F442546

General Info

Members Datasets Scaffolds Average Seq Length
432 188 864 96

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100263250|Ga0070708_1002632502
Length 117
Sequence MAQLSTHVLDTARGIPAAGVLVEVRLVGARQQEPLASATTNEQGRTDAPLISRDRLDRGDYELTFHVGDYLRRQGVTLSDPPFLDRVIIRIGVADPAGHYHIPLLVSPYGCTTYRGS

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
111 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
112 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 0.46
Rhizosphere 97.22
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100263250 3300005445 Bacteria 1621
2 JGI24739J22299_10156845 3300001989 Bacteria 672
3 JGI25406J46586_10036331 3300003203 Bacteria 1788
4 JGI25407J50210_10003634 3300003373 Bacteria 3710
5 Ga0070658_11337495 3300005327 Unclassified 622
6 Ga0070683_100032892 3300005329 Bacteria 4726
7 Ga0070683_100523102 3300005329 Bacteria 1134
8 Ga0068869_100762715 3300005334 Bacteria 829
9 Ga0070682_100052296 3300005337 Bacteria 2556
10 Ga0068868_100150196 3300005338 Bacteria 1918
11 Ga0070660_100202412 3300005339 Bacteria 1610
12 Ga0070691_10013509 3300005341 Bacteria 3740
13 Ga0070661_100297239 3300005344 Bacteria 1256
14 Ga0070692_10095612 3300005345 Bacteria 1621
15 Ga0070668_100083163 3300005347 Bacteria 2512
16 Ga0070675_100157809 3300005354 Bacteria 1949
17 Ga0070675_100889439 3300005354 Bacteria 816
18 Ga0070675_101232275 3300005354 Bacteria 689
19 Ga0070659_100038116 3300005366 Bacteria 3748
20 Ga0070659_100067402 3300005366 Bacteria 2838
21 Ga0070681_10087713 3300005458 Bacteria 3064
22 Ga0070698_101417414 3300005471 Bacteria 646
23 Ga0070679_100454281 3300005530 Bacteria 1226
24 Ga0070679_100818067 3300005530 Bacteria 875
25 Ga0070684_100043708 3300005535 Bacteria 3871
26 Ga0070684_100350946 3300005535 Bacteria 1357
27 Ga0070684_101420743 3300005535 Bacteria 653
28 Ga0068853_100554556 3300005539 Bacteria 1089
29 Ga0070672_102033242 3300005543 Bacteria 518
30 Ga0070704_101552065 3300005549 Bacteria 610
31 Ga0068855_100577784 3300005563 Bacteria 1214
32 Ga0070664_100266088 3300005564 Bacteria 1543
33 Ga0068857_100596783 3300005577 Bacteria 1044
34 Ga0068857_100639224 3300005577 Bacteria 1008
35 Ga0068854_100235785 3300005578 Bacteria 1454
36 Ga0068852_101361782 3300005616 Bacteria 731
37 Ga0068859_101761697 3300005617 Bacteria 684
38 Ga0068864_101307137 3300005618 Unclassified 725
39 Ga0068866_10154798 3300005718 Bacteria 1331
40 Ga0068851_11077813 3300005834 Unclassified 509
41 Ga0081455_10027342 3300005937 Bacteria 5228
42 Ga0081455_10029079 3300005937 Bacteria 5042
43 Ga0081455_10093854 3300005937 Bacteria 2425
44 Ga0081538_10001664 3300005981 Bacteria 22718
45 Ga0081538_10013283 3300005981 Bacteria 6529
46 Ga0081539_10000244 3300005985 Bacteria 127514
47 Ga0075365_10025094 3300006038 Bacteria 3770
48 Ga0075365_10395880 3300006038 Bacteria 975
49 Ga0075364_10815655 3300006051 Bacteria 636
50 Ga0075432_10001198 3300006058 Bacteria 8330
51 Ga0075367_10062503 3300006178 Bacteria 2224
52 Ga0075428_100001437 3300006844 Bacteria 25438
53 Ga0075428_100117265 3300006844 Bacteria 2900
54 Ga0075430_100002418 3300006846 Bacteria 15547
55 Ga0075431_100038168 3300006847 Bacteria 4946
56 Ga0075431_101017449 3300006847 Unclassified 795
57 Ga0075433_10272861 3300006852 Bacteria 1499
58 Ga0075434_100125077 3300006871 Bacteria 2589
59 Ga0075434_100526221 3300006871 Bacteria 1203
60 Ga0075429_100018177 3300006880 Bacteria 6084
61 Ga0068865_100428505 3300006881 Bacteria 1089
62 Ga0097620_101761976 3300006931 Bacteria 684
63 Ga0111539_10004397 3300009094 Bacteria 18425
64 Ga0111539_10006367 3300009094 Bacteria 15227
65 Ga0111539_10062459 3300009094 Bacteria 4409
66 Ga0111539_10655178 3300009094 Bacteria 1223
67 Ga0111539_11091255 3300009094 Bacteria 927
68 Ga0105245_10467084 3300009098 Bacteria 1273
69 Ga0114129_10003661 3300009147 Bacteria 21612
70 Ga0114129_10057197 3300009147 Bacteria 5459
71 Ga0114129_11156012 3300009147 Bacteria 966
72 Ga0114129_11538001 3300009147 Bacteria 816
73 Ga0114129_11988398 3300009147 Bacteria 703
74 Ga0105243_10038984 3300009148 Bacteria 3703
75 Ga0105243_11067555 3300009148 Unclassified 814
76 Ga0105249_11235908 3300009553 Bacteria 818
77 Ga0105239_10038925 3300010375 Bacteria 5208
78 Ga0105239_10056375 3300010375 Bacteria 4310
79 Ga0182008_10126883 3300014497 Bacteria 1271
80 Ga0157377_10151428 3300014745 Bacteria 1434
81 Ga0157377_10447424 3300014745 Bacteria 891
82 Ga0207688_10059292 3300025901 Bacteria 2155
83 Ga0207688_10350463 3300025901 Bacteria 910
84 Ga0207643_10135010 3300025908 Bacteria 1470
85 Ga0207707_11322298 3300025912 Bacteria 578
86 Ga0207657_10242860 3300025919 Bacteria 1437
87 Ga0207649_11422922 3300025920 Bacteria 549
88 Ga0207652_10275357 3300025921 Bacteria 1518
89 Ga0207652_10843017 3300025921 Bacteria 812
90 Ga0207681_10128422 3300025923 Bacteria 1871
91 Ga0207681_10374495 3300025923 Bacteria 1145
92 Ga0207659_10656419 3300025926 Bacteria 897
93 Ga0207659_11178166 3300025926 Bacteria 659
94 Ga0207659_11582808 3300025926 Bacteria 560
95 Ga0207687_10004296 3300025927 Bacteria 9512
96 Ga0207690_10070205 3300025932 Bacteria 2412
97 Ga0207690_10229807 3300025932 Bacteria 1423
98 Ga0207709_11467239 3300025935 Bacteria 566
99 Ga0207704_10443304 3300025938 Bacteria 1035
100 Ga0207691_10645581 3300025940 Bacteria 894
101 Ga0207661_10124624 3300025944 Bacteria 2199
102 Ga0207679_11174971 3300025945 Bacteria 704
103 Ga0207668_10029858 3300025972 Bacteria 3578
104 Ga0207640_10269943 3300025981 Bacteria 1330
105 Ga0207677_10124424 3300026023 Bacteria 1946
106 Ga0207641_11334843 3300026088 Bacteria 718
107 Ga0207676_12312474 3300026095 Unclassified 535
108 Ga0207676_12520159 3300026095 Unclassified 511
109 Ga0207674_10659844 3300026116 Unclassified 1010
110 Ga0207674_10675373 3300026116 Bacteria 997
111 Ga0207428_10002440 3300027907 Bacteria 18579
112 Ga0207428_10011119 3300027907 Bacteria 7992
113 Ga0207428_10047965 3300027907 Bacteria 3429
114 Ga0207428_10072267 3300027907 Bacteria 2708
115 Ga0207428_10641006 3300027907 Bacteria 763
116 Ga0265326_10216318 3300028558 Bacteria 551
117 Ga0265319_1013980 3300028563 Bacteria 3168
118 Ga0265334_10004996 3300028573 Bacteria 5828
119 Ga0265318_10003432 3300028577 Bacteria 7962
120 Ga0265336_10045593 3300028666 Bacteria 1333
121 Ga0265338_10005535 3300028800 Bacteria 16442
122 Ga0265338_10019247 3300028800 Bacteria 7260
123 Ga0265338_10189039 3300028800 Bacteria 1562
124 Ga0265324_10040369 3300029957 Bacteria 1616
125 Ga0265330_10013282 3300031235 Bacteria 3841
126 Ga0265330_10319185 3300031235 Bacteria 655
127 Ga0265332_10023727 3300031238 Bacteria 2704
128 Ga0265328_10005014 3300031239 Bacteria 5704
129 Ga0265328_10168533 3300031239 Bacteria 827
130 Ga0265320_10012482 3300031240 Bacteria 4940
131 Ga0265320_10053204 3300031240 Bacteria 1957
132 Ga0265325_10025076 3300031241 Bacteria 3239
133 Ga0265329_10003092 3300031242 Bacteria 7364
134 Ga0265340_10005581 3300031247 Bacteria 6978
135 Ga0265339_10019608 3300031249 Bacteria 3967
136 Ga0265339_10036828 3300031249 Bacteria 2735
137 Ga0265331_10028827 3300031250 Bacteria 2774
138 Ga0265327_10006678 3300031251 Bacteria 9149
139 Ga0265327_10027705 3300031251 Bacteria 3255
140 Ga0265316_10012519 3300031344 Bacteria 7599
141 Ga0265316_10178596 3300031344 Unclassified 1581
142 Ga0307408_100258900 3300031548 Bacteria 1439
143 Ga0265313_10002613 3300031595 Bacteria 15334
144 Ga0265314_10022259 3300031711 Bacteria 4856
145 Ga0265314_10156788 3300031711 Bacteria 1389
146 Ga0265342_10029002 3300031712 Bacteria 3439
147 Ga0307416_101191916 3300032002 Bacteria 867
148 Ga0373956_0032519 3300035119 Bacteria 2289
149 Ga0373957_0103269 3300035120 Bacteria 1143
150 Ga0373931_0095744 3300035691 Bacteria 1662
151 Ga0373933_0106067 3300035724 Bacteria 1748
152 Ga0373937_0083754 3300036401 Bacteria 2950
153 Ga0395899_0252458 3300037312 Bacteria 1210
154 Ga0395900_0379892 3300037418 Unclassified 1381
155 Ga0395900_1561071 3300037418 Unclassified 572
156 Ga0395901_0324011 3300038443 Bacteria 1594
157 Ga0395901_1280650 3300038443 Bacteria 696
158 Ga0395901_1347478 3300038443 Bacteria 674
159 Ga0451853_2194367 3300041512 Bacteria 503
160 Ga0439455_0097554 3300042012 Bacteria 810
161 Ga0439456_104977 3300042013 Bacteria 641
162 Ga0450906_032144 3300042145 Bacteria 928
163 Ga0439460_0071602 3300042461 Bacteria 1075
164 Ga0466967_1419050 3300045976 Bacteria 691
165 Ga0495592_0944391 3300046454 Bacteria 505
166 Ga0495603_0004398 3300046455 Bacteria 8401
167 Ga0495651_0164321 3300046462 Bacteria 1587
168 Ga0495653_0142186 3300046463 Bacteria 1686
169 Ga0495584_0313181 3300046491 Unclassified 797
170 Ga0495616_0238810 3300046513 Bacteria 785
171 Ga0495628_0544129 3300046516 Bacteria 834
172 Ga0495631_0175834 3300046518 Unclassified 918
173 Ga0495642_0282525 3300046528 Bacteria 727
174 Ga0495667_0190338 3300046559 Bacteria 1315
175 Ga0495656_0783405 3300046615 Bacteria 515
176 Ga0495634_0024571 3300046642 Bacteria 4226
177 Ga0495635_0076637 3300046663 Bacteria 2291
178 Ga0495659_0116061 3300046664 Bacteria 1050
179 Ga0495661_0152977 3300046665 Bacteria 1245
180 Ga0495588_0010385 3300046674 Bacteria 4330
181 Ga0495599_0632903 3300046678 Bacteria 621
182 Ga0495670_0102085 3300046691 Bacteria 1478
183 Ga0495600_0084541 3300046809 Bacteria 2071
184 Ga0495604_0321038 3300047317 Bacteria 1035
185 Ga0495636_0615223 3300047318 Unclassified 532
186 Ga0495680_0020973 3300047322 Bacteria 5478
187 Ga0495675_0406859 3300047444 Bacteria 793
188 Ga0495684_0097503 3300047471 Bacteria 2224
189 Ga0495684_0100380 3300047471 Bacteria 2188
190 Ga0495602_0693180 3300048088 Bacteria 692
191 Ga0495602_0726197 3300048088 Bacteria 672
192 Ga0496106_1360402 3300048909 Bacteria 550
193 Ga0496110_0042773 3300048913 Bacteria 3954
194 Ga0501031_0016860 3300049568 Bacteria 4743
195 Ga0501031_0018988 3300049568 Bacteria 4476
196 Ga0501031_0023872 3300049568 Bacteria 3987
197 Ga0501031_0116055 3300049568 Bacteria 1749
198 Ga0501031_0278964 3300049568 Bacteria 1084
199 Ga0501031_0639890 3300049568 Unclassified 684
200 Ga0501032_0008902 3300049569 Bacteria 7298
201 Ga0501032_0497908 3300049569 Bacteria 779
202 Ga0501032_0881159 3300049569 Bacteria 564
203 Ga0501033_0002824 3300049570 Bacteria 14539
204 Ga0501033_0053893 3300049570 Bacteria 2977
205 Ga0501033_0399764 3300049570 Bacteria 958
206 Ga0501034_0603243 3300049571 Bacteria 1003
207 Ga0501036_0003036 3300049572 Bacteria 13370
208 Ga0501036_0026502 3300049572 Bacteria 4893
209 Ga0501036_0029239 3300049572 Bacteria 4658
210 Ga0501036_0042277 3300049572 Bacteria 3860
211 Ga0501036_0113448 3300049572 Bacteria 2290
212 Ga0501036_0181098 3300049572 Bacteria 1774
213 Ga0501036_0669386 3300049572 Bacteria 859
214 Ga0501036_1126684 3300049572 Bacteria 641
215 Ga0501037_0000851 3300049573 Bacteria 22750
216 Ga0501037_0141010 3300049573 Bacteria 1725
217 Ga0501037_0201412 3300049573 Bacteria 1407
218 Ga0501037_0763389 3300049573 Bacteria 640
219 Ga0501038_0000817 3300049574 Bacteria 27664
220 Ga0501038_0035795 3300049574 Bacteria 4358
221 Ga0501038_0038400 3300049574 Bacteria 4193
222 Ga0501038_0038422 3300049574 Bacteria 4192
223 Ga0501038_0410544 3300049574 Bacteria 1046
224 Ga0501039_0018588 3300049575 Bacteria 5335
225 Ga0501039_0019826 3300049575 Bacteria 5155
226 Ga0501039_0020659 3300049575 Bacteria 5046
227 Ga0501039_0036084 3300049575 Bacteria 3814
228 Ga0501039_0148030 3300049575 Bacteria 1845
229 Ga0501039_0272774 3300049575 Bacteria 1330
230 Ga0501040_0004296 3300049576 Bacteria 9256
231 Ga0501040_0013240 3300049576 Bacteria 5426
232 Ga0501040_0019961 3300049576 Bacteria 4461
233 Ga0501040_0030916 3300049576 Bacteria 3618
234 Ga0501040_0036029 3300049576 Bacteria 3356
235 Ga0501040_0418086 3300049576 Unclassified 964
236 Ga0501040_0463311 3300049576 Bacteria 913
237 Ga0501040_0554714 3300049576 Bacteria 829
238 Ga0501041_0003739 3300049577 Bacteria 8751
239 Ga0501041_0011212 3300049577 Bacteria 5295
240 Ga0501041_0015443 3300049577 Bacteria 4533
241 Ga0501041_0295095 3300049577 Bacteria 1021
242 Ga0501041_0414283 3300049577 Unclassified 854
243 Ga0501041_0654618 3300049577 Bacteria 672
244 Ga0501042_0015486 3300049578 Bacteria 5222
245 Ga0501042_0016993 3300049578 Bacteria 5010
246 Ga0501042_0052534 3300049578 Bacteria 2906
247 Ga0501042_0077155 3300049578 Bacteria 2385
248 Ga0501042_0096989 3300049578 Bacteria 2119
249 Ga0501042_0205053 3300049578 Bacteria 1422
250 Ga0501042_1129776 3300049578 Bacteria 571
251 Ga0501043_0016623 3300049579 Bacteria 5767
252 Ga0501043_0023109 3300049579 Bacteria 4877
253 Ga0501043_0180502 3300049579 Bacteria 1645
254 Ga0501046_0017207 3300049580 Bacteria 6040
255 Ga0501046_0047248 3300049580 Bacteria 3413
256 Ga0501046_0101991 3300049580 Bacteria 2200
257 Ga0501046_0137593 3300049580 Bacteria 1849
258 Ga0501046_0347312 3300049580 Bacteria 1078
259 Ga0501046_0618857 3300049580 Unclassified 767
260 Ga0501047_0088312 3300049581 Bacteria 2977
261 Ga0501047_0138372 3300049581 Bacteria 2314
262 Ga0501048_0008736 3300049582 Bacteria 7635
263 Ga0501048_0022441 3300049582 Bacteria 4617
264 Ga0501048_0036757 3300049582 Bacteria 3519
265 Ga0501048_0044602 3300049582 Bacteria 3169
266 Ga0501048_0143417 3300049582 Bacteria 1689
267 Ga0501048_0255124 3300049582 Unclassified 1246
268 Ga0501048_0341344 3300049582 Bacteria 1068
269 Ga0501048_0824448 3300049582 Bacteria 667
270 Ga0501048_0951344 3300049582 Bacteria 618
271 Ga0501068_0002229 3300049584 Bacteria 10314
272 Ga0501068_0112763 3300049584 Bacteria 1691
273 Ga0501068_0159540 3300049584 Bacteria 1421
274 Ga0501069_0056530 3300049585 Bacteria 2186
275 Ga0501069_0366397 3300049585 Bacteria 850
276 Ga0501069_0521641 3300049585 Unclassified 710
277 Ga0501070_0018417 3300049586 Bacteria 5859
278 Ga0501070_0239722 3300049586 Bacteria 1485
279 Ga0501070_0731717 3300049586 Unclassified 781
280 Ga0501071_0020157 3300049587 Bacteria 4633
281 Ga0501071_0021342 3300049587 Bacteria 4508
282 Ga0501071_0022473 3300049587 Bacteria 4396
283 Ga0501071_0033868 3300049587 Bacteria 3631
284 Ga0501071_0054393 3300049587 Bacteria 2888
285 Ga0501071_0157072 3300049587 Bacteria 1698
286 Ga0501071_0365655 3300049587 Bacteria 1099
287 Ga0501071_0457731 3300049587 Bacteria 977
288 Ga0501071_0919640 3300049587 Bacteria 675
289 Ga0501071_0956720 3300049587 Bacteria 661
290 Ga0501071_1402036 3300049587 Unclassified 539
291 Ga0501072_0000966 3300049588 Bacteria 21218
292 Ga0501072_0002830 3300049588 Bacteria 13018
293 Ga0501072_0022668 3300049588 Bacteria 4871
294 Ga0501072_0023075 3300049588 Bacteria 4831
295 Ga0501072_0037664 3300049588 Bacteria 3793
296 Ga0501072_0089048 3300049588 Bacteria 2449
297 Ga0501072_0120688 3300049588 Bacteria 2089
298 Ga0501072_0159047 3300049588 Bacteria 1802
299 Ga0501072_0312576 3300049588 Bacteria 1249
300 Ga0501072_0334898 3300049588 Bacteria 1202
301 Ga0501072_0812632 3300049588 Bacteria 732
302 Ga0501072_1477798 3300049588 Bacteria 525
303 Ga0501073_0004374 3300049589 Bacteria 10610
304 Ga0501073_0340645 3300049589 Bacteria 1035
305 Ga0501073_0353525 3300049589 Bacteria 1015
306 Ga0501074_0028682 3300049590 Bacteria 4034
307 Ga0501074_0038431 3300049590 Bacteria 3468
308 Ga0501074_0086722 3300049590 Bacteria 2242
309 Ga0501074_0132925 3300049590 Bacteria 1780
310 Ga0501074_0165015 3300049590 Bacteria 1581
311 Ga0501074_0681226 3300049590 Bacteria 726
312 Ga0501075_0005501 3300049591 Bacteria 8668
313 Ga0501075_0006766 3300049591 Bacteria 7910
314 Ga0501075_0040503 3300049591 Bacteria 3489
315 Ga0501075_0096642 3300049591 Bacteria 2242
316 Ga0501075_0120039 3300049591 Bacteria 2000
317 Ga0501075_0313812 3300049591 Unclassified 1195
318 Ga0501075_0822021 3300049591 Bacteria 707
319 Ga0501076_0001090 3300049592 Bacteria 17846
320 Ga0501076_0004345 3300049592 Bacteria 10060
321 Ga0501076_0046250 3300049592 Bacteria 3438
322 Ga0501076_0062622 3300049592 Bacteria 2963
323 Ga0501076_0122684 3300049592 Bacteria 2104
324 Ga0501076_0284247 3300049592 Bacteria 1355
325 Ga0501076_0302284 3300049592 Bacteria 1312
326 Ga0501076_0691479 3300049592 Bacteria 842
327 Ga0501076_0846217 3300049592 Unclassified 754
328 Ga0501076_0962231 3300049592 Bacteria 703
329 Ga0501077_0026701 3300049593 Bacteria 3665
330 Ga0501077_0029548 3300049593 Bacteria 3484
331 Ga0501077_0030790 3300049593 Bacteria 3415
332 Ga0501077_0039931 3300049593 Bacteria 2990
333 Ga0501077_0167584 3300049593 Bacteria 1395
334 Ga0501077_0214264 3300049593 Bacteria 1224
335 Ga0501077_0587215 3300049593 Bacteria 715
336 Ga0501077_1002289 3300049593 Bacteria 537
337 Ga0501079_0003052 3300049741 Bacteria 12254
338 Ga0501079_0018514 3300049741 Bacteria 5321
339 Ga0501079_0021398 3300049741 Bacteria 4947
340 Ga0501079_0023510 3300049741 Bacteria 4729
341 Ga0501079_0028952 3300049741 Bacteria 4251
342 Ga0501079_0141053 3300049741 Bacteria 1877
343 Ga0501079_0171556 3300049741 Bacteria 1692
344 Ga0501079_0861978 3300049741 Bacteria 713
345 Ga0501079_1588184 3300049741 Bacteria 514
346 Ga0501080_0001996 3300049742 Bacteria 17609
347 Ga0501080_0010216 3300049742 Bacteria 8585
348 Ga0501080_0015691 3300049742 Bacteria 6984
349 Ga0501080_0056282 3300049742 Bacteria 3663
350 Ga0501080_0084938 3300049742 Bacteria 2941
351 Ga0501080_0096731 3300049742 Bacteria 2741
352 Ga0501080_0616615 3300049742 Bacteria 962
353 Ga0501081_0004577 3300049743 Bacteria 8880
354 Ga0501081_0006110 3300049743 Bacteria 7806
355 Ga0501081_0016048 3300049743 Bacteria 4946
356 Ga0501081_0041491 3300049743 Bacteria 3152
357 Ga0501081_0071446 3300049743 Bacteria 2419
358 Ga0501081_0413966 3300049743 Bacteria 999
359 Ga0501081_0547706 3300049743 Bacteria 864
360 Ga0501081_0575094 3300049743 Bacteria 842
361 Ga0501081_0581816 3300049743 Unclassified 837
362 Ga0501083_0020610 3300049744 Bacteria 4585
363 Ga0501083_0063733 3300049744 Bacteria 2458
364 Ga0501035_0002330 3300049822 Bacteria 18722
365 Ga0501035_0022490 3300049822 Bacteria 5791
366 Ga0501035_0117048 3300049822 Bacteria 2332
367 Ga0501035_0561895 3300049822 Bacteria 933
368 Ga0501035_0889640 3300049822 Bacteria 706
369 Ga0501044_0111679 3300049823 Bacteria 2740
370 Ga0501044_0125420 3300049823 Bacteria 2565
371 Ga0501044_0160808 3300049823 Bacteria 2223
372 Ga0501044_1182180 3300049823 Bacteria 633
373 Ga0501044_1419523 3300049823 Bacteria 560
374 Ga0501044_1446060 3300049823 Unclassified 553
375 Ga0501045_0003574 3300049824 Bacteria 10673
376 Ga0501045_0011493 3300049824 Bacteria 6217
377 Ga0501045_0048516 3300049824 Bacteria 3095
378 Ga0501045_0053587 3300049824 Bacteria 2947
379 Ga0501045_0318569 3300049824 Bacteria 1157
380 Ga0501045_0888161 3300049824 Bacteria 655
381 nmdc:mga00v17_56683_c1 3300050491 Bacteria 2396
382 nmdc:mga00v17_638710_c1 3300050491 Bacteria 685
383 nmdc:mga0yw44_257661_c1 3300050492 Bacteria 1162
384 nmdc:mga0yw44_338268_c1 3300050492 Unclassified 1012
385 nmdc:mga06z11_392103_c1 3300050494 Bacteria 835
386 nmdc:mga05p37_120738_c1 3300050507 Bacteria 3220
387 nmdc:mga05p37_157687_c1 3300050507 Bacteria 2773
388 nmdc:mga05p37_6955_c1 3300050507 Bacteria 13332
389 nmdc:mga09592_20924_c1 3300050508 Bacteria 5388
390 nmdc:mga09592_832107_c1 3300050508 Unclassified 779
391 nmdc:mga0qj67_25890_c1 3300050509 Bacteria 4538
392 nmdc:mga06r32_1109015_c1 3300050510 Bacteria 740
393 nmdc:mga06r32_2053248_c1 3300050510 Bacteria 505
394 nmdc:mga06r32_2062_c1 3300050510 Bacteria 17988
395 nmdc:mga08y16_1007397_c1 3300050511 Bacteria 813
396 nmdc:mga08y16_18799_c1 3300050511 Bacteria 7280
397 nmdc:mga08y16_59733_c1 3300050511 Bacteria 3983
398 nmdc:mga08y16_779200_c1 3300050511 Unclassified 951
399 nmdc:mga08y16_96903_c1 3300050511 Bacteria 3072
400 nmdc:mga0n895_283750_c1 3300050512 Bacteria 1679
401 nmdc:mga0n895_571377_c1 3300050512 Bacteria 1135
402 nmdc:mga08x19_1101941_c1 3300050514 Unclassified 563
403 nmdc:mga0a205_4647_c1 3300050515 Bacteria 12316
404 Ga0495619_0017046 3300053085 Bacteria 4605
405 Ga0501084_0001164 3300054114 Bacteria 20508
406 Ga0501084_0013005 3300054114 Bacteria 6887
407 Ga0501084_0034176 3300054114 Bacteria 4251
408 Ga0501084_0046418 3300054114 Bacteria 3639
409 Ga0501084_0165633 3300054114 Bacteria 1865
410 Ga0501084_0286216 3300054114 Bacteria 1392
411 Ga0501084_0304182 3300054114 Bacteria 1347
412 Ga0501084_0537791 3300054114 Bacteria 987
413 Ga0501084_0729469 3300054114 Unclassified 835
414 Ga0501084_1620210 3300054114 Unclassified 541
415 Ga0501082_0010084 3300060353 Bacteria 8140
416 Ga0501082_0016974 3300060353 Bacteria 6268
417 Ga0501082_0038614 3300060353 Bacteria 4119
418 Ga0501082_0098835 3300060353 Bacteria 2523
419 Ga0501082_0240635 3300060353 Bacteria 1575
420 Ga0501082_0281620 3300060353 Bacteria 1447
421 Ga0501082_0464500 3300060353 Bacteria 1106
422 Ga0501082_1261174 3300060353 Bacteria 646
423 Ga0501082_1408772 3300060353 Bacteria 609
424 Ga0530510_0005460 3300061734 Bacteria 8798
425 Ga0530510_0005779 3300061734 Bacteria 8574
426 Ga0530510_0110517 3300061734 Bacteria 2013
427 Ga0530510_0174488 3300061734 Bacteria 1593
428 Ga0530510_0273762 3300061734 Bacteria 1260
429 Ga0530510_0361838 3300061734 Bacteria 1090
430 Ga0530510_0605739 3300061734 Bacteria 833
431 Ga0530510_1156344 3300061734 Unclassified 593
432 Ga0530510_1263671 3300061734 Bacteria 566
433 Ga0070708_100263250
434 JGI24739J22299_10156845
435 JGI25406J46586_10036331
436 JGI25407J50210_10003634
437 Ga0070658_11337495
438 Ga0070683_100032892
439 Ga0070683_100523102
440 Ga0068869_100762715
441 Ga0070682_100052296
442 Ga0068868_100150196
443 Ga0070660_100202412
444 Ga0070691_10013509
445 Ga0070661_100297239
446 Ga0070692_10095612
447 Ga0070668_100083163
448 Ga0070675_100157809
449 Ga0070675_100889439
450 Ga0070675_101232275
451 Ga0070659_100038116
452 Ga0070659_100067402
453 Ga0070681_10087713
454 Ga0070698_101417414
455 Ga0070679_100454281
456 Ga0070679_100818067
457 Ga0070684_100043708
458 Ga0070684_100350946
459 Ga0070684_101420743
460 Ga0068853_100554556
461 Ga0070672_102033242
462 Ga0070704_101552065
463 Ga0068855_100577784
464 Ga0070664_100266088
465 Ga0068857_100596783
466 Ga0068857_100639224
467 Ga0068854_100235785
468 Ga0068852_101361782
469 Ga0068859_101761697
470 Ga0068864_101307137
471 Ga0068866_10154798
472 Ga0068851_11077813
473 Ga0081455_10027342
474 Ga0081455_10029079
475 Ga0081455_10093854
476 Ga0081538_10001664
477 Ga0081538_10013283
478 Ga0081539_10000244
479 Ga0075365_10025094
480 Ga0075365_10395880
481 Ga0075364_10815655
482 Ga0075432_10001198
483 Ga0075367_10062503
484 Ga0075428_100001437
485 Ga0075428_100117265
486 Ga0075430_100002418
487 Ga0075431_100038168
488 Ga0075431_101017449
489 Ga0075433_10272861
490 Ga0075434_100125077
491 Ga0075434_100526221
492 Ga0075429_100018177
493 Ga0068865_100428505
494 Ga0097620_101761976
495 Ga0111539_10004397
496 Ga0111539_10006367
497 Ga0111539_10062459
498 Ga0111539_10655178
499 Ga0111539_11091255
500 Ga0105245_10467084
501 Ga0114129_10003661
502 Ga0114129_10057197
503 Ga0114129_11156012
504 Ga0114129_11538001
505 Ga0114129_11988398
506 Ga0105243_10038984
507 Ga0105243_11067555
508 Ga0105249_11235908
509 Ga0105239_10038925
510 Ga0105239_10056375
511 Ga0182008_10126883
512 Ga0157377_10151428
513 Ga0157377_10447424
514 Ga0207688_10059292
515 Ga0207688_10350463
516 Ga0207643_10135010
517 Ga0207707_11322298
518 Ga0207657_10242860
519 Ga0207649_11422922
520 Ga0207652_10275357
521 Ga0207652_10843017
522 Ga0207681_10128422
523 Ga0207681_10374495
524 Ga0207659_10656419
525 Ga0207659_11178166
526 Ga0207659_11582808
527 Ga0207687_10004296
528 Ga0207690_10070205
529 Ga0207690_10229807
530 Ga0207709_11467239
531 Ga0207704_10443304
532 Ga0207691_10645581
533 Ga0207661_10124624
534 Ga0207679_11174971
535 Ga0207668_10029858
536 Ga0207640_10269943
537 Ga0207677_10124424
538 Ga0207641_11334843
539 Ga0207676_12312474
540 Ga0207676_12520159
541 Ga0207674_10659844
542 Ga0207674_10675373
543 Ga0207428_10002440
544 Ga0207428_10011119
545 Ga0207428_10047965
546 Ga0207428_10072267
547 Ga0207428_10641006
548 Ga0265326_10216318
549 Ga0265319_1013980
550 Ga0265334_10004996
551 Ga0265318_10003432
552 Ga0265336_10045593
553 Ga0265338_10005535
554 Ga0265338_10019247
555 Ga0265338_10189039
556 Ga0265324_10040369
557 Ga0265330_10013282
558 Ga0265330_10319185
559 Ga0265332_10023727
560 Ga0265328_10005014
561 Ga0265328_10168533
562 Ga0265320_10012482
563 Ga0265320_10053204
564 Ga0265325_10025076
565 Ga0265329_10003092
566 Ga0265340_10005581
567 Ga0265339_10019608
568 Ga0265339_10036828
569 Ga0265331_10028827
570 Ga0265327_10006678
571 Ga0265327_10027705
572 Ga0265316_10012519
573 Ga0265316_10178596
574 Ga0307408_100258900
575 Ga0265313_10002613
576 Ga0265314_10022259
577 Ga0265314_10156788
578 Ga0265342_10029002
579 Ga0307416_101191916
580 Ga0373956_0032519
581 Ga0373957_0103269
582 Ga0373931_0095744
583 Ga0373933_0106067
584 Ga0373937_0083754
585 Ga0395899_0252458
586 Ga0395900_0379892
587 Ga0395900_1561071
588 Ga0395901_0324011
589 Ga0395901_1280650
590 Ga0395901_1347478
591 Ga0451853_2194367
592 Ga0439455_0097554
593 Ga0439456_104977
594 Ga0450906_032144
595 Ga0439460_0071602
596 Ga0466967_1419050
597 Ga0495592_0944391
598 Ga0495603_0004398
599 Ga0495651_0164321
600 Ga0495653_0142186
601 Ga0495584_0313181
602 Ga0495616_0238810
603 Ga0495628_0544129
604 Ga0495631_0175834
605 Ga0495642_0282525
606 Ga0495667_0190338
607 Ga0495656_0783405
608 Ga0495634_0024571
609 Ga0495635_0076637
610 Ga0495659_0116061
611 Ga0495661_0152977
612 Ga0495588_0010385
613 Ga0495599_0632903
614 Ga0495670_0102085
615 Ga0495600_0084541
616 Ga0495604_0321038
617 Ga0495636_0615223
618 Ga0495680_0020973
619 Ga0495675_0406859
620 Ga0495684_0097503
621 Ga0495684_0100380
622 Ga0495602_0693180
623 Ga0495602_0726197
624 Ga0496106_1360402
625 Ga0496110_0042773
626 Ga0501031_0016860
627 Ga0501031_0018988
628 Ga0501031_0023872
629 Ga0501031_0116055
630 Ga0501031_0278964
631 Ga0501031_0639890
632 Ga0501032_0008902
633 Ga0501032_0497908
634 Ga0501032_0881159
635 Ga0501033_0002824
636 Ga0501033_0053893
637 Ga0501033_0399764
638 Ga0501034_0603243
639 Ga0501036_0003036
640 Ga0501036_0026502
641 Ga0501036_0029239
642 Ga0501036_0042277
643 Ga0501036_0113448
644 Ga0501036_0181098
645 Ga0501036_0669386
646 Ga0501036_1126684
647 Ga0501037_0000851
648 Ga0501037_0141010
649 Ga0501037_0201412
650 Ga0501037_0763389
651 Ga0501038_0000817
652 Ga0501038_0035795
653 Ga0501038_0038400
654 Ga0501038_0038422
655 Ga0501038_0410544
656 Ga0501039_0018588
657 Ga0501039_0019826
658 Ga0501039_0020659
659 Ga0501039_0036084
660 Ga0501039_0148030
661 Ga0501039_0272774
662 Ga0501040_0004296
663 Ga0501040_0013240
664 Ga0501040_0019961
665 Ga0501040_0030916
666 Ga0501040_0036029
667 Ga0501040_0418086
668 Ga0501040_0463311
669 Ga0501040_0554714
670 Ga0501041_0003739
671 Ga0501041_0011212
672 Ga0501041_0015443
673 Ga0501041_0295095
674 Ga0501041_0414283
675 Ga0501041_0654618
676 Ga0501042_0015486
677 Ga0501042_0016993
678 Ga0501042_0052534
679 Ga0501042_0077155
680 Ga0501042_0096989
681 Ga0501042_0205053
682 Ga0501042_1129776
683 Ga0501043_0016623
684 Ga0501043_0023109
685 Ga0501043_0180502
686 Ga0501046_0017207
687 Ga0501046_0047248
688 Ga0501046_0101991
689 Ga0501046_0137593
690 Ga0501046_0347312
691 Ga0501046_0618857
692 Ga0501047_0088312
693 Ga0501047_0138372
694 Ga0501048_0008736
695 Ga0501048_0022441
696 Ga0501048_0036757
697 Ga0501048_0044602
698 Ga0501048_0143417
699 Ga0501048_0255124
700 Ga0501048_0341344
701 Ga0501048_0824448
702 Ga0501048_0951344
703 Ga0501068_0002229
704 Ga0501068_0112763
705 Ga0501068_0159540
706 Ga0501069_0056530
707 Ga0501069_0366397
708 Ga0501069_0521641
709 Ga0501070_0018417
710 Ga0501070_0239722
711 Ga0501070_0731717
712 Ga0501071_0020157
713 Ga0501071_0021342
714 Ga0501071_0022473
715 Ga0501071_0033868
716 Ga0501071_0054393
717 Ga0501071_0157072
718 Ga0501071_0365655
719 Ga0501071_0457731
720 Ga0501071_0919640
721 Ga0501071_0956720
722 Ga0501071_1402036
723 Ga0501072_0000966
724 Ga0501072_0002830
725 Ga0501072_0022668
726 Ga0501072_0023075
727 Ga0501072_0037664
728 Ga0501072_0089048
729 Ga0501072_0120688
730 Ga0501072_0159047
731 Ga0501072_0312576
732 Ga0501072_0334898
733 Ga0501072_0812632
734 Ga0501072_1477798
735 Ga0501073_0004374
736 Ga0501073_0340645
737 Ga0501073_0353525
738 Ga0501074_0028682
739 Ga0501074_0038431
740 Ga0501074_0086722
741 Ga0501074_0132925
742 Ga0501074_0165015
743 Ga0501074_0681226
744 Ga0501075_0005501
745 Ga0501075_0006766
746 Ga0501075_0040503
747 Ga0501075_0096642
748 Ga0501075_0120039
749 Ga0501075_0313812
750 Ga0501075_0822021
751 Ga0501076_0001090
752 Ga0501076_0004345
753 Ga0501076_0046250
754 Ga0501076_0062622
755 Ga0501076_0122684
756 Ga0501076_0284247
757 Ga0501076_0302284
758 Ga0501076_0691479
759 Ga0501076_0846217
760 Ga0501076_0962231
761 Ga0501077_0026701
762 Ga0501077_0029548
763 Ga0501077_0030790
764 Ga0501077_0039931
765 Ga0501077_0167584
766 Ga0501077_0214264
767 Ga0501077_0587215
768 Ga0501077_1002289
769 Ga0501079_0003052
770 Ga0501079_0018514
771 Ga0501079_0021398
772 Ga0501079_0023510
773 Ga0501079_0028952
774 Ga0501079_0141053
775 Ga0501079_0171556
776 Ga0501079_0861978
777 Ga0501079_1588184
778 Ga0501080_0001996
779 Ga0501080_0010216
780 Ga0501080_0015691
781 Ga0501080_0056282
782 Ga0501080_0084938
783 Ga0501080_0096731
784 Ga0501080_0616615
785 Ga0501081_0004577
786 Ga0501081_0006110
787 Ga0501081_0016048
788 Ga0501081_0041491
789 Ga0501081_0071446
790 Ga0501081_0413966
791 Ga0501081_0547706
792 Ga0501081_0575094
793 Ga0501081_0581816
794 Ga0501083_0020610
795 Ga0501083_0063733
796 Ga0501035_0002330
797 Ga0501035_0022490
798 Ga0501035_0117048
799 Ga0501035_0561895
800 Ga0501035_0889640
801 Ga0501044_0111679
802 Ga0501044_0125420
803 Ga0501044_0160808
804 Ga0501044_1182180
805 Ga0501044_1419523
806 Ga0501044_1446060
807 Ga0501045_0003574
808 Ga0501045_0011493
809 Ga0501045_0048516
810 Ga0501045_0053587
811 Ga0501045_0318569
812 Ga0501045_0888161
813 nmdc:mga00v17_56683_c1
814 nmdc:mga00v17_638710_c1
815 nmdc:mga0yw44_257661_c1
816 nmdc:mga0yw44_338268_c1
817 nmdc:mga06z11_392103_c1
818 nmdc:mga05p37_120738_c1
819 nmdc:mga05p37_157687_c1
820 nmdc:mga05p37_6955_c1
821 nmdc:mga09592_20924_c1
822 nmdc:mga09592_832107_c1
823 nmdc:mga0qj67_25890_c1
824 nmdc:mga06r32_1109015_c1
825 nmdc:mga06r32_2053248_c1
826 nmdc:mga06r32_2062_c1
827 nmdc:mga08y16_1007397_c1
828 nmdc:mga08y16_18799_c1
829 nmdc:mga08y16_59733_c1
830 nmdc:mga08y16_779200_c1
831 nmdc:mga08y16_96903_c1
832 nmdc:mga0n895_283750_c1
833 nmdc:mga0n895_571377_c1
834 nmdc:mga08x19_1101941_c1
835 nmdc:mga0a205_4647_c1
836 Ga0495619_0017046
837 Ga0501084_0001164
838 Ga0501084_0013005
839 Ga0501084_0034176
840 Ga0501084_0046418
841 Ga0501084_0165633
842 Ga0501084_0286216
843 Ga0501084_0304182
844 Ga0501084_0537791
845 Ga0501084_0729469
846 Ga0501084_1620210
847 Ga0501082_0010084
848 Ga0501082_0016974
849 Ga0501082_0038614
850 Ga0501082_0098835
851 Ga0501082_0240635
852 Ga0501082_0281620
853 Ga0501082_0464500
854 Ga0501082_1261174
855 Ga0501082_1408772
856 Ga0530510_0005460
857 Ga0530510_0005779
858 Ga0530510_0110517
859 Ga0530510_0174488
860 Ga0530510_0273762
861 Ga0530510_0361838
862 Ga0530510_0605739
863 Ga0530510_1156344
864 Ga0530510_1263671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00576

Transthyretin

HIUase/Transthyretin family

4

116

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3glz-assembly1.cif.gz_B human transthyretin (ttr) complexed with(e)-3-(2-(trifluoromethyl)benzylideneaminooxy)propanoic acid (inhibitor 11) 0.9055 5 95
3qva-assembly1.cif.gz_C structure of klebsiella pneumoniae 5-hydroxyisourate hydrolase 0.9021 3 95
3qva-assembly1.cif.gz_D structure of klebsiella pneumoniae 5-hydroxyisourate hydrolase 0.8951 4 95
3gs4-assembly1.cif.gz_B human transthyretin (ttr) complexed with 3-(9h-fluoren-9-ylideneaminooxy)propanoic acid (inhibitor 15) 0.893 5 94
2flm-assembly1.cif.gz_B-2 human transthyretin (ttr) complexed with bivalant amyloid inhibitor (6 carbon linker) 0.8923 5 94
ID Description Score Start End Superfamily
af_Q54LD6_18_133_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9095 2 93 2.60.40.180
3qvaD00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.8951 4 95 2.60.40.180
af_O44578_18_134_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.8926 4 93 2.60.40.180
3cbrB00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.8917 5 94 2.60.40.180
af_Q54LD6_18_133_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.8733 2 93 2.60.40.180
ID Description Score Start End GO Terms
AF-A0A538DYX6-F1-model_v4 Hydroxyisourate hydrolase 0.9845 1 95 GO:0006144
GO:0016787
AF-A0A7V9UZ10-F1-model_v4 Hydroxyisourate hydrolase 0.9826 3 95 GO:0006144
GO:0016787
AF-A0A538DYX6-F1-model_v4 Hydroxyisourate hydrolase 0.9743 1 95 GO:0006144
GO:0016787
AF-A0A538ITE4-F1-model_v4 Hydroxyisourate hydrolase 0.9647 1 95 GO:0006144
GO:0016787
AF-A0A538ITE4-F1-model_v4 Hydroxyisourate hydrolase 0.9548 1 95 GO:0006144
GO:0016787

Map