F442570

General Info

Members Datasets Scaffolds Average Seq Length
432 263 431 363

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100175501|Ga0075428_1001755013
Length 398
Sequence MTAVRVLVGTKKGAFVLTSDGKRDKWKVEGPHFAGWEIYHLKASPVDPNRIYASQTSGWFGQIMQRSDDGGKTWHAPGSKPEELVGEMGMPKGESNKFVYNDDPKKGGKPLTTHQFYDGTQKPWVFKRVWHIEPSLNDPDTAYAGVEDAAIFKTTDGGKAWNELAGLRGHGTGPQWSPGAGGLGLHTILIDPKNPKRIYIAISAAGCFRTDDGGNSWKPINQGLKSEYIPDPTAEVGHCVHRIALHPSKPDTLFMQKHWDVMRSDNAGDTWTEVSGNLPTDFGFPIDVHAHQPETIYVVPITSDSLHYPPEGKLRVYRSKTGGNDDKGWEPLTKGLPQQDCYVNVLRDAMCVDTLDPCGVYFGTSGGQVYASSNGGDSWSPIVRDLPGVLSVEVQTIN

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
155 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 1.85
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 3.24
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002565 3300001976 Bacteria 2420
2 JGI24034J26672_10002694 3300002239 Bacteria 2448
3 Ga0065712_10024680 3300005290 Bacteria 2874
4 Ga0065712_10079196 3300005290 Unclassified 3247
5 Ga0065715_10011829 3300005293 Bacteria 2530
6 Ga0065715_10100945 3300005293 Bacteria 3252
7 Ga0065707_10005132 3300005295 Bacteria 3275
8 Ga0065707_10170658 3300005295 Bacteria 1487
9 Ga0070658_10000949 3300005327 Bacteria 24773
10 Ga0070658_10058938 3300005327 Bacteria 3126
11 Ga0070676_10011045 3300005328 Bacteria 4908
12 Ga0070683_100043621 3300005329 Bacteria 4134
13 Ga0070683_100320607 3300005329 Bacteria 1475
14 Ga0070690_100015512 3300005330 Bacteria 4548
15 Ga0070670_100180647 3300005331 Bacteria 1832
16 Ga0070670_100199375 3300005331 Bacteria 1739
17 Ga0070677_10052998 3300005333 Bacteria 1648
18 Ga0068869_100002057 3300005334 Bacteria 12093
19 Ga0070682_100005894 3300005337 Bacteria 6850
20 Ga0070682_100051574 3300005337 Bacteria 2571
21 Ga0070660_100001305 3300005339 Bacteria 16998
22 Ga0070689_100009107 3300005340 Bacteria 7029
23 Ga0070661_100038717 3300005344 Bacteria 3472
24 Ga0070668_100139594 3300005347 Bacteria 1952
25 Ga0070675_100000046 3300005354 Bacteria 76244
26 Ga0070675_100092131 3300005354 Bacteria 2540
27 Ga0070675_100139008 3300005354 Bacteria 2075
28 Ga0070675_100209394 3300005354 Bacteria 1694
29 Ga0070671_100011888 3300005355 Bacteria 7000
30 Ga0070671_100140432 3300005355 Unclassified 2038
31 Ga0070674_100120037 3300005356 Bacteria 1945
32 Ga0070674_100166385 3300005356 Bacteria 1677
33 Ga0070673_100002117 3300005364 Bacteria 12008
34 Ga0070673_100017445 3300005364 Bacteria 5106
35 Ga0070688_100022859 3300005365 Bacteria 3670
36 Ga0070659_100093362 3300005366 Bacteria 2415
37 Ga0070714_100028197 3300005435 Bacteria 4656
38 Ga0070714_100098451 3300005435 Bacteria 2573
39 Ga0070714_100105856 3300005435 Bacteria 2484
40 Ga0070714_100200724 3300005435 Bacteria 1824
41 Ga0070713_100073928 3300005436 Bacteria 2886
42 Ga0070710_10108055 3300005437 Bacteria 1667
43 Ga0070705_100039384 3300005440 Bacteria 2681
44 Ga0070700_100014627 3300005441 Bacteria 4434
45 Ga0070708_100040767 3300005445 Bacteria 4068
46 Ga0070708_100118562 3300005445 Bacteria 2438
47 Ga0070708_100281767 3300005445 Bacteria 1564
48 Ga0070678_100140382 3300005456 Bacteria 1932
49 Ga0070706_100063258 3300005467 Bacteria 3419
50 Ga0070706_100153153 3300005467 Bacteria 2152
51 Ga0070706_100194470 3300005467 Bacteria 1895
52 Ga0070707_100006910 3300005468 Bacteria 10512
53 Ga0070707_100022134 3300005468 Bacteria 6009
54 Ga0070707_100022427 3300005468 Bacteria 5970
55 Ga0070707_100051131 3300005468 Bacteria 3961
56 Ga0070707_100062853 3300005468 Bacteria 3562
57 Ga0070707_100140634 3300005468 Bacteria 2349
58 Ga0070707_100200634 3300005468 Bacteria 1944
59 Ga0070698_100011215 3300005471 Bacteria 9523
60 Ga0070698_100219462 3300005471 Bacteria 1835
61 Ga0070699_100000683 3300005518 Bacteria 31621
62 Ga0070699_100002029 3300005518 Bacteria 18283
63 Ga0070699_100024342 3300005518 Bacteria 5217
64 Ga0070699_100038649 3300005518 Bacteria 4132
65 Ga0070679_100125876 3300005530 Bacteria 2545
66 Ga0070679_100187617 3300005530 Bacteria 2037
67 Ga0070697_100000060 3300005536 Bacteria 86138
68 Ga0070697_100002139 3300005536 Bacteria 15148
69 Ga0070697_100007718 3300005536 Bacteria 8381
70 Ga0070697_100031429 3300005536 Bacteria 4271
71 Ga0070697_100069874 3300005536 Bacteria 2878
72 Ga0070697_100110767 3300005536 Bacteria 2287
73 Ga0070697_100139864 3300005536 Bacteria 2035
74 Ga0070697_100270383 3300005536 Bacteria 1457
75 Ga0070697_100289520 3300005536 Bacteria 1406
76 Ga0068853_100000004 3300005539 Bacteria 405732
77 Ga0070672_100028725 3300005543 Bacteria 4162
78 Ga0070695_100006076 3300005545 Bacteria 7136
79 Ga0070665_100077570 3300005548 Bacteria 3329
80 Ga0068855_100302894 3300005563 Bacteria 1770
81 Ga0070664_100329627 3300005564 Bacteria 1384
82 Ga0068857_100005254 3300005577 Bacteria 11025
83 Ga0068857_100024986 3300005577 Bacteria 5262
84 Ga0068854_100018882 3300005578 Bacteria 4636
85 Ga0068856_100042031 3300005614 Bacteria 4495
86 Ga0068856_100193535 3300005614 Bacteria 2047
87 Ga0068852_100014600 3300005616 Bacteria 6054
88 Ga0068852_100469723 3300005616 Bacteria 1248
89 Ga0068859_100368025 3300005617 Bacteria 1533
90 Ga0068864_100082549 3300005618 Bacteria 2820
91 Ga0068866_10123933 3300005718 Bacteria 1460
92 Ga0068861_100031147 3300005719 Bacteria 3915
93 Ga0068851_10005404 3300005834 Bacteria 5795
94 Ga0068870_10092663 3300005840 Bacteria 1692
95 Ga0068870_10109364 3300005840 Bacteria 1576
96 Ga0068863_100045293 3300005841 Bacteria 4175
97 Ga0068858_100069985 3300005842 Bacteria 3252
98 Ga0068858_100096038 3300005842 Bacteria 2762
99 Ga0068860_100032118 3300005843 Bacteria 5047
100 Ga0068862_100048246 3300005844 Bacteria 3635
101 Ga0070717_10000647 3300006028 Bacteria 22354
102 Ga0097621_100063816 3300006237 Bacteria 3028
103 Ga0097621_100221190 3300006237 Bacteria 1650
104 Ga0068871_100014302 3300006358 Bacteria 5913
105 Ga0068871_100043002 3300006358 Bacteria 3629
106 Ga0068871_100215252 3300006358 Bacteria 1663
107 Ga0075428_100009297 3300006844 Bacteria 10897
108 Ga0075428_100018609 3300006844 Bacteria 7677
109 Ga0075428_100175501 3300006844 Bacteria 2321
110 Ga0075431_100009287 3300006847 Bacteria 9865
111 Ga0075433_10007524 3300006852 Bacteria 8643
112 Ga0075433_10040897 3300006852 Bacteria 4015
113 Ga0075433_10264237 3300006852 Bacteria 1525
114 Ga0075434_100006535 3300006871 Bacteria 10692
115 Ga0075434_100084113 3300006871 Bacteria 3180
116 Ga0075434_100299932 3300006871 Bacteria 1627
117 Ga0075429_100025483 3300006880 Bacteria 5132
118 Ga0075436_100024450 3300006914 Bacteria 4152
119 Ga0075436_100125298 3300006914 Bacteria 1799
120 Ga0097620_100368024 3300006931 Bacteria 1533
121 Ga0075435_100090603 3300007076 Bacteria 2523
122 Ga0075435_100102772 3300007076 Bacteria 2369
123 Ga0075435_100145814 3300007076 Bacteria 1988
124 Ga0105240_10013461 3300009093 Bacteria 11234
125 Ga0105240_10039963 3300009093 Bacteria 6005
126 Ga0111539_10000077 3300009094 Bacteria 98027
127 Ga0105245_10009908 3300009098 Bacteria 8299
128 Ga0105245_10018069 3300009098 Bacteria 6161
129 Ga0105245_10113515 3300009098 Bacteria 2523
130 Ga0105245_10143847 3300009098 Bacteria 2249
131 Ga0105247_10005265 3300009101 Bacteria 8163
132 Ga0114129_10013693 3300009147 Bacteria 11557
133 Ga0114129_10148556 3300009147 Bacteria 3209
134 Ga0114129_10381473 3300009147 Bacteria 1861
135 Ga0105242_10018248 3300009176 Bacteria 5483
136 Ga0105248_10000003 3300009177 Bacteria 1019601
137 Ga0105248_10075840 3300009177 Unclassified 3779
138 Ga0105248_10077705 3300009177 Bacteria 3732
139 Ga0105248_10207883 3300009177 Bacteria 2205
140 Ga0105248_10288019 3300009177 Bacteria 1849
141 Ga0105237_10003745 3300009545 Bacteria 17911
142 Ga0105238_10058267 3300009551 Bacteria 3872
143 Ga0105249_10022601 3300009553 Bacteria 5635
144 Ga0105239_10023993 3300010375 Bacteria 6718
145 Ga0105239_10406269 3300010375 Bacteria 1541
146 Ga0105239_10472180 3300010375 Bacteria 1424
147 Ga0105246_10028989 3300011119 Bacteria 3640
148 Ga0157371_10054137 3300013102 Unclassified 2850
149 Ga0157369_10227534 3300013105 Bacteria 1951
150 Ga0157374_10252774 3300013296 Bacteria 1735
151 Ga0157378_10005809 3300013297 Bacteria 10817
152 Ga0157378_10051162 3300013297 Bacteria 3676
153 Ga0163162_10031369 3300013306 Bacteria 5271
154 Ga0163162_10035593 3300013306 Unclassified 4960
155 Ga0157375_10036926 3300013308 Bacteria 4677
156 Ga0157375_10206757 3300013308 Bacteria 2119
157 Ga0157375_10298119 3300013308 Bacteria 1776
158 Ga0163163_10037711 3300014325 Bacteria 4703
159 Ga0163163_10052639 3300014325 Bacteria 4017
160 Ga0163163_10058885 3300014325 Bacteria 3798
161 Ga0157377_10000604 3300014745 Bacteria 14890
162 Ga0157379_10180063 3300014968 Bacteria 1909
163 Ga0157376_10055942 3300014969 Bacteria 3294
164 Ga0157376_10213337 3300014969 Bacteria 1784
165 Ga0163161_10010955 3300017792 Bacteria 6284
166 Ga0163161_10011639 3300017792 Bacteria 6107
167 Ga0197907_11040071 3300020069 Bacteria 1325
168 Ga0206351_10609679 3300020077 Bacteria 1399
169 Ga0206351_10743917 3300020077 Bacteria 1314
170 Ga0206350_10144234 3300020080 Bacteria 2521
171 Ga0206353_11735744 3300020082 Bacteria 1448
172 Ga0154015_1255813 3300020610 Bacteria 1637
173 Ga0213875_10004731 3300021388 Bacteria 7406
174 Ga0224712_10055467 3300022467 Bacteria 1559
175 Ga0224712_10057960 3300022467 Bacteria 1532
176 Ga0224572_1020873 3300024225 Bacteria 1258
177 Ga0207697_10010526 3300025315 Bacteria 3950
178 Ga0207697_10065443 3300025315 Bacteria 1517
179 Ga0207656_10007939 3300025321 Bacteria 3890
180 Ga0207653_10026077 3300025885 Bacteria 1873
181 Ga0207682_10023559 3300025893 Bacteria 2432
182 Ga0207642_10017431 3300025899 Bacteria 2731
183 Ga0207642_10162325 3300025899 Bacteria 1201
184 Ga0207710_10024042 3300025900 Unclassified 2622
185 Ga0207688_10026428 3300025901 Bacteria 3191
186 Ga0207647_10014154 3300025904 Bacteria 5507
187 Ga0207645_10003125 3300025907 Bacteria 12696
188 Ga0207645_10053244 3300025907 Bacteria 2586
189 Ga0207643_10001093 3300025908 Bacteria 16060
190 Ga0207643_10008167 3300025908 Bacteria 5617
191 Ga0207643_10020154 3300025908 Bacteria 3659
192 Ga0207643_10066260 3300025908 Bacteria 2071
193 Ga0207705_10019850 3300025909 Bacteria 4807
194 Ga0207684_10000001 3300025910 Bacteria 1115726
195 Ga0207684_10000162 3300025910 Bacteria 114838
196 Ga0207684_10032484 3300025910 Bacteria 4438
197 Ga0207684_10120311 3300025910 Bacteria 2251
198 Ga0207684_10266895 3300025910 Bacteria 1477
199 Ga0207707_10202807 3300025912 Bacteria 1729
200 Ga0207657_10002871 3300025919 Bacteria 18515
201 Ga0207649_10001017 3300025920 Bacteria 17305
202 Ga0207649_10063018 3300025920 Bacteria 2339
203 Ga0207652_10081426 3300025921 Bacteria 2832
204 Ga0207646_10012198 3300025922 Bacteria 8269
205 Ga0207646_10036350 3300025922 Bacteria 4446
206 Ga0207646_10049522 3300025922 Bacteria 3763
207 Ga0207646_10110591 3300025922 Bacteria 2465
208 Ga0207681_10011230 3300025923 Bacteria 5501
209 Ga0207681_10025337 3300025923 Bacteria 3814
210 Ga0207694_10238175 3300025924 Bacteria 1487
211 Ga0207650_10000051 3300025925 Bacteria 168652
212 Ga0207659_10000183 3300025926 Bacteria 37254
213 Ga0207659_10012088 3300025926 Bacteria 5475
214 Ga0207659_10097473 3300025926 Bacteria 2209
215 Ga0207687_10081786 3300025927 Bacteria 2335
216 Ga0207700_10300925 3300025928 Bacteria 1385
217 Ga0207664_10002892 3300025929 Bacteria 11415
218 Ga0207644_10006972 3300025931 Bacteria 7358
219 Ga0207690_10049967 3300025932 Bacteria 2790
220 Ga0207706_10006949 3300025933 Bacteria 10464
221 Ga0207670_10020207 3300025936 Bacteria 4087
222 Ga0207670_10042400 3300025936 Bacteria 2998
223 Ga0207669_10106261 3300025937 Bacteria 1869
224 Ga0207669_10149150 3300025937 Bacteria 1635
225 Ga0207665_10060954 3300025939 Bacteria 2556
226 Ga0207665_10068725 3300025939 Bacteria 2414
227 Ga0207665_10092325 3300025939 Bacteria 2100
228 Ga0207691_10021810 3300025940 Bacteria 6046
229 Ga0207691_10085365 3300025940 Bacteria 2833
230 Ga0207711_10000012 3300025941 Bacteria 515147
231 Ga0207711_10185356 3300025941 Unclassified 1894
232 Ga0207689_10000184 3300025942 Bacteria 54232
233 Ga0207661_10000122 3300025944 Bacteria 49562
234 Ga0207661_10346836 3300025944 Bacteria 1339
235 Ga0207679_10000101 3300025945 Bacteria 71096
236 Ga0207679_10080324 3300025945 Bacteria 2490
237 Ga0207667_10033856 3300025949 Bacteria 5490
238 Ga0207667_10247462 3300025949 Bacteria 1824
239 Ga0207651_10053963 3300025960 Bacteria 2751
240 Ga0207651_10197829 3300025960 Bacteria 1608
241 Ga0207640_10024018 3300025981 Bacteria 3672
242 Ga0207677_10009250 3300026023 Bacteria 5535
243 Ga0207703_10065210 3300026035 Bacteria 2992
244 Ga0207703_10083252 3300026035 Bacteria 2672
245 Ga0207639_10000002 3300026041 Bacteria 903066
246 Ga0207639_10038436 3300026041 Bacteria 3560
247 Ga0207678_10033626 3300026067 Bacteria 4466
248 Ga0207678_10095126 3300026067 Bacteria 2546
249 Ga0207708_10036747 3300026075 Bacteria 3730
250 Ga0207702_10082499 3300026078 Unclassified 2795
251 Ga0207702_10152612 3300026078 Bacteria 2103
252 Ga0207641_10000006 3300026088 Bacteria 442569
253 Ga0207648_10006908 3300026089 Bacteria 11245
254 Ga0207676_10000155 3300026095 Bacteria 59757
255 Ga0207674_10000537 3300026116 Bacteria 49684
256 Ga0207674_10015550 3300026116 Bacteria 8358
257 Ga0207674_10118037 3300026116 Bacteria 2623
258 Ga0207675_100042206 3300026118 Bacteria 4257
259 Ga0207675_100298411 3300026118 Bacteria 1569
260 Ga0207683_10022849 3300026121 Bacteria 5373
261 Ga0207683_10085480 3300026121 Bacteria 2804
262 Ga0207683_10174703 3300026121 Bacteria 1946
263 Ga0207698_10005572 3300026142 Bacteria 7786
264 Ga0207428_10016670 3300027907 Bacteria 6318
265 Ga0268266_10117877 3300028379 Unclassified 2359
266 Ga0268266_10125096 3300028379 Bacteria 2293
267 Ga0268265_10012466 3300028380 Bacteria 5760
268 Ga0268265_10101324 3300028380 Bacteria 2327
269 Ga0268265_10398492 3300028380 Bacteria 1271
270 Ga0265322_10000143 3300028654 Bacteria 33417
271 Ga0265336_10020098 3300028666 Bacteria 2148
272 Ga0265338_10170579 3300028800 Bacteria 1669
273 Ga0265325_10003154 3300031241 Bacteria 10852
274 Ga0265325_10034692 3300031241 Bacteria 2683
275 Ga0265331_10024743 3300031250 Bacteria 3035
276 Ga0265313_10064778 3300031595 Bacteria 1699
277 Ga0265314_10035188 3300031711 Bacteria 3653
278 Ga0265342_10042728 3300031712 Bacteria 2737
279 Ga0316578_10105713 3300031728 Bacteria 1689
280 Ga0373934_0000259 3300035086 Bacteria 19013
281 Ga0373923_0006427 3300035111 Bacteria 4063
282 Ga0373936_0041951 3300035113 Bacteria 1836
283 Ga0373956_0000569 3300035119 Bacteria 15103
284 Ga0373935_0066467 3300035692 Bacteria 2316
285 Ga0373933_0000530 3300035724 Bacteria 23770
286 Ga0373947_0047497 3300035725 Bacteria 2572
287 Ga0373937_0085700 3300036401 Bacteria 2915
288 Ga0373937_0553967 3300036401 Bacteria 1092
289 Ga0316584_0181109 3300036712 Bacteria 1560
290 Ga0373925_0100046 3300037068 Bacteria 2228
291 Ga0395900_0007249 3300037418 Bacteria 11481
292 Ga0395905_0071815 3300037471 Bacteria 3245
293 Ga0436364_0568464 3300037853 Bacteria 24121
294 Ga0436365_0155012 3300039437 Bacteria 1676
295 Ga0436360_0422378 3300039438 Bacteria 10003
296 Ga0436360_0723407 3300039438 Bacteria 2177
297 Ga0436363_0180919 3300039450 Bacteria 2139
298 Ga0439453_0001805 3300041408 Bacteria 2835
299 Ga0439435_0006296 3300042436 Bacteria 2661
300 Ga0439460_0015422 3300042461 Bacteria 2023
301 Ga0451577_0009034 3300042876 Bacteria 9622
302 Ga0453683_0005482 3300044673 Bacteria 8851
303 Ga0466963_0064857 3300044694 Bacteria 2448
304 Ga0453684_0001868 3300044712 Bacteria 54857
305 Ga0453684_0276323 3300044712 Bacteria 1917
306 Ga0453684_0352825 3300044712 Bacteria 1658
307 Ga0466957_0139280 3300044842 Bacteria 1562
308 Ga0451576_0002401 3300045051 Bacteria 28123
309 Ga0451576_0006636 3300045051 Bacteria 14134
310 Ga0466967_0216720 3300045976 Bacteria 1817
311 Ga0466967_0325187 3300045976 Bacteria 1484
312 Ga0495592_0032881 3300046454 Bacteria 3912
313 Ga0495641_0036061 3300046461 Bacteria 2327
314 Ga0495651_0001072 3300046462 Bacteria 21066
315 Ga0495651_0003578 3300046462 Bacteria 11918
316 Ga0495653_0000533 3300046463 Bacteria 29147
317 Ga0495653_0010146 3300046463 Bacteria 7705
318 Ga0495662_0127242 3300046476 Bacteria 1252
319 Ga0495664_0076072 3300046477 Bacteria 2009
320 Ga0495608_0000171 3300046511 Bacteria 46179
321 Ga0495608_0005341 3300046511 Bacteria 9181
322 Ga0495618_0161486 3300046514 Bacteria 1428
323 Ga0495628_0001985 3300046516 Bacteria 18552
324 Ga0495630_0174257 3300046517 Bacteria 1640
325 Ga0495630_0214951 3300046517 Bacteria 1467
326 Ga0495643_0000329 3300046522 Bacteria 65145
327 Ga0495652_0152991 3300046529 Bacteria 1800
328 Ga0495665_0028046 3300046531 Bacteria 3021
329 Ga0495640_0034410 3300046533 Bacteria 3593
330 Ga0495640_0057526 3300046533 Bacteria 2653
331 Ga0495640_0106887 3300046533 Bacteria 1832
332 Ga0495586_0019636 3300046535 Bacteria 3599
333 Ga0495586_0029560 3300046535 Bacteria 2933
334 Ga0495586_0056579 3300046535 Bacteria 2127
335 Ga0495587_0001549 3300046536 Bacteria 15276
336 Ga0495587_0040282 3300046536 Bacteria 2793
337 Ga0495645_0000557 3300046543 Bacteria 25603
338 Ga0495645_0139080 3300046543 Bacteria 1696
339 Ga0495667_0001252 3300046559 Bacteria 16648
340 Ga0495667_0014149 3300046559 Bacteria 5386
341 Ga0495667_0051417 3300046559 Bacteria 2718
342 Ga0495667_0120270 3300046559 Bacteria 1696
343 Ga0495635_0000238 3300046663 Bacteria 34935
344 Ga0495635_0089154 3300046663 Bacteria 2110
345 Ga0495635_0109818 3300046663 Bacteria 1884
346 Ga0495657_0000272 3300046675 Bacteria 46662
347 Ga0495599_0004198 3300046678 Bacteria 8506
348 Ga0495599_0015981 3300046678 Bacteria 4658
349 Ga0495599_0082980 3300046678 Bacteria 2002
350 Ga0495623_0003495 3300046679 Bacteria 10398
351 Ga0495646_0010674 3300046680 Bacteria 5835
352 Ga0495646_0081465 3300046680 Bacteria 1886
353 Ga0495613_0072994 3300046689 Bacteria 2501
354 Ga0495589_0085979 3300046794 Bacteria 1528
355 Ga0495600_0000187 3300046809 Bacteria 35919
356 Ga0495600_0003466 3300046809 Bacteria 9282
357 Ga0495581_0053601 3300047315 Bacteria 2329
358 Ga0495604_0002842 3300047317 Bacteria 13895
359 Ga0495604_0079337 3300047317 Bacteria 2462
360 Ga0495674_0002377 3300047319 Bacteria 18413
361 Ga0495674_0009201 3300047319 Bacteria 9386
362 Ga0495674_0066440 3300047319 Bacteria 3128
363 Ga0495674_0081941 3300047319 Bacteria 2767
364 Ga0495672_0062177 3300047320 Bacteria 2149
365 Ga0495680_0002400 3300047322 Bacteria 19224
366 Ga0495675_0000052 3300047444 Bacteria 79959
367 Ga0495684_0002150 3300047471 Bacteria 15793
368 Ga0495684_0007925 3300047471 Bacteria 8215
369 Ga0495684_0091335 3300047471 Bacteria 2306
370 Ga0495602_0251652 3300048088 Bacteria 1316
371 Ga0496102_0073134 3300048905 Unclassified 3151
372 Ga0496104_0184870 3300048907 Unclassified 1995
373 Ga0496104_0301261 3300048907 Bacteria 1515
374 Ga0496107_0228440 3300048910 Bacteria 1385
375 Ga0496108_0000258 3300048911 Bacteria 45782
376 Ga0496108_0149940 3300048911 Bacteria 2012
377 Ga0496109_0000126 3300048912 Bacteria 77920
378 Ga0496109_0178141 3300048912 Bacteria 1996
379 Ga0496110_0187153 3300048913 Bacteria 1880
380 Ga0496111_0000724 3300048914 Bacteria 17595
381 Ga0496112_0000081 3300048915 Bacteria 62594
382 Ga0496112_0287614 3300048915 Bacteria 1590
383 Ga0496113_0001980 3300048916 Bacteria 11735
384 Ga0496114_0000868 3300048917 Bacteria 22624
385 Ga0501032_0000141 3300049569 Bacteria 58799
386 Ga0501033_0000001 3300049570 Bacteria 795921
387 Ga0501033_0003741 3300049570 Bacteria 12372
388 Ga0501034_0014716 3300049571 Bacteria 8052
389 Ga0501034_0031033 3300049571 Bacteria 5431
390 Ga0501034_0107946 3300049571 Bacteria 2775
391 Ga0501034_0128521 3300049571 Bacteria 2518
392 Ga0501038_0001171 3300049574 Bacteria 23805
393 Ga0501039_0053827 3300049575 Bacteria 3115
394 Ga0501043_0027719 3300049579 Bacteria 4447
395 Ga0501046_0009072 3300049580 Bacteria 8624
396 Ga0501046_0040051 3300049580 Bacteria 3747
397 Ga0501047_0197146 3300049581 Bacteria 1875
398 Ga0501070_0000452 3300049586 Bacteria 37359
399 Ga0501070_0061172 3300049586 Bacteria 3120
400 Ga0501072_0073217 3300049588 Bacteria 2709
401 Ga0501073_0009561 3300049589 Bacteria 7150
402 Ga0501075_0011236 3300049591 Bacteria 6334
403 Ga0501076_0003577 3300049592 Bacteria 10914
404 Ga0501077_0006444 3300049593 Bacteria 7205
405 Ga0501079_0017554 3300049741 Bacteria 5465
406 Ga0501083_0100156 3300049744 Bacteria 1911
407 Ga0501035_0303452 3300049822 Bacteria 1345
408 Ga0501044_0008959 3300049823 Bacteria 10939
409 Ga0501044_0071281 3300049823 Bacteria 3534
410 Ga0501044_0098651 3300049823 Bacteria 2941
411 nmdc:mga05p37_38560_c1 3300050507 Bacteria 5861
412 nmdc:mga06r32_2264_c1 3300050510 Bacteria 17209
413 nmdc:mga06r32_8449_c1 3300050510 Bacteria 9280
414 nmdc:mga08y16_261882_c1 3300050511 Bacteria 1786
415 nmdc:mga08y16_3101_c1 3300050511 Bacteria 17200
416 nmdc:mga0n895_13955_c1 3300050512 Bacteria 7276
417 nmdc:mga0n895_3988_c1 3300050512 Bacteria 11999
418 nmdc:mga0rr50_136533_c1 3300050513 Bacteria 1969
419 nmdc:mga0rr50_25597_c1 3300050513 Bacteria 4104
420 nmdc:mga0rr50_88925_c1 3300050513 Bacteria 2401
421 nmdc:mga08x19_47008_c1 3300050514 Bacteria 2762
422 nmdc:mga08x19_54641_c1 3300050514 Bacteria 2572
423 nmdc:mga0a205_25561_c2 3300050515 Bacteria 3265
424 nmdc:mga0a205_8026_c1 3300050515 Bacteria 9594
425 Ga0495601_0004275 3300053077 Bacteria 8248
426 Ga0495601_0128543 3300053077 Bacteria 1649
427 Ga0495612_0000987 3300053078 Bacteria 11688
428 Ga0495619_0108072 3300053085 Bacteria 1898
429 Ga0500644_0020582 3300053088 Bacteria 1963
430 Ga0500595_000023 3300053119 Bacteria 147097
431 Ga0501084_0085711 3300054114 Bacteria 2645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0723407 Ga0436360_0723407_1095_2060 301
2 3300049575 Ga0501039_0053827 Ga0501039_0053827_306_1298 310
3 3300049588 Ga0501072_0073217 Ga0501072_0073217_1608_2600 310
4 3300049591 Ga0501075_0011236 Ga0501075_0011236_224_1216 310
5 3300049592 Ga0501076_0003577 Ga0501076_0003577_9864_10856 310
6 3300049593 Ga0501077_0006444 Ga0501077_0006444_1624_2616 310
7 3300049741 Ga0501079_0017554 Ga0501079_0017554_2864_3856 310
8 3300049744 Ga0501083_0100156 Ga0501083_0100156_176_1168 310
9 3300049822 Ga0501035_0303452 Ga0501035_0303452_169_1161 310
10 3300054114 Ga0501084_0085711 Ga0501084_0085711_59_1051 310
11 3300009093 Ga0105240_10039963 Ga0105240_100399632 311
12 3300009545 Ga0105237_10003745 Ga0105237_1000374519 311
13 3300046536 Ga0495587_0001549 Ga0495587_0001549_14239_15234 311
14 3300050511 nmdc:mga08y16_261882_c1 nmdc:mga08y16_261882_c1_32_1036 314
15 3300037068 Ga0373925_0100046 Ga0373925_0100046_356_1420 321
16 3300005564 Ga0070664_100329627 Ga0070664_1003296271 323
17 3300044673 Ga0453683_0005482 Ga0453683_0005482_56_1126 323
18 3300005331 Ga0070670_100180647 Ga0070670_1001806471 328
19 3300005355 Ga0070671_100011888 Ga0070671_1000118889 328
20 3300005356 Ga0070674_100120037 Ga0070674_1001200372 328
21 3300005548 Ga0070665_100077570 Ga0070665_1000775704 328
22 3300005841 Ga0068863_100045293 Ga0068863_1000452937 328
23 3300006237 Ga0097621_100063816 Ga0097621_1000638161 328
24 3300006358 Ga0068871_100014302 Ga0068871_1000143028 328
25 3300009177 Ga0105248_10288019 Ga0105248_102880191 328
26 3300010375 Ga0105239_10472180 Ga0105239_104721801 328
27 3300014969 Ga0157376_10055942 Ga0157376_100559422 328
28 3300025937 Ga0207669_10106261 Ga0207669_101062612 328
29 3300026121 Ga0207683_10022849 Ga0207683_100228491 328
30 3300028379 Ga0268266_10125096 Ga0268266_101250962 328
31 3300006871 Ga0075434_100299932 Ga0075434_1002999322 329
32 3300045976 Ga0466967_0216720 Ga0466967_0216720_740_1789 329
33 3300037418 Ga0395900_0007249 Ga0395900_0007249_6554_7699 332
34 3300005293 Ga0065715_10011829 Ga0065715_100118291 334
35 3300005445 Ga0070708_100040767 Ga0070708_1000407676 334
36 3300035113 Ga0373936_0041951 Ga0373936_0041951_400_1515 334
37 3300036401 Ga0373937_0553967 Ga0373937_0553967_13_1080 334
38 3300049571 Ga0501034_0031033 Ga0501034_0031033_4234_5301 335
39 3300006852 Ga0075433_10040897 Ga0075433_100408973 336
40 3300050515 nmdc:mga0a205_25561_c2 nmdc:mga0a205_25561_c2_35_1150 336
41 3300005467 Ga0070706_100153153 Ga0070706_1001531532 338
42 3300005471 Ga0070698_100219462 Ga0070698_1002194622 338
43 3300005518 Ga0070699_100038649 Ga0070699_1000386492 338
44 3300005718 Ga0068866_10123933 Ga0068866_101239331 338
45 3300005843 Ga0068860_100032118 Ga0068860_1000321185 338
46 3300007076 Ga0075435_100090603 Ga0075435_1000906032 338
47 3300025910 Ga0207684_10120311 Ga0207684_101203112 338
48 3300025922 Ga0207646_10110591 Ga0207646_101105912 338
49 3300025939 Ga0207665_10068725 Ga0207665_100687252 338
50 3300026035 Ga0207703_10083252 Ga0207703_100832521 338
51 3300050512 nmdc:mga0n895_13955_c1 nmdc:mga0n895_13955_c1_225_1355 338
52 3300050513 nmdc:mga0rr50_25597_c1 nmdc:mga0rr50_25597_c1_252_1382 338
53 3300050515 nmdc:mga0a205_8026_c1 nmdc:mga0a205_8026_c1_214_1329 339
54 3300006852 Ga0075433_10007524 Ga0075433_100075246 340
55 3300006871 Ga0075434_100084113 Ga0075434_1000841132 340
56 3300007076 Ga0075435_100145814 Ga0075435_1001458142 340
57 3300025945 Ga0207679_10080324 Ga0207679_100803243 340
58 3300050513 nmdc:mga0rr50_88925_c1 nmdc:mga0rr50_88925_c1_797_1912 340
59 3300050514 nmdc:mga08x19_47008_c1 nmdc:mga08x19_47008_c1_1438_2553 340
60 3300005347 Ga0070668_100139594 Ga0070668_1001395942 341
61 3300049586 Ga0501070_0061172 Ga0501070_0061172_1143_2258 341
62 3300009177 Ga0105248_10077705 Ga0105248_100777052 344
63 3300046517 Ga0495630_0174257 Ga0495630_0174257_464_1579 344
64 3300046533 Ga0495640_0034410 Ga0495640_0034410_1790_2905 344
65 3300047319 Ga0495674_0009201 Ga0495674_0009201_335_1450 344
66 3300050513 nmdc:mga0rr50_136533_c1 nmdc:mga0rr50_136533_c1_280_1374 344
67 3300050514 nmdc:mga08x19_54641_c1 nmdc:mga08x19_54641_c1_413_1507 344
68 3300028800 Ga0265338_10170579 Ga0265338_101705792 345
69 3300031241 Ga0265325_10003154 Ga0265325_100031548 345
70 3300031241 Ga0265325_10034692 Ga0265325_100346922 345
71 3300031595 Ga0265313_10064778 Ga0265313_100647781 345
72 3300031712 Ga0265342_10042728 Ga0265342_100427283 345
73 3300046535 Ga0495586_0019636 Ga0495586_0019636_1747_2916 345
74 3300005354 Ga0070675_100139008 Ga0070675_1001390083 346
75 3300005617 Ga0068859_100368025 Ga0068859_1003680252 346
76 3300006931 Ga0097620_100368024 Ga0097620_1003680242 346
77 3300025926 Ga0207659_10097473 Ga0207659_100974732 346
78 3300025940 Ga0207691_10085365 Ga0207691_100853653 346
79 3300044712 Ga0453684_0352825 Ga0453684_0352825_354_1469 346
80 3300046514 Ga0495618_0161486 Ga0495618_0161486_98_1213 346
81 3300046533 Ga0495640_0057526 Ga0495640_0057526_1198_2313 346
82 3300046535 Ga0495586_0029560 Ga0495586_0029560_399_1514 346
83 3300046559 Ga0495667_0051417 Ga0495667_0051417_285_1400 346
84 3300046663 Ga0495635_0089154 Ga0495635_0089154_506_1621 346
85 3300046680 Ga0495646_0081465 Ga0495646_0081465_349_1464 346
86 3300048088 Ga0495602_0251652 Ga0495602_0251652_98_1213 346
87 3300045976 Ga0466967_0325187 Ga0466967_0325187_169_1275 347
88 3300048911 Ga0496108_0149940 Ga0496108_0149940_21_1127 347
89 3300048912 Ga0496109_0178141 Ga0496109_0178141_869_1975 347
90 3300048913 Ga0496110_0187153 Ga0496110_0187153_537_1643 347
91 iso_pu_bacteria 2582580736 2583153485 347
92 3300048907 Ga0496104_0301261 Ga0496104_0301261_321_1412 349
93 3300005290 Ga0065712_10024680 Ga0065712_100246801 350
94 3300005293 Ga0065715_10100945 Ga0065715_101009452 350
95 3300005295 Ga0065707_10005132 Ga0065707_100051322 350
96 3300005329 Ga0070683_100320607 Ga0070683_1003206071 350
97 3300005331 Ga0070670_100199375 Ga0070670_1001993752 350
98 3300005333 Ga0070677_10052998 Ga0070677_100529981 350
99 3300005337 Ga0070682_100051574 Ga0070682_1000515742 350
100 3300005354 Ga0070675_100000046 Ga0070675_10000004652 350
101 3300005354 Ga0070675_100209394 Ga0070675_1002093943 350
102 3300005364 Ga0070673_100002117 Ga0070673_1000021174 350
103 3300005366 Ga0070659_100093362 Ga0070659_1000933622 350
104 3300005456 Ga0070678_100140382 Ga0070678_1001403822 350
105 3300005536 Ga0070697_100007718 Ga0070697_1000077182 350
106 3300005614 Ga0068856_100193535 Ga0068856_1001935352 350
107 3300005616 Ga0068852_100469723 Ga0068852_1004697231 350
108 3300005840 Ga0068870_10109364 Ga0068870_101093642 350
109 3300006844 Ga0075428_100018609 Ga0075428_1000186092 350
110 3300006871 Ga0075434_100006535 Ga0075434_1000065355 350
111 3300009098 Ga0105245_10009908 Ga0105245_100099085 350
112 3300009177 Ga0105248_10207883 Ga0105248_102078832 350
113 3300010375 Ga0105239_10406269 Ga0105239_104062692 350
114 3300013296 Ga0157374_10252774 Ga0157374_102527742 350
115 3300013297 Ga0157378_10005809 Ga0157378_1000580912 350
116 3300013306 Ga0163162_10031369 Ga0163162_100313693 350
117 3300013308 Ga0157375_10036926 Ga0157375_100369263 350
118 3300013308 Ga0157375_10298119 Ga0157375_102981192 350
119 3300017792 Ga0163161_10011639 Ga0163161_100116395 350
120 3300020082 Ga0206353_11735744 Ga0206353_117357442 350
121 3300025315 Ga0207697_10065443 Ga0207697_100654432 350
122 3300025893 Ga0207682_10023559 Ga0207682_100235592 350
123 3300025899 Ga0207642_10162325 Ga0207642_101623251 350
124 3300025907 Ga0207645_10053244 Ga0207645_100532444 350
125 3300025908 Ga0207643_10008167 Ga0207643_100081675 350
126 3300025908 Ga0207643_10020154 Ga0207643_100201543 350
127 3300025912 Ga0207707_10202807 Ga0207707_102028071 350
128 3300025923 Ga0207681_10011230 Ga0207681_100112305 350
129 3300025926 Ga0207659_10000183 Ga0207659_1000018313 350
130 3300025932 Ga0207690_10049967 Ga0207690_100499673 350
131 3300025936 Ga0207670_10042400 Ga0207670_100424004 350
132 3300025940 Ga0207691_10021810 Ga0207691_100218105 350
133 3300025944 Ga0207661_10346836 Ga0207661_103468362 350
134 3300026067 Ga0207678_10095126 Ga0207678_100951262 350
135 3300026078 Ga0207702_10152612 Ga0207702_101526122 350
136 3300026116 Ga0207674_10118037 Ga0207674_101180373 350
137 3300026118 Ga0207675_100298411 Ga0207675_1002984112 350
138 3300026121 Ga0207683_10174703 Ga0207683_101747032 350
139 3300026142 Ga0207698_10005572 Ga0207698_100055727 350
140 3300028380 Ga0268265_10101324 Ga0268265_101013242 350
141 3300028666 Ga0265336_10020098 Ga0265336_100200983 350
142 3300031711 Ga0265314_10035188 Ga0265314_100351881 350
143 3300037471 Ga0395905_0071815 Ga0395905_0071815_1316_2431 350
144 3300039437 Ga0436365_0155012 Ga0436365_0155012_365_1477 350
145 3300039450 Ga0436363_0180919 Ga0436363_0180919_935_2050 350
146 3300044694 Ga0466963_0064857 Ga0466963_0064857_681_1793 350
147 3300044842 Ga0466957_0139280 Ga0466957_0139280_347_1459 350
148 3300046663 Ga0495635_0109818 Ga0495635_0109818_110_1222 350
149 3300046794 Ga0495589_0085979 Ga0495589_0085979_107_1222 350
150 3300047317 Ga0495604_0079337 Ga0495604_0079337_429_1544 350
151 3300047319 Ga0495674_0081941 Ga0495674_0081941_466_1581 350
152 3300047320 Ga0495672_0062177 Ga0495672_0062177_893_2005 350
153 3300048910 Ga0496107_0228440 Ga0496107_0228440_144_1256 350
154 3300049569 Ga0501032_0000141 Ga0501032_0000141_13704_14816 350
155 3300049570 Ga0501033_0000001 Ga0501033_0000001_72962_74074 350
156 3300050512 nmdc:mga0n895_3988_c1 nmdc:mga0n895_3988_c1_7216_8331 350
157 3300053077 Ga0495601_0128543 Ga0495601_0128543_219_1331 350
158 3300005295 Ga0065707_10170658 Ga0065707_101706582 351
159 3300005327 Ga0070658_10000949 Ga0070658_1000094911 351
160 3300005356 Ga0070674_100166385 Ga0070674_1001663851 351
161 3300005364 Ga0070673_100017445 Ga0070673_1000174454 351
162 3300005435 Ga0070714_100028197 Ga0070714_1000281973 351
163 3300005435 Ga0070714_100098451 Ga0070714_1000984513 351
164 3300005435 Ga0070714_100105856 Ga0070714_1001058562 351
165 3300005440 Ga0070705_100039384 Ga0070705_1000393842 351
166 3300005445 Ga0070708_100281767 Ga0070708_1002817672 351
167 3300005467 Ga0070706_100063258 Ga0070706_1000632582 351
168 3300005467 Ga0070706_100194470 Ga0070706_1001944702 351
169 3300005468 Ga0070707_100006910 Ga0070707_10000691014 351
170 3300005468 Ga0070707_100022427 Ga0070707_1000224273 351
171 3300005468 Ga0070707_100051131 Ga0070707_1000511313 351
172 3300005468 Ga0070707_100062853 Ga0070707_1000628533 351
173 3300005471 Ga0070698_100011215 Ga0070698_1000112154 351
174 3300005518 Ga0070699_100000683 Ga0070699_10000068315 351
175 3300005518 Ga0070699_100002029 Ga0070699_1000020298 351
176 3300005518 Ga0070699_100024342 Ga0070699_1000243422 351
177 3300005530 Ga0070679_100125876 Ga0070679_1001258762 351
178 3300005530 Ga0070679_100187617 Ga0070679_1001876172 351
179 3300005536 Ga0070697_100000060 Ga0070697_10000006022 351
180 3300005536 Ga0070697_100002139 Ga0070697_1000021392 351
181 3300005536 Ga0070697_100069874 Ga0070697_1000698742 351
182 3300005536 Ga0070697_100110767 Ga0070697_1001107672 351
183 3300005536 Ga0070697_100270383 Ga0070697_1002703832 351
184 3300005545 Ga0070695_100006076 Ga0070695_1000060766 351
185 3300005563 Ga0068855_100302894 Ga0068855_1003028943 351
186 3300005842 Ga0068858_100096038 Ga0068858_1000960382 351
187 3300006028 Ga0070717_10000647 Ga0070717_1000064714 351
188 3300006237 Ga0097621_100221190 Ga0097621_1002211901 351
189 3300006358 Ga0068871_100043002 Ga0068871_1000430022 351
190 3300006358 Ga0068871_100215252 Ga0068871_1002152522 351
191 3300006844 Ga0075428_100009297 Ga0075428_1000092979 351
192 3300006880 Ga0075429_100025483 Ga0075429_1000254832 351
193 3300006914 Ga0075436_100024450 Ga0075436_1000244503 351
194 3300006914 Ga0075436_100125298 Ga0075436_1001252982 351
195 3300007076 Ga0075435_100102772 Ga0075435_1001027724 351
196 3300009093 Ga0105240_10013461 Ga0105240_100134616 351
197 3300009147 Ga0114129_10148556 Ga0114129_101485563 351
198 3300009147 Ga0114129_10381473 Ga0114129_103814732 351
199 3300009177 Ga0105248_10000003 Ga0105248_10000003412 351
200 3300009551 Ga0105238_10058267 Ga0105238_100582672 351
201 3300013105 Ga0157369_10227534 Ga0157369_102275342 351
202 3300014325 Ga0163163_10058885 Ga0163163_100588853 351
203 3300014969 Ga0157376_10213337 Ga0157376_102133372 351
204 3300020069 Ga0197907_11040071 Ga0197907_110400711 351
205 3300020077 Ga0206351_10609679 Ga0206351_106096792 351
206 3300020077 Ga0206351_10743917 Ga0206351_107439171 351
207 3300020080 Ga0206350_10144234 Ga0206350_101442342 351
208 3300020610 Ga0154015_1255813 Ga0154015_12558131 351
209 3300021388 Ga0213875_10004731 Ga0213875_100047312 351
210 3300022467 Ga0224712_10055467 Ga0224712_100554672 351
211 3300022467 Ga0224712_10057960 Ga0224712_100579601 351
212 3300024225 Ga0224572_1020873 Ga0224572_10208732 351
213 3300025885 Ga0207653_10026077 Ga0207653_100260772 351
214 3300025908 Ga0207643_10066260 Ga0207643_100662602 351
215 3300025909 Ga0207705_10019850 Ga0207705_100198503 351
216 3300025910 Ga0207684_10000001 Ga0207684_100000011151 351
217 3300025910 Ga0207684_10000162 Ga0207684_1000016236 351
218 3300025910 Ga0207684_10266895 Ga0207684_102668952 351
219 3300025920 Ga0207649_10063018 Ga0207649_100630183 351
220 3300025921 Ga0207652_10081426 Ga0207652_100814262 351
221 3300025922 Ga0207646_10012198 Ga0207646_100121982 351
222 3300025922 Ga0207646_10036350 Ga0207646_100363502 351
223 3300025924 Ga0207694_10238175 Ga0207694_102381752 351
224 3300025928 Ga0207700_10300925 Ga0207700_103009252 351
225 3300025929 Ga0207664_10002892 Ga0207664_100028928 351
226 3300025939 Ga0207665_10092325 Ga0207665_100923252 351
227 3300025941 Ga0207711_10000012 Ga0207711_1000001214 351
228 3300025949 Ga0207667_10033856 Ga0207667_100338564 351
229 3300025949 Ga0207667_10247462 Ga0207667_102474623 351
230 3300025960 Ga0207651_10053963 Ga0207651_100539632 351
231 3300025960 Ga0207651_10197829 Ga0207651_101978292 351
232 3300028380 Ga0268265_10398492 Ga0268265_103984922 351
233 3300031250 Ga0265331_10024743 Ga0265331_100247433 351
234 3300035086 Ga0373934_0000259 Ga0373934_0000259_15109_16224 351
235 3300035111 Ga0373923_0006427 Ga0373923_0006427_193_1308 351
236 3300035119 Ga0373956_0000569 Ga0373956_0000569_11693_12808 351
237 3300035724 Ga0373933_0000530 Ga0373933_0000530_8046_9161 351
238 3300037853 Ga0436364_0568464 Ga0436364_0568464_11006_12121 351
239 3300039438 Ga0436360_0422378 Ga0436360_0422378_3138_4310 351
240 3300041408 Ga0439453_0001805 Ga0439453_0001805_609_1724 351
241 3300042436 Ga0439435_0006296 Ga0439435_0006296_1016_2131 351
242 3300046454 Ga0495592_0032881 Ga0495592_0032881_2704_3819 351
243 3300046461 Ga0495641_0036061 Ga0495641_0036061_193_1308 351
244 3300046462 Ga0495651_0003578 Ga0495651_0003578_3640_4755 351
245 3300046463 Ga0495653_0000533 Ga0495653_0000533_23773_24888 351
246 3300046511 Ga0495608_0000171 Ga0495608_0000171_18019_19134 351
247 3300046543 Ga0495645_0000557 Ga0495645_0000557_21430_22545 351
248 3300046559 Ga0495667_0001252 Ga0495667_0001252_1075_2190 351
249 3300046663 Ga0495635_0000238 Ga0495635_0000238_26338_27453 351
250 3300046675 Ga0495657_0000272 Ga0495657_0000272_17512_18627 351
251 3300046678 Ga0495599_0004198 Ga0495599_0004198_5295_6410 351
252 3300046679 Ga0495623_0003495 Ga0495623_0003495_9093_10208 351
253 3300046680 Ga0495646_0010674 Ga0495646_0010674_26_1141 351
254 3300046809 Ga0495600_0000187 Ga0495600_0000187_27035_28150 351
255 3300047315 Ga0495581_0053601 Ga0495581_0053601_695_1810 351
256 3300048917 Ga0496114_0000868 Ga0496114_0000868_2900_4015 351
257 3300049570 Ga0501033_0003741 Ga0501033_0003741_1338_2456 351
258 3300049571 Ga0501034_0014716 Ga0501034_0014716_4372_5490 351
259 3300049571 Ga0501034_0128521 Ga0501034_0128521_1119_2237 351
260 3300049574 Ga0501038_0001171 Ga0501038_0001171_7469_8584 351
261 3300049579 Ga0501043_0027719 Ga0501043_0027719_2729_3847 351
262 3300049580 Ga0501046_0009072 Ga0501046_0009072_2393_3511 351
263 3300049580 Ga0501046_0040051 Ga0501046_0040051_1523_2641 351
264 3300049581 Ga0501047_0197146 Ga0501047_0197146_607_1725 351
265 3300049586 Ga0501070_0000452 Ga0501070_0000452_3459_4577 351
266 3300049823 Ga0501044_0098651 Ga0501044_0098651_610_1728 351
267 3300050510 nmdc:mga06r32_2264_c1 nmdc:mga06r32_2264_c1_11070_12185 351
268 3300053077 Ga0495601_0004275 Ga0495601_0004275_5274_6389 351
269 3300053078 Ga0495612_0000987 Ga0495612_0000987_2165_3280 351
270 3300053085 Ga0495619_0108072 Ga0495619_0108072_30_1145 351
271 3300053088 Ga0500644_0020582 Ga0500644_0020582_732_1847 351
272 3300053119 Ga0500595_000023 Ga0500595_000023_118323_119438 351
273 3300049823 Ga0501044_0008959 Ga0501044_0008959_2871_4037 353
274 3300046529 Ga0495652_0152991 Ga0495652_0152991_569_1741 355
275 3300036401 Ga0373937_0085700 Ga0373937_0085700_1263_2438 356
276 3300046543 Ga0495645_0139080 Ga0495645_0139080_241_1416 356
277 3300046678 Ga0495599_0082980 Ga0495599_0082980_464_1639 356
278 3300005334 Ga0068869_100002057 Ga0068869_10000205711 360
279 3300025939 Ga0207665_10060954 Ga0207665_100609542 360
280 3300050507 nmdc:mga05p37_38560_c1 nmdc:mga05p37_38560_c1_3098_4276 360
281 3300005536 Ga0070697_100031429 Ga0070697_1000314291 361
282 3300035692 Ga0373935_0066467 Ga0373935_0066467_917_2101 361
283 3300035725 Ga0373947_0047497 Ga0373947_0047497_619_1779 361
284 3300046476 Ga0495662_0127242 Ga0495662_0127242_28_1173 361
285 3300046535 Ga0495586_0056579 Ga0495586_0056579_88_1272 361
286 3300046689 Ga0495613_0072994 Ga0495613_0072994_963_2147 361
287 3300047471 Ga0495684_0091335 Ga0495684_0091335_517_1701 361
288 3300005468 Ga0070707_100022134 Ga0070707_1000221344 362
289 3300005468 Ga0070707_100200634 Ga0070707_1002006342 362
290 3300025910 Ga0207684_10032484 Ga0207684_100324842 362
291 3300006847 Ga0075431_100009287 Ga0075431_1000092874 363
292 3300009147 Ga0114129_10013693 Ga0114129_100136933 363
293 3300050510 nmdc:mga06r32_8449_c1 nmdc:mga06r32_8449_c1_652_1839 363
294 3300005539 Ga0068853_100000004 Ga0068853_100000004300 365
295 3300026041 Ga0207639_10000002 Ga0207639_10000002107 365
296 3300042461 Ga0439460_0015422 Ga0439460_0015422_516_1700 365
297 3300046522 Ga0495643_0000329 Ga0495643_0000329_29825_30985 365
298 3300005445 Ga0070708_100118562 Ga0070708_1001185622 367
299 3300005536 Ga0070697_100139864 Ga0070697_1001398642 367
300 3300009098 Ga0105245_10143847 Ga0105245_101438472 368
301 3300013297 Ga0157378_10051162 Ga0157378_100511624 368
302 3300046517 Ga0495630_0214951 Ga0495630_0214951_138_1304 368
303 3300046531 Ga0495665_0028046 Ga0495665_0028046_166_1332 368
304 3300047319 Ga0495674_0066440 Ga0495674_0066440_1933_3099 368
305 3300047471 Ga0495684_0002150 Ga0495684_0002150_8818_9984 368
306 3300049571 Ga0501034_0107946 Ga0501034_0107946_1534_2703 368
307 3300049823 Ga0501044_0071281 Ga0501044_0071281_1950_3119 368
308 3300005468 Ga0070707_100140634 Ga0070707_1001406344 369
309 3300025922 Ga0207646_10049522 Ga0207646_100495222 369
310 3300009098 Ga0105245_10113515 Ga0105245_101135151 370
311 3300031728 Ga0316578_10105713 Ga0316578_101057131 370
312 3300036712 Ga0316584_0181109 Ga0316584_0181109_121_1308 370
313 3300048915 Ga0496112_0287614 Ga0496112_0287614_305_1486 371
314 3300049589 Ga0501073_0009561 Ga0501073_0009561_4556_5731 371
315 3300005327 Ga0070658_10058938 Ga0070658_100589381 373
316 3300005437 Ga0070710_10108055 Ga0070710_101080552 373
317 3300006852 Ga0075433_10264237 Ga0075433_102642371 373
318 3300005436 Ga0070713_100073928 Ga0070713_1000739283 374
319 3300006844 Ga0075428_100175501 Ga0075428_1001755013 374
320 3300042876 Ga0451577_0009034 Ga0451577_0009034_5917_7104 374
321 3300044712 Ga0453684_0001868 Ga0453684_0001868_24657_25844 374
322 3300045051 Ga0451576_0002401 Ga0451576_0002401_16916_18103 374
323 3300045051 Ga0451576_0006636 Ga0451576_0006636_8746_9933 374
324 3300046559 Ga0495667_0120270 Ga0495667_0120270_301_1485 374
325 3300001976 JGI24752J21851_1002565 JGI24752J21851_10025653 375
326 3300002239 JGI24034J26672_10002694 JGI24034J26672_100026942 375
327 3300005290 Ga0065712_10079196 Ga0065712_100791964 375
328 3300005328 Ga0070676_10011045 Ga0070676_100110455 375
329 3300005329 Ga0070683_100043621 Ga0070683_1000436216 375
330 3300005330 Ga0070690_100015512 Ga0070690_1000155122 375
331 3300005337 Ga0070682_100005894 Ga0070682_1000058942 375
332 3300005339 Ga0070660_100001305 Ga0070660_1000013058 375
333 3300005340 Ga0070689_100009107 Ga0070689_1000091079 375
334 3300005344 Ga0070661_100038717 Ga0070661_1000387175 375
335 3300005354 Ga0070675_100092131 Ga0070675_1000921312 375
336 3300005355 Ga0070671_100140432 Ga0070671_1001404322 375
337 3300005365 Ga0070688_100022859 Ga0070688_1000228592 375
338 3300005435 Ga0070714_100200724 Ga0070714_1002007242 375
339 3300005441 Ga0070700_100014627 Ga0070700_1000146277 375
340 3300005536 Ga0070697_100289520 Ga0070697_1002895201 375
341 3300005543 Ga0070672_100028725 Ga0070672_1000287252 375
342 3300005577 Ga0068857_100005254 Ga0068857_10000525413 375
343 3300005577 Ga0068857_100024986 Ga0068857_1000249866 375
344 3300005578 Ga0068854_100018882 Ga0068854_1000188824 375
345 3300005614 Ga0068856_100042031 Ga0068856_1000420314 375
346 3300005616 Ga0068852_100014600 Ga0068852_1000146007 375
347 3300005618 Ga0068864_100082549 Ga0068864_1000825492 375
348 3300005719 Ga0068861_100031147 Ga0068861_1000311476 375
349 3300005834 Ga0068851_10005404 Ga0068851_100054045 375
350 3300005840 Ga0068870_10092663 Ga0068870_100926632 375
351 3300005842 Ga0068858_100069985 Ga0068858_1000699852 375
352 3300005844 Ga0068862_100048246 Ga0068862_1000482465 375
353 3300009094 Ga0111539_10000077 Ga0111539_1000007728 375
354 3300009098 Ga0105245_10018069 Ga0105245_100180697 375
355 3300009101 Ga0105247_10005265 Ga0105247_1000526510 375
356 3300009176 Ga0105242_10018248 Ga0105242_100182484 375
357 3300009177 Ga0105248_10075840 Ga0105248_100758405 375
358 3300009553 Ga0105249_10022601 Ga0105249_100226014 375
359 3300010375 Ga0105239_10023993 Ga0105239_100239934 375
360 3300011119 Ga0105246_10028989 Ga0105246_100289892 375
361 3300013102 Ga0157371_10054137 Ga0157371_100541372 375
362 3300013306 Ga0163162_10035593 Ga0163162_100355932 375
363 3300013308 Ga0157375_10206757 Ga0157375_102067573 375
364 3300014325 Ga0163163_10037711 Ga0163163_100377113 375
365 3300014325 Ga0163163_10052639 Ga0163163_100526392 375
366 3300014745 Ga0157377_10000604 Ga0157377_1000060410 375
367 3300014968 Ga0157379_10180063 Ga0157379_101800632 375
368 3300017792 Ga0163161_10010955 Ga0163161_100109555 375
369 3300025315 Ga0207697_10010526 Ga0207697_100105263 375
370 3300025321 Ga0207656_10007939 Ga0207656_100079393 375
371 3300025899 Ga0207642_10017431 Ga0207642_100174312 375
372 3300025900 Ga0207710_10024042 Ga0207710_100240424 375
373 3300025901 Ga0207688_10026428 Ga0207688_100264284 375
374 3300025904 Ga0207647_10014154 Ga0207647_100141547 375
375 3300025907 Ga0207645_10003125 Ga0207645_1000312515 375
376 3300025908 Ga0207643_10001093 Ga0207643_1000109315 375
377 3300025919 Ga0207657_10002871 Ga0207657_1000287113 375
378 3300025920 Ga0207649_10001017 Ga0207649_1000101714 375
379 3300025923 Ga0207681_10025337 Ga0207681_100253375 375
380 3300025925 Ga0207650_10000051 Ga0207650_10000051158 375
381 3300025926 Ga0207659_10012088 Ga0207659_100120883 375
382 3300025927 Ga0207687_10081786 Ga0207687_100817862 375
383 3300025931 Ga0207644_10006972 Ga0207644_1000697210 375
384 3300025933 Ga0207706_10006949 Ga0207706_1000694913 375
385 3300025936 Ga0207670_10020207 Ga0207670_100202073 375
386 3300025937 Ga0207669_10149150 Ga0207669_101491502 375
387 3300025941 Ga0207711_10185356 Ga0207711_101853561 375
388 3300025942 Ga0207689_10000184 Ga0207689_100001845 375
389 3300025944 Ga0207661_10000122 Ga0207661_1000012243 375
390 3300025945 Ga0207679_10000101 Ga0207679_1000010148 375
391 3300025981 Ga0207640_10024018 Ga0207640_100240183 375
392 3300026023 Ga0207677_10009250 Ga0207677_100092507 375
393 3300026035 Ga0207703_10065210 Ga0207703_100652101 375
394 3300026041 Ga0207639_10038436 Ga0207639_100384362 375
395 3300026067 Ga0207678_10033626 Ga0207678_100336264 375
396 3300026075 Ga0207708_10036747 Ga0207708_100367476 375
397 3300026078 Ga0207702_10082499 Ga0207702_100824994 375
398 3300026088 Ga0207641_10000006 Ga0207641_10000006368 375
399 3300026089 Ga0207648_10006908 Ga0207648_1000690813 375
400 3300026095 Ga0207676_10000155 Ga0207676_1000015532 375
401 3300026116 Ga0207674_10000537 Ga0207674_1000053721 375
402 3300026116 Ga0207674_10015550 Ga0207674_100155509 375
403 3300026118 Ga0207675_100042206 Ga0207675_1000422062 375
404 3300026121 Ga0207683_10085480 Ga0207683_100854804 375
405 3300027907 Ga0207428_10016670 Ga0207428_100166702 375
406 3300028379 Ga0268266_10117877 Ga0268266_101178774 375
407 3300028380 Ga0268265_10012466 Ga0268265_100124667 375
408 3300028654 Ga0265322_10000143 Ga0265322_1000014326 375
409 3300044712 Ga0453684_0276323 Ga0453684_0276323_497_1684 375
410 3300046462 Ga0495651_0001072 Ga0495651_0001072_6196_7383 375
411 3300046463 Ga0495653_0010146 Ga0495653_0010146_4267_5454 375
412 3300046477 Ga0495664_0076072 Ga0495664_0076072_639_1826 375
413 3300046511 Ga0495608_0005341 Ga0495608_0005341_3129_4316 375
414 3300046516 Ga0495628_0001985 Ga0495628_0001985_6531_7718 375
415 3300046533 Ga0495640_0106887 Ga0495640_0106887_545_1732 375
416 3300046536 Ga0495587_0040282 Ga0495587_0040282_724_1911 375
417 3300046559 Ga0495667_0014149 Ga0495667_0014149_3238_4425 375
418 3300046678 Ga0495599_0015981 Ga0495599_0015981_748_1935 375
419 3300046809 Ga0495600_0003466 Ga0495600_0003466_6488_7675 375
420 3300047317 Ga0495604_0002842 Ga0495604_0002842_2136_3323 375
421 3300047319 Ga0495674_0002377 Ga0495674_0002377_5209_6396 375
422 3300047322 Ga0495680_0002400 Ga0495680_0002400_594_1781 375
423 3300047444 Ga0495675_0000052 Ga0495675_0000052_6502_7689 375
424 3300047471 Ga0495684_0007925 Ga0495684_0007925_1484_2671 375
425 3300048905 Ga0496102_0073134 Ga0496102_0073134_1281_2468 375
426 3300048907 Ga0496104_0184870 Ga0496104_0184870_112_1299 375
427 3300048911 Ga0496108_0000258 Ga0496108_0000258_30345_31532 375
428 3300048912 Ga0496109_0000126 Ga0496109_0000126_14076_15263 375
429 3300048914 Ga0496111_0000724 Ga0496111_0000724_11635_12822 375
430 3300048915 Ga0496112_0000081 Ga0496112_0000081_41459_42646 375
431 3300048916 Ga0496113_0001980 Ga0496113_0001980_4476_5663 375
432 3300050511 nmdc:mga08y16_3101_c1 nmdc:mga08y16_3101_c1_7135_8322 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02012

BNR

BNR/Asp-box repeat

65

76

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1brg-assembly3.cif.gz_C crystallographic analysis of phe->leu substitution in the hydrophobic core of barnase 0.8685 140 163
1b2z-assembly3.cif.gz_C deletion of a buried salt bridge in barnase 0.8675 140 163
1ban-assembly2.cif.gz_B the contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants 0.8646 140 163
1brh-assembly3.cif.gz_C barnase mutant with leu 14 replaced by ala 0.859 140 163
1brk-assembly3.cif.gz_C barnase mutant with ile 96 replaced by ala 0.8561 140 163
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8124 1 375 2.130.10.10
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8016 1 375 2.130.10.10
af_A0A0P0V8T8_135_297_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7631 32 211 2.40.128.630
af_Q4E4S0_27_142_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7576 125 211 2.130.10.10
af_I1N9X3_72_261_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.757 125 304 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A535EHK9-F1-model_v4 Exo-alpha-sialidase 0.9828 1 325 GO:0000272
GO:0010411
GO:0016798
AF-A0A535EHK9-F1-model_v4 Exo-alpha-sialidase 0.9796 1 325 GO:0000272
GO:0010411
GO:0016798
AF-A0A539D8H8-F1-model_v4 BNR/Asp-box repeat-containing protein 0.9757 47 343 GO:0000272
GO:0010411
GO:0016798
AF-A0A535VDA2-F1-model_v4 Exo-alpha-sialidase 0.9748 1 323 GO:0000272
GO:0010411
GO:0016798
AF-A0A7C2XSJ5-F1-model_v4 Exo-alpha-sialidase 0.9741 1 73

Feature Viewer

pLDDT pTM Quality
89.67 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map