F442499

General Info

Members Datasets Scaffolds Average Seq Length
431 259 400 406

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2811994874|2812334678
Length 428
Sequence PFDLVPEPGKSQPIRMGCSRYAELSRAELATLVPELLLMGQLIDRSGMAWCIAAFGREEMLQVAIEEWAAASPIYTRRMQQALGYAPAVPGQGDVVTIFKGLQLDIGAPPQFMDFRYTVHDPWHGEFRLDHCGALVDVEPMGADYVRGMCHDIEDPTFDATAIATNPHAQVRPIHRPPRVPADRSPHCAWTVTIDPAFPEPTPVPALAVNERSRAALLELAPIDPSDDGLAGYAGPLLSDVDFAAFSHSALVRIADEVCLQMHLLDRGFALAVAERVETDAELLKLRRKQLTGIAGIGAERLARALDLPRDAAGALRAIWLHPLLNPAAYVAASADAAAITVAPGPADEDAAWISLCGPDWPDALRAIAGAVDPHLDARVTASPRGGWQVEVVAGEERPEAEEVAVTRFSTGASFVFEPRRSIPITPV

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2643221576 Nocardioides sp. Root614 Isolate Unclassified
4 2643221590 Nocardioides sp. Root682 Isolate Unclassified
5 2643221604 Nocardioides sp. Root190 Isolate Unclassified
6 2643221617 Nocardioides sp. Root79 Isolate Unclassified
7 2643221620 Nocardioides sp. Root240 Isolate Unclassified
8 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
9 2643221692 Nocardia sp. Root136 Isolate Unclassified
10 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
11 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
12 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
13 2738541305 Nocardioides sp. CF167 Isolate Unclassified
14 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
15 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
16 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
17 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
18 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
19 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
20 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
21 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
22 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
23 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
24 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
25 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
26 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
27 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
28 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
29 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
30 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
31 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
32 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
249 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
254 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
255 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 0
Isolates 7.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.71
Nodule 0.23
Rhizoplane 9.74
Rhizosphere 60.32
Stem 0
Stem Tuber 0
Unclassified 12.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10001423 3300002077 Unclassified 4747
2 JGI25406J46586_10003123 3300003203 Bacteria 7783
3 rootH2_10112827 3300003320 Bacteria 10399
4 Ga0055540_1000071 3300003792 Bacteria 117607
5 Ga0055540_1001342 3300003792 Bacteria 14830
6 Ga0055540_1001578 3300003792 Bacteria 13291
7 Ga0055540_1004351 3300003792 Bacteria 6432
8 Ga0070658_10244745 3300005327 Bacteria 1521
9 Ga0068869_100036778 3300005334 Bacteria 3477
10 Ga0070666_10199948 3300005335 Bacteria 1406
11 Ga0070682_100063274 3300005337 Bacteria 2345
12 Ga0068868_100002325 3300005338 Bacteria 13149
13 Ga0070660_100068377 3300005339 Bacteria 2769
14 Ga0070689_100015199 3300005340 Bacteria 5609
15 Ga0070691_10002630 3300005341 Bacteria 8001
16 Ga0070668_100002986 3300005347 Bacteria 12511
17 Ga0070668_100071836 3300005347 Bacteria 2696
18 Ga0070669_100092505 3300005353 Bacteria 2270
19 Ga0070675_100209900 3300005354 Bacteria 1692
20 Ga0070671_100089733 3300005355 Bacteria 2573
21 Ga0070674_100026782 3300005356 Bacteria 3770
22 Ga0070659_100031380 3300005366 Bacteria 4115
23 Ga0070667_100000535 3300005367 Bacteria 37853
24 Ga0070667_100001027 3300005367 Bacteria 25488
25 Ga0070667_100054721 3300005367 Bacteria 3370
26 Ga0070667_100086132 3300005367 Bacteria 2695
27 Ga0070667_100118603 3300005367 Bacteria 2300
28 Ga0070709_10046866 3300005434 Bacteria 2690
29 Ga0070709_10059305 3300005434 Bacteria 2430
30 Ga0070713_100021366 3300005436 Bacteria 4976
31 Ga0070710_10000927 3300005437 Bacteria 13974
32 Ga0070711_100015074 3300005439 Bacteria 4884
33 Ga0070700_100051139 3300005441 Bacteria 2571
34 Ga0070700_100112993 3300005441 Bacteria 1809
35 Ga0070663_100000704 3300005455 Bacteria 18056
36 Ga0070663_100148240 3300005455 Bacteria 1797
37 Ga0070678_100001013 3300005456 Bacteria 14617
38 Ga0070662_100006531 3300005457 Bacteria 7523
39 Ga0070662_100211549 3300005457 Bacteria 1543
40 Ga0068867_100007500 3300005459 Bacteria 7715
41 Ga0068867_100148462 3300005459 Bacteria 1839
42 Ga0070685_10079528 3300005466 Bacteria 1962
43 Ga0068853_100009857 3300005539 Bacteria 7710
44 Ga0070695_100005991 3300005545 Bacteria 7180
45 Ga0070696_100005238 3300005546 Bacteria 8665
46 Ga0070696_100122748 3300005546 Bacteria 1882
47 Ga0070693_100008642 3300005547 Bacteria 5036
48 Ga0070665_100028522 3300005548 Bacteria 5622
49 Ga0070665_100171453 3300005548 Bacteria 2171
50 Ga0070704_100001452 3300005549 Bacteria 12702
51 Ga0070704_100030194 3300005549 Bacteria 3629
52 Ga0068854_100001661 3300005578 Bacteria 13545
53 Ga0070702_100014355 3300005615 Bacteria 4018
54 Ga0070702_100144517 3300005615 Bacteria 1519
55 Ga0068852_100061210 3300005616 Bacteria 3271
56 Ga0068859_100001593 3300005617 Bacteria 23142
57 Ga0068866_10001603 3300005718 Bacteria 9583
58 Ga0068861_100001508 3300005719 Bacteria 14758
59 Ga0068861_100061979 3300005719 Bacteria 2871
60 Ga0068863_100000143 3300005841 Bacteria 75127
61 Ga0068863_100000277 3300005841 Bacteria 53361
62 Ga0068863_100192986 3300005841 Bacteria 1957
63 Ga0068858_100012625 3300005842 Bacteria 7964
64 Ga0068860_100000079 3300005843 Bacteria 170752
65 Ga0068860_100001146 3300005843 Bacteria 29082
66 Ga0068860_100005332 3300005843 Bacteria 13048
67 Ga0068860_100238763 3300005843 Bacteria 1767
68 Ga0068862_100000093 3300005844 Bacteria 106838
69 Ga0068862_100011543 3300005844 Bacteria 7288
70 Ga0068862_100094213 3300005844 Bacteria 2612
71 Ga0081539_10000179 3300005985 Bacteria 149126
72 Ga0081539_10011084 3300005985 Bacteria 7202
73 Ga0075365_10013898 3300006038 Bacteria 4830
74 Ga0075365_10166503 3300006038 Bacteria 1538
75 Ga0075368_10001648 3300006042 Bacteria 7165
76 Ga0075368_10002514 3300006042 Bacteria 5997
77 Ga0075363_100002284 3300006048 Bacteria 7775
78 Ga0075363_100025014 3300006048 Bacteria 3041
79 Ga0075363_100028565 3300006048 Bacteria 2871
80 Ga0075364_10000725 3300006051 Bacteria 17255
81 Ga0075364_10011587 3300006051 Bacteria 5358
82 Ga0075364_10049997 3300006051 Bacteria 2728
83 Ga0075364_10159556 3300006051 Bacteria 1522
84 Ga0070715_10002248 3300006163 Bacteria 5864
85 Ga0070716_100006071 3300006173 Bacteria 5888
86 Ga0070716_100092522 3300006173 Bacteria 1833
87 Ga0070712_100010377 3300006175 Bacteria 5876
88 Ga0070712_100010496 3300006175 Bacteria 5847
89 Ga0075367_10006360 3300006178 Bacteria 5958
90 Ga0075367_10079650 3300006178 Bacteria 1980
91 Ga0075367_10094330 3300006178 Bacteria 1824
92 Ga0075369_10000029 3300006186 Bacteria 39213
93 Ga0075369_10010956 3300006186 Bacteria 3556
94 Ga0075369_10026993 3300006186 Bacteria 2398
95 Ga0075369_10034713 3300006186 Bacteria 2141
96 Ga0075369_10053328 3300006186 Bacteria 1755
97 Ga0075369_10053460 3300006186 Bacteria 1753
98 Ga0097621_100050898 3300006237 Bacteria 3369
99 Ga0075370_10000916 3300006353 Bacteria 12114
100 Ga0075370_10023872 3300006353 Bacteria 3372
101 Ga0075370_10032893 3300006353 Bacteria 2902
102 Ga0075370_10069302 3300006353 Bacteria 2015
103 Ga0075428_100007875 3300006844 Bacteria 11813
104 Ga0075430_100012559 3300006846 Bacteria 7211
105 Ga0075431_100021357 3300006847 Bacteria 6620
106 Ga0068865_100015012 3300006881 Bacteria 4933
107 Ga0097620_100001593 3300006931 Bacteria 23142
108 Ga0111539_10218356 3300009094 Bacteria 2221
109 Ga0105245_10008472 3300009098 Bacteria 8974
110 Ga0105247_10000044 3300009101 Bacteria 153728
111 Ga0105247_10002130 3300009101 Bacteria 13679
112 Ga0105247_10053896 3300009101 Bacteria 2482
113 Ga0114129_10067451 3300009147 Bacteria 4990
114 Ga0105243_10006087 3300009148 Bacteria 9326
115 Ga0105241_10024816 3300009174 Bacteria 4454
116 Ga0105242_10002099 3300009176 Bacteria 15700
117 Ga0105248_10000641 3300009177 Bacteria 39742
118 Ga0105248_10036479 3300009177 Bacteria 5498
119 Ga0105248_10042639 3300009177 Bacteria 5089
120 Ga0105237_10004965 3300009545 Bacteria 15182
121 Ga0105237_10049265 3300009545 Bacteria 4234
122 Ga0105249_10000049 3300009553 Bacteria 169899
123 Ga0105249_10006471 3300009553 Bacteria 10189
124 Ga0105239_10003558 3300010375 Bacteria 19045
125 Ga0105239_10021969 3300010375 Bacteria 7033
126 Ga0105239_10032417 3300010375 Bacteria 5742
127 Ga0105239_10093469 3300010375 Bacteria 3321
128 Ga0157374_10030722 3300013296 Bacteria 4880
129 Ga0157378_10006985 3300013297 Bacteria 9850
130 Ga0163162_10020042 3300013306 Bacteria 6568
131 Ga0163162_10020332 3300013306 Bacteria 6521
132 Ga0157372_10031294 3300013307 Bacteria 5826
133 Ga0157375_10006104 3300013308 Bacteria 10506
134 Ga0157375_10090069 3300013308 Bacteria 3125
135 Ga0163163_10287558 3300014325 Bacteria 1696
136 Ga0157380_10003346 3300014326 Bacteria 10992
137 Ga0157380_10156621 3300014326 Bacteria 1975
138 Ga0157379_10141225 3300014968 Bacteria 2171
139 Ga0157376_10036171 3300014969 Bacteria 3998
140 Ga0163161_10001520 3300017792 Bacteria 17172
141 Ga0209051_1000033 3300025303 Bacteria 380540
142 Ga0209051_1000776 3300025303 Bacteria 33909
143 Ga0209051_1002729 3300025303 Bacteria 12253
144 Ga0209051_1005787 3300025303 Bacteria 7118
145 Ga0207692_10039680 3300025898 Bacteria 2318
146 Ga0207710_10000066 3300025900 Bacteria 153734
147 Ga0207688_10001970 3300025901 Bacteria 11004
148 Ga0207688_10003152 3300025901 Bacteria 8997
149 Ga0207647_10009472 3300025904 Bacteria 6917
150 Ga0207654_10109952 3300025911 Bacteria 1713
151 Ga0207671_10012965 3300025914 Bacteria 6670
152 Ga0207671_10049217 3300025914 Bacteria 3120
153 Ga0207693_10000197 3300025915 Bacteria 54675
154 Ga0207693_10002311 3300025915 Bacteria 16577
155 Ga0207657_10038513 3300025919 Bacteria 4256
156 Ga0207657_10051362 3300025919 Bacteria 3583
157 Ga0207657_10203210 3300025919 Bacteria 1593
158 Ga0207681_10016969 3300025923 Bacteria 4567
159 Ga0207659_10198284 3300025926 Bacteria 1601
160 Ga0207687_10008880 3300025927 Bacteria 6572
161 Ga0207687_10084242 3300025927 Bacteria 2304
162 Ga0207644_10061739 3300025931 Bacteria 2715
163 Ga0207690_10115053 3300025932 Bacteria 1943
164 Ga0207706_10002775 3300025933 Bacteria 17025
165 Ga0207706_10271169 3300025933 Bacteria 1481
166 Ga0207686_10034402 3300025934 Bacteria 3033
167 Ga0207709_10001414 3300025935 Bacteria 16810
168 Ga0207709_10037832 3300025935 Bacteria 2869
169 Ga0207670_10013985 3300025936 Bacteria 4751
170 Ga0207669_10044479 3300025937 Bacteria 2609
171 Ga0207704_10068503 3300025938 Bacteria 2237
172 Ga0207665_10059714 3300025939 Bacteria 2581
173 Ga0207691_10159805 3300025940 Bacteria 1977
174 Ga0207711_10000058 3300025941 Bacteria 133317
175 Ga0207689_10005569 3300025942 Bacteria 11244
176 Ga0207689_10016496 3300025942 Bacteria 6252
177 Ga0207712_10000038 3300025961 Bacteria 192762
178 Ga0207712_10139280 3300025961 Bacteria 1860
179 Ga0207668_10010715 3300025972 Bacteria 5548
180 Ga0207668_10113083 3300025972 Bacteria 2041
181 Ga0207640_10005779 3300025981 Bacteria 6745
182 Ga0207658_10004152 3300025986 Bacteria 10093
183 Ga0207658_10009345 3300025986 Bacteria 6649
184 Ga0207658_10323076 3300025986 Bacteria 1336
185 Ga0207677_10155887 3300026023 Bacteria 1768
186 Ga0207639_10093536 3300026041 Bacteria 2411
187 Ga0207678_10000040 3300026067 Bacteria 100102
188 Ga0207678_10026326 3300026067 Bacteria 5074
189 Ga0207708_10003700 3300026075 Bacteria 11290
190 Ga0207708_10011368 3300026075 Bacteria 6629
191 Ga0207641_10000232 3300026088 Bacteria 71885
192 Ga0207641_10026891 3300026088 Bacteria 4750
193 Ga0207648_10001194 3300026089 Bacteria 29114
194 Ga0207648_10032137 3300026089 Bacteria 4637
195 Ga0207675_100003156 3300026118 Bacteria 16170
196 Ga0207675_100037624 3300026118 Bacteria 4513
197 Ga0207675_100105729 3300026118 Bacteria 2653
198 Ga0207683_10003067 3300026121 Bacteria 14603
199 Ga0207698_10119794 3300026142 Bacteria 2225
200 Ga0207428_10162449 3300027907 Bacteria 1695
201 Ga0268266_10024036 3300028379 Bacteria 5186
202 Ga0268266_10046953 3300028379 Bacteria 3697
203 Ga0268265_10000053 3300028380 Bacteria 170215
204 Ga0268265_10064147 3300028380 Bacteria 2829
205 Ga0268265_10078959 3300028380 Bacteria 2590
206 Ga0268264_10000017 3300028381 Bacteria 498037
207 Ga0268264_10000155 3300028381 Bacteria 156029
208 Ga0307515_10103134 3300028794 Bacteria 3423
209 Ga0307515_10233706 3300028794 Bacteria 1624
210 Ga0316182_1302543 3300030745 Bacteria 3900
211 Ga0265327_10000128 3300031251 Bacteria 165601
212 Ga0265327_10003633 3300031251 Bacteria 14510
213 Ga0265327_10010613 3300031251 Bacteria 6449
214 Ga0307405_10019352 3300031731 Bacteria 3780
215 Ga0307410_10012128 3300031852 Bacteria 4966
216 Ga0307406_10160907 3300031901 Bacteria 1614
217 Ga0307409_100004501 3300031995 Bacteria 7848
218 Ga0307409_100027438 3300031995 Bacteria 4036
219 Ga0307409_100170337 3300031995 Bacteria 1916
220 Ga0307416_100007223 3300032002 Bacteria 7037
221 Ga0307416_100114185 3300032002 Bacteria 2389
222 Ga0307414_10153466 3300032004 Bacteria 1820
223 Ga0307415_100001675 3300032126 Bacteria 10754
224 Ga0395900_0066417 3300037418 Bacteria 3706
225 Ga0439465_0000749 3300041413 Bacteria 10052
226 Ga0439465_0003963 3300041413 Bacteria 4830
227 Ga0451793_1237962 3300041452 Bacteria 3342
228 Ga0451851_0058072 3300041507 Bacteria 1264
229 Ga0439445_0004457 3300042004 Bacteria 3173
230 Ga0439448_0003211 3300042005 Bacteria 4511
231 Ga0439434_0034274 3300042435 Bacteria 1550
232 Ga0466969_0027213 3300044656 Bacteria 2929
233 Ga0466969_0030772 3300044656 Bacteria 2734
234 Ga0466972_0001604 3300044658 Bacteria 11046
235 Ga0466972_0004673 3300044658 Bacteria 6857
236 Ga0466972_0073656 3300044658 Bacteria 1628
237 Ga0466965_0006125 3300044683 Bacteria 5439
238 Ga0466965_0052693 3300044683 Bacteria 2021
239 Ga0466966_0009663 3300044684 Bacteria 6385
240 Ga0466961_0020083 3300044693 Bacteria 4299
241 Ga0466963_0007795 3300044694 Bacteria 6403
242 Ga0466971_0056385 3300044719 Bacteria 1772
243 Ga0466970_0075175 3300044765 Bacteria 1819
244 Ga0466957_0001665 3300044842 Bacteria 11671
245 Ga0466960_0005101 3300044901 Bacteria 5191
246 Ga0466960_0038928 3300044901 Bacteria 2239
247 Ga0466967_0001559 3300045976 Bacteria 13444
248 Ga0466967_0091826 3300045976 Bacteria 2760
249 Ga0466967_0096953 3300045976 Bacteria 2691
250 Ga0466967_0149467 3300045976 Bacteria 2182
251 Ga0466967_0302386 3300045976 Bacteria 1539
252 Ga0495638_0002686 3300046460 Bacteria 14324
253 Ga0495638_0004575 3300046460 Bacteria 10469
254 Ga0495582_0113308 3300046473 Bacteria 1524
255 Ga0495648_0002131 3300046524 Bacteria 18629
256 Ga0495672_0004722 3300047320 Bacteria 11013
257 Ga0495672_0018408 3300047320 Bacteria 4638
258 Ga0495676_0058378 3300047321 Bacteria 3036
259 Ga0495673_0002114 3300047469 Bacteria 14439
260 Ga0495626_0030021 3300048091 Bacteria 2624
261 Ga0496100_0000029 3300048903 Bacteria 110710
262 Ga0496100_0034281 3300048903 Bacteria 3184
263 Ga0496100_0077693 3300048903 Bacteria 2232
264 Ga0496100_0184545 3300048903 Bacteria 1510
265 Ga0496101_0000015 3300048904 Bacteria 252368
266 Ga0496101_0000031 3300048904 Bacteria 195195
267 Ga0496101_0019771 3300048904 Bacteria 4604
268 Ga0496102_0000065 3300048905 Bacteria 161370
269 Ga0496102_0000559 3300048905 Bacteria 39807
270 Ga0496102_0004254 3300048905 Bacteria 12101
271 Ga0496102_0050553 3300048905 Bacteria 3785
272 Ga0496103_0000048 3300048906 Bacteria 160911
273 Ga0496103_0001418 3300048906 Bacteria 16076
274 Ga0496103_0013949 3300048906 Bacteria 4771
275 Ga0496103_0034139 3300048906 Bacteria 3110
276 Ga0496103_0131756 3300048906 Bacteria 1597
277 Ga0496104_0121012 3300048907 Bacteria 2513
278 Ga0496105_0090729 3300048908 Bacteria 2524
279 Ga0496105_0138783 3300048908 Bacteria 2002
280 Ga0496106_0000396 3300048909 Bacteria 31087
281 Ga0496106_0011084 3300048909 Bacteria 6666
282 Ga0496107_0000330 3300048910 Bacteria 25647
283 Ga0496107_0011248 3300048910 Bacteria 6228
284 Ga0496108_0010614 3300048911 Bacteria 7473
285 Ga0496108_0052762 3300048911 Bacteria 3409
286 Ga0496108_0085038 3300048911 Bacteria 2685
287 Ga0496109_0000134 3300048912 Bacteria 75662
288 Ga0496109_0020199 3300048912 Bacteria 5882
289 Ga0496109_0026118 3300048912 Bacteria 5206
290 Ga0496109_0179906 3300048912 Bacteria 1986
291 Ga0496109_0503884 3300048912 Bacteria 1143
292 Ga0496110_0003464 3300048913 Bacteria 12096
293 Ga0496110_0092103 3300048913 Bacteria 2712
294 Ga0496111_0049081 3300048914 Bacteria 3043
295 Ga0496112_0036807 3300048915 Bacteria 4775
296 Ga0496112_0218960 3300048915 Bacteria 1860
297 Ga0496114_0000716 3300048917 Bacteria 24693
298 Ga0496114_0002600 3300048917 Bacteria 13777
299 Ga0496114_0020921 3300048917 Bacteria 5314
300 Ga0496114_0211728 3300048917 Bacteria 1700
301 Ga0496115_0003676 3300048918 Bacteria 11041
302 Ga0496116_0000125 3300048919 Bacteria 160885
303 Ga0496116_0033785 3300048919 Bacteria 3622
304 Ga0496117_0000111 3300048920 Bacteria 184570
305 Ga0496117_0001352 3300048920 Bacteria 35887
306 Ga0496118_0000083 3300048921 Bacteria 184570
307 Ga0496118_0003684 3300048921 Bacteria 18997
308 Ga0496118_0009678 3300048921 Bacteria 9687
309 Ga0496119_0004014 3300048922 Bacteria 14877
310 Ga0496119_0016106 3300048922 Bacteria 5710
311 Ga0496119_0026863 3300048922 Bacteria 3977
312 Ga0496120_0001769 3300048923 Bacteria 24335
313 Ga0496120_0030132 3300048923 Bacteria 3303
314 Ga0496121_0000004 3300048924 Bacteria 1139011
315 Ga0496121_0001000 3300048924 Bacteria 50532
316 Ga0496121_0009728 3300048924 Bacteria 10998
317 Ga0496122_0000138 3300048925 Bacteria 169434
318 Ga0496122_0044212 3300048925 Bacteria 3479
319 Ga0496123_0007870 3300048926 Bacteria 9908
320 Ga0496124_0000012 3300048927 Bacteria 512581
321 Ga0496124_0081301 3300048927 Bacteria 2664
322 Ga0496124_0186126 3300048927 Bacteria 1593
323 Ga0496125_0000003 3300048928 Bacteria 1189767
324 Ga0496126_0000001 3300048929 Bacteria 1139011
325 Ga0496126_0000220 3300048929 Bacteria 124547
326 Ga0496126_0035022 3300048929 Bacteria 4708
327 Ga0496126_0060597 3300048929 Bacteria 3402
328 Ga0496126_0132094 3300048929 Bacteria 2157
329 Ga0501032_0075781 3300049569 Bacteria 2240
330 Ga0501033_0013625 3300049570 Bacteria 6189
331 Ga0501034_0004099 3300049571 Bacteria 16355
332 Ga0501034_0075803 3300049571 Bacteria 3370
333 Ga0501034_0128141 3300049571 Bacteria 2522
334 Ga0501034_0335112 3300049571 Bacteria 1444
335 Ga0501036_0008446 3300049572 Bacteria 8437
336 Ga0501037_0000219 3300049573 Bacteria 49904
337 Ga0501037_0008732 3300049573 Bacteria 7427
338 Ga0501038_0007713 3300049574 Bacteria 9922
339 Ga0501038_0211306 3300049574 Bacteria 1552
340 Ga0501039_0000675 3300049575 Bacteria 24622
341 Ga0501041_0157403 3300049577 Bacteria 1420
342 Ga0501043_0001226 3300049579 Bacteria 22608
343 Ga0501047_0019061 3300049581 Bacteria 6583
344 Ga0501047_0186847 3300049581 Bacteria 1937
345 Ga0501048_0086228 3300049582 Bacteria 2215
346 Ga0501067_0075470 3300049583 Bacteria 1868
347 Ga0501070_0011129 3300049586 Bacteria 7594
348 Ga0501070_0159565 3300049586 Bacteria 1859
349 Ga0501071_0240606 3300049587 Bacteria 1365
350 Ga0501073_0011919 3300049589 Bacteria 6347
351 Ga0501077_0034761 3300049593 Bacteria 3208
352 Ga0501035_0000121 3300049822 Bacteria 94497
353 Ga0501044_0001164 3300049823 Bacteria 31166
354 Ga0501044_0214912 3300049823 Bacteria 1876
355 nmdc:mga03683_21994_c1 3300050489 Bacteria 2466
356 nmdc:mga03n38_10908_c1 3300050490 Bacteria 3366
357 nmdc:mga03n38_49999_c1 3300050490 Bacteria 1861
358 nmdc:mga03n38_5397_c1 3300050490 Bacteria 4348
359 nmdc:mga03n38_7338_c1 3300050490 Bacteria 3897
360 nmdc:mga00v17_100571_c1 3300050491 Bacteria 1824
361 nmdc:mga00v17_129765_c1 3300050491 Bacteria 1610
362 nmdc:mga00v17_681_c1 3300050491 Bacteria 18678
363 nmdc:mga0yw44_109600_c1 3300050492 Bacteria 1768
364 nmdc:mga0yw44_1870_c1 3300050492 Bacteria 8653
365 nmdc:mga0yw44_202922_c1 3300050492 Bacteria 1310
366 nmdc:mga0yw44_211914_c1 3300050492 Bacteria 1282
367 nmdc:mga0yw44_56427_c1 3300050492 Bacteria 2393
368 nmdc:mga0yw44_68895_c1 3300050492 Bacteria 2190
369 nmdc:mga0yw44_712_c1 3300050492 Bacteria 12202
370 nmdc:mga06z11_3046_c1 3300050494 Bacteria 6451
371 nmdc:mga06z11_59929_c1 3300050494 Bacteria 1980
372 nmdc:mga04h51_25087_c1 3300050495 Bacteria 1832
373 nmdc:mga07m45_11216_c1 3300050496 Bacteria 4704
374 nmdc:mga07m45_12284_c1 3300050496 Bacteria 3510
375 nmdc:mga07m45_1669_c1 3300050496 Bacteria 10210
376 nmdc:mga07m45_2345_c1 3300050496 Bacteria 8884
377 nmdc:mga07m45_38736_c1 3300050496 Bacteria 2661
378 nmdc:mga07m45_9863_c1 3300050496 Bacteria 4967
379 nmdc:mga05p37_61841_c1 3300050507 Bacteria 4609
380 nmdc:mga0qj67_4393_c1 3300050509 Bacteria 10208
381 nmdc:mga06r32_23972_c1 3300050510 Bacteria 5655
382 nmdc:mga08y16_177904_c1 3300050511 Bacteria 2209
383 nmdc:mga0sz30_1058_c1 3300050516 Bacteria 9925
384 nmdc:mga0sz30_2612_c2 3300050516 Bacteria 3870
385 nmdc:mga0sz30_58921_c1 3300050516 Bacteria 1638
386 nmdc:mga0sz30_8956_c1 3300050516 Bacteria 3794
387 Ga0495601_0133258 3300053077 Bacteria 1619
388 Ga0500610_0002450 3300053079 Bacteria 6842
389 Ga0500635_0010079 3300053080 Bacteria 2642
390 Ga0500643_001730 3300053087 Bacteria 12096
391 Ga0500644_0000225 3300053088 Bacteria 32583
392 Ga0500641_0006608 3300053096 Bacteria 4116
393 Ga0500554_022128 3300053102 Bacteria 1772
394 Ga0500562_002979 3300053108 Bacteria 4222
395 Ga0500652_000269 3300053131 Bacteria 19409
396 Ga0500616_0011843 3300053153 Bacteria 5129
397 Ga0500616_0017296 3300053153 Bacteria 4093
398 Ga0500627_0009630 3300053158 Bacteria 3487
399 Ga0500645_000081 3300053730 Bacteria 76748
400 Ga0466962_0014394 3300061719 Bacteria 3811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0240606 Ga0501071_0240606_29_1138 331
2 3300050492 nmdc:mga0yw44_211914_c1 nmdc:mga0yw44_211914_c1_224_1261 339
3 3300053080 Ga0500635_0010079 Ga0500635_0010079_1588_2622 344
4 3300048912 Ga0496109_0503884 Ga0496109_0503884_80_1120 346
5 3300048925 Ga0496122_0044212 Ga0496122_0044212_2415_3455 346
6 3300053131 Ga0500652_000269 Ga0500652_000269_10105_11196 363
7 3300044656 Ga0466969_0030772 Ga0466969_0030772_1543_2712 369
8 3300006042 Ga0075368_10001648 Ga0075368_100016485 370
9 3300006178 Ga0075367_10006360 Ga0075367_100063603 370
10 3300050494 nmdc:mga06z11_3046_c1 nmdc:mga06z11_3046_c1_2916_4046 370
11 3300005367 Ga0070667_100086132 Ga0070667_1000861323 371
12 3300049577 Ga0501041_0157403 Ga0501041_0157403_84_1328 374
13 3300005327 Ga0070658_10244745 Ga0070658_102447451 377
14 3300041507 Ga0451851_0058072 Ga0451851_0058072_24_1157 377
15 3300044658 Ga0466972_0001604 Ga0466972_0001604_2237_3463 378
16 3300044683 Ga0466965_0006125 Ga0466965_0006125_1224_2450 378
17 3300044842 Ga0466957_0001665 Ga0466957_0001665_7584_8810 378
18 3300044901 Ga0466960_0005101 Ga0466960_0005101_3723_4949 378
19 3300045976 Ga0466967_0001559 Ga0466967_0001559_6984_8210 378
20 3300049581 Ga0501047_0186847 Ga0501047_0186847_777_1925 382
21 3300006038 Ga0075365_10166503 Ga0075365_101665032 385
22 3300030745 Ga0316182_1302543 Ga0316182_13025432 390
23 3300050489 nmdc:mga03683_21994_c1 nmdc:mga03683_21994_c1_285_1460 391
24 3300026118 Ga0207675_100105729 Ga0207675_1001057293 392
25 3300050516 nmdc:mga0sz30_2612_c2 nmdc:mga0sz30_2612_c2_2556_3734 392
26 3300031251 Ga0265327_10003633 Ga0265327_100036336 393
27 3300048912 Ga0496109_0179906 Ga0496109_0179906_462_1646 394
28 3300045976 Ga0466967_0302386 Ga0466967_0302386_102_1304 400
29 3300049569 Ga0501032_0075781 Ga0501032_0075781_273_1475 400
30 3300049571 Ga0501034_0075803 Ga0501034_0075803_1097_2299 400
31 3300049573 Ga0501037_0008732 Ga0501037_0008732_5864_7066 400
32 3300049586 Ga0501070_0159565 Ga0501070_0159565_64_1266 400
33 3300005843 Ga0068860_100001146 Ga0068860_10000114624 401
34 3300006042 Ga0075368_10002514 Ga0075368_100025142 401
35 3300006048 Ga0075363_100002284 Ga0075363_1000022849 401
36 3300006051 Ga0075364_10049997 Ga0075364_100499974 401
37 3300006178 Ga0075367_10079650 Ga0075367_100796502 401
38 3300006353 Ga0075370_10069302 Ga0075370_100693023 401
39 3300028381 Ga0268264_10000155 Ga0268264_1000015566 401
40 3300042435 Ga0439434_0034274 Ga0439434_0034274_265_1515 401
41 3300048927 Ga0496124_0081301 Ga0496124_0081301_1046_2269 401
42 3300049583 Ga0501067_0075470 Ga0501067_0075470_597_1832 401
43 3300049586 Ga0501070_0011129 Ga0501070_0011129_5826_7061 401
44 3300050490 nmdc:mga03n38_10908_c1 nmdc:mga03n38_10908_c1_155_1378 401
45 3300050491 nmdc:mga00v17_100571_c1 nmdc:mga00v17_100571_c1_336_1559 401
46 3300050492 nmdc:mga0yw44_109600_c1 nmdc:mga0yw44_109600_c1_313_1536 401
47 3300050492 nmdc:mga0yw44_202922_c1 nmdc:mga0yw44_202922_c1_13_1227 401
48 3300050492 nmdc:mga0yw44_68895_c1 nmdc:mga0yw44_68895_c1_888_2132 401
49 3300050494 nmdc:mga06z11_59929_c1 nmdc:mga06z11_59929_c1_623_1846 401
50 3300050495 nmdc:mga04h51_25087_c1 nmdc:mga04h51_25087_c1_263_1507 401
51 3300050496 nmdc:mga07m45_1669_c1 nmdc:mga07m45_1669_c1_5941_7164 401
52 3300050496 nmdc:mga07m45_38736_c1 nmdc:mga07m45_38736_c1_841_2064 401
53 3300053102 Ga0500554_022128 Ga0500554_022128_153_1376 401
54 3300053153 Ga0500616_0017296 Ga0500616_0017296_2462_3778 401
55 iso_pu_bacteria 2643221617 2644099835 401
56 iso_pu_bacteria 2643221620 2644117441 401
57 iso_pu_bacteria 2643221692 2644517705 401
58 iso_pu_bacteria 2738541305 2738870816 401
59 3300028794 Ga0307515_10233706 Ga0307515_102337062 402
60 3300044901 Ga0466960_0038928 Ga0466960_0038928_38_1270 402
61 iso_pu_bacteria 2643221576 2643891938 402
62 iso_pu_bacteria 2643221590 2643960990 402
63 iso_pu_bacteria 2891968417 2891970865 402
64 iso_pu_bacteria 2842134933 2842140362 403
65 iso_pu_bacteria 2902810491 2902814487 403
66 iso_pu_bacteria 2919713450 2919718162 403
67 3300005339 Ga0070660_100068377 Ga0070660_1000683772 404
68 3300005366 Ga0070659_100031380 Ga0070659_1000313801 404
69 3300010375 Ga0105239_10021969 Ga0105239_100219691 404
70 3300025919 Ga0207657_10038513 Ga0207657_100385133 404
71 3300025932 Ga0207690_10115053 Ga0207690_101150531 404
72 iso_pu_bacteria 2643221604 2644031858 404
73 iso_pu_bacteria 2643221687 2644491295 404
74 iso_pu_bacteria 2643221715 2644636429 404
75 iso_pu_bacteria 2738541264 2738667375 404
76 iso_pu_bacteria 2738541356 2739146218 404
77 iso_pu_bacteria 2773857762 2774392528 404
78 iso_pu_bacteria 2808606439 2809196310 404
79 iso_pu_bacteria 2811994874 2812334678 404
80 iso_pu_bacteria 2902792274 2902797170 404
81 iso_pu_bacteria 2902837492 2902839204 404
82 iso_pu_bacteria 2929212328 2929217926 404
83 iso_pu_bacteria 2939582691 2939585152 404
84 3300003203 JGI25406J46586_10003123 JGI25406J46586_100031233 405
85 3300005455 Ga0070663_100000704 Ga0070663_10000070415 405
86 3300005455 Ga0070663_100148240 Ga0070663_1001482401 405
87 3300005457 Ga0070662_100211549 Ga0070662_1002115491 405
88 3300005985 Ga0081539_10000179 Ga0081539_1000017993 405
89 3300025919 Ga0207657_10203210 Ga0207657_102032101 405
90 3300025933 Ga0207706_10271169 Ga0207706_102711692 405
91 3300026067 Ga0207678_10000040 Ga0207678_1000004051 405
92 3300044656 Ga0466969_0027213 Ga0466969_0027213_1333_2589 405
93 3300044658 Ga0466972_0073656 Ga0466972_0073656_42_1259 405
94 3300048911 Ga0496108_0085038 Ga0496108_0085038_707_1924 405
95 3300049581 Ga0501047_0019061 Ga0501047_0019061_798_2054 405
96 3300005985 Ga0081539_10011084 Ga0081539_100110847 406
97 3300025935 Ga0207709_10001414 Ga0207709_100014144 406
98 3300031901 Ga0307406_10160907 Ga0307406_101609072 406
99 3300031995 Ga0307409_100170337 Ga0307409_1001703372 406
100 3300032002 Ga0307416_100114185 Ga0307416_1001141852 406
101 3300037418 Ga0395900_0066417 Ga0395900_0066417_543_1793 406
102 3300045976 Ga0466967_0091826 Ga0466967_0091826_418_1683 406
103 3300049574 Ga0501038_0211306 Ga0501038_0211306_241_1491 406
104 3300049593 Ga0501077_0034761 Ga0501077_0034761_1468_2718 406
105 3300049823 Ga0501044_0214912 Ga0501044_0214912_551_1792 406
106 3300050492 nmdc:mga0yw44_1870_c1 nmdc:mga0yw44_1870_c1_5916_7136 406
107 3300053088 Ga0500644_0000225 Ga0500644_0000225_29912_31138 406
108 3300053096 Ga0500641_0006608 Ga0500641_0006608_809_2059 406
109 iso_pu_bacteria 2547132424 2548692609 406
110 iso_pu_bacteria 2551306166 2552105436 406
111 iso_pu_bacteria 2738543011 2739238844 406
112 iso_pu_bacteria 2811994878 2812351528 406
113 iso_pu_bacteria 2889300758 2889301119 406
114 iso_pu_bacteria 2939743619 2939744637 406
115 3300003320 rootH2_10112827 rootH2_101128272 407
116 3300005436 Ga0070713_100021366 Ga0070713_1000213663 407
117 3300028794 Ga0307515_10103134 Ga0307515_101031342 407
118 3300031251 Ga0265327_10000128 Ga0265327_1000012888 407
119 3300031251 Ga0265327_10010613 Ga0265327_100106134 407
120 3300044694 Ga0466963_0007795 Ga0466963_0007795_4955_6184 407
121 3300046460 Ga0495638_0002686 Ga0495638_0002686_2640_3863 407
122 3300048904 Ga0496101_0019771 Ga0496101_0019771_1617_2849 407
123 3300048908 Ga0496105_0138783 Ga0496105_0138783_751_1983 407
124 3300049570 Ga0501033_0013625 Ga0501033_0013625_1156_2382 407
125 3300049571 Ga0501034_0128141 Ga0501034_0128141_690_1916 407
126 3300049582 Ga0501048_0086228 Ga0501048_0086228_89_1315 407
127 3300049822 Ga0501035_0000121 Ga0501035_0000121_16127_17353 407
128 3300049823 Ga0501044_0001164 Ga0501044_0001164_13971_15197 407
129 3300053079 Ga0500610_0002450 Ga0500610_0002450_2394_3617 407
130 iso_pu_bacteria 2738541274 2738702404 407
131 iso_pu_bacteria 2738543028 2739331660 407
132 iso_pu_bacteria 2902799365 2902802678 407
133 3300002077 JGI24744J21845_10001423 JGI24744J21845_100014233 408
134 3300003792 Ga0055540_1000071 Ga0055540_100007194 408
135 3300003792 Ga0055540_1001342 Ga0055540_100134214 408
136 3300003792 Ga0055540_1001578 Ga0055540_100157813 408
137 3300003792 Ga0055540_1004351 Ga0055540_10043512 408
138 3300005334 Ga0068869_100036778 Ga0068869_1000367784 408
139 3300005335 Ga0070666_10199948 Ga0070666_101999481 408
140 3300005337 Ga0070682_100063274 Ga0070682_1000632743 408
141 3300005338 Ga0068868_100002325 Ga0068868_1000023258 408
142 3300005340 Ga0070689_100015199 Ga0070689_1000151996 408
143 3300005341 Ga0070691_10002630 Ga0070691_100026306 408
144 3300005347 Ga0070668_100002986 Ga0070668_10000298614 408
145 3300005347 Ga0070668_100071836 Ga0070668_1000718362 408
146 3300005353 Ga0070669_100092505 Ga0070669_1000925053 408
147 3300005354 Ga0070675_100209900 Ga0070675_1002099002 408
148 3300005355 Ga0070671_100089733 Ga0070671_1000897332 408
149 3300005356 Ga0070674_100026782 Ga0070674_1000267822 408
150 3300005367 Ga0070667_100000535 Ga0070667_10000053535 408
151 3300005367 Ga0070667_100001027 Ga0070667_1000010274 408
152 3300005367 Ga0070667_100054721 Ga0070667_1000547213 408
153 3300005367 Ga0070667_100118603 Ga0070667_1001186032 408
154 3300005434 Ga0070709_10046866 Ga0070709_100468662 408
155 3300005434 Ga0070709_10059305 Ga0070709_100593053 408
156 3300005437 Ga0070710_10000927 Ga0070710_100009275 408
157 3300005439 Ga0070711_100015074 Ga0070711_1000150743 408
158 3300005441 Ga0070700_100051139 Ga0070700_1000511392 408
159 3300005441 Ga0070700_100112993 Ga0070700_1001129932 408
160 3300005456 Ga0070678_100001013 Ga0070678_1000010135 408
161 3300005457 Ga0070662_100006531 Ga0070662_1000065316 408
162 3300005459 Ga0068867_100007500 Ga0068867_1000075006 408
163 3300005459 Ga0068867_100148462 Ga0068867_1001484622 408
164 3300005466 Ga0070685_10079528 Ga0070685_100795282 408
165 3300005539 Ga0068853_100009857 Ga0068853_1000098578 408
166 3300005545 Ga0070695_100005991 Ga0070695_1000059919 408
167 3300005546 Ga0070696_100005238 Ga0070696_10000523811 408
168 3300005546 Ga0070696_100122748 Ga0070696_1001227482 408
169 3300005547 Ga0070693_100008642 Ga0070693_1000086424 408
170 3300005548 Ga0070665_100028522 Ga0070665_1000285224 408
171 3300005548 Ga0070665_100171453 Ga0070665_1001714533 408
172 3300005549 Ga0070704_100001452 Ga0070704_10000145211 408
173 3300005549 Ga0070704_100030194 Ga0070704_1000301942 408
174 3300005578 Ga0068854_100001661 Ga0068854_10000166113 408
175 3300005615 Ga0070702_100014355 Ga0070702_1000143552 408
176 3300005615 Ga0070702_100144517 Ga0070702_1001445172 408
177 3300005616 Ga0068852_100061210 Ga0068852_1000612102 408
178 3300005617 Ga0068859_100001593 Ga0068859_10000159314 408
179 3300005718 Ga0068866_10001603 Ga0068866_1000160311 408
180 3300005719 Ga0068861_100001508 Ga0068861_10000150814 408
181 3300005719 Ga0068861_100061979 Ga0068861_1000619793 408
182 3300005841 Ga0068863_100000143 Ga0068863_10000014348 408
183 3300005841 Ga0068863_100000277 Ga0068863_1000002772 408
184 3300005841 Ga0068863_100192986 Ga0068863_1001929862 408
185 3300005842 Ga0068858_100012625 Ga0068858_1000126254 408
186 3300005843 Ga0068860_100000079 Ga0068860_100000079114 408
187 3300005843 Ga0068860_100005332 Ga0068860_1000053324 408
188 3300005843 Ga0068860_100238763 Ga0068860_1002387632 408
189 3300005844 Ga0068862_100000093 Ga0068862_10000009336 408
190 3300005844 Ga0068862_100011543 Ga0068862_1000115435 408
191 3300005844 Ga0068862_100094213 Ga0068862_1000942132 408
192 3300006038 Ga0075365_10013898 Ga0075365_100138982 408
193 3300006048 Ga0075363_100025014 Ga0075363_1000250141 408
194 3300006048 Ga0075363_100028565 Ga0075363_1000285652 408
195 3300006051 Ga0075364_10000725 Ga0075364_1000072513 408
196 3300006051 Ga0075364_10011587 Ga0075364_100115875 408
197 3300006051 Ga0075364_10159556 Ga0075364_101595562 408
198 3300006163 Ga0070715_10002248 Ga0070715_100022483 408
199 3300006173 Ga0070716_100006071 Ga0070716_1000060715 408
200 3300006173 Ga0070716_100092522 Ga0070716_1000925222 408
201 3300006175 Ga0070712_100010377 Ga0070712_1000103773 408
202 3300006175 Ga0070712_100010496 Ga0070712_1000104964 408
203 3300006178 Ga0075367_10094330 Ga0075367_100943302 408
204 3300006186 Ga0075369_10000029 Ga0075369_1000002917 408
205 3300006186 Ga0075369_10010956 Ga0075369_100109564 408
206 3300006186 Ga0075369_10026993 Ga0075369_100269933 408
207 3300006186 Ga0075369_10034713 Ga0075369_100347132 408
208 3300006186 Ga0075369_10053328 Ga0075369_100533283 408
209 3300006186 Ga0075369_10053460 Ga0075369_100534602 408
210 3300006237 Ga0097621_100050898 Ga0097621_1000508983 408
211 3300006353 Ga0075370_10000916 Ga0075370_100009167 408
212 3300006353 Ga0075370_10023872 Ga0075370_100238723 408
213 3300006353 Ga0075370_10032893 Ga0075370_100328933 408
214 3300006844 Ga0075428_100007875 Ga0075428_10000787512 408
215 3300006846 Ga0075430_100012559 Ga0075430_1000125595 408
216 3300006847 Ga0075431_100021357 Ga0075431_1000213577 408
217 3300006881 Ga0068865_100015012 Ga0068865_1000150126 408
218 3300006931 Ga0097620_100001593 Ga0097620_10000159312 408
219 3300009094 Ga0111539_10218356 Ga0111539_102183563 408
220 3300009098 Ga0105245_10008472 Ga0105245_100084723 408
221 3300009101 Ga0105247_10000044 Ga0105247_1000004416 408
222 3300009101 Ga0105247_10002130 Ga0105247_1000213013 408
223 3300009101 Ga0105247_10053896 Ga0105247_100538964 408
224 3300009147 Ga0114129_10067451 Ga0114129_100674513 408
225 3300009148 Ga0105243_10006087 Ga0105243_100060875 408
226 3300009174 Ga0105241_10024816 Ga0105241_100248164 408
227 3300009176 Ga0105242_10002099 Ga0105242_1000209911 408
228 3300009177 Ga0105248_10000641 Ga0105248_1000064137 408
229 3300009177 Ga0105248_10036479 Ga0105248_100364795 408
230 3300009177 Ga0105248_10042639 Ga0105248_100426394 408
231 3300009545 Ga0105237_10004965 Ga0105237_100049656 408
232 3300009545 Ga0105237_10049265 Ga0105237_100492653 408
233 3300009553 Ga0105249_10000049 Ga0105249_10000049113 408
234 3300009553 Ga0105249_10006471 Ga0105249_100064713 408
235 3300010375 Ga0105239_10003558 Ga0105239_100035586 408
236 3300010375 Ga0105239_10032417 Ga0105239_100324174 408
237 3300010375 Ga0105239_10093469 Ga0105239_100934693 408
238 3300013296 Ga0157374_10030722 Ga0157374_100307225 408
239 3300013297 Ga0157378_10006985 Ga0157378_100069859 408
240 3300013306 Ga0163162_10020042 Ga0163162_100200424 408
241 3300013306 Ga0163162_10020332 Ga0163162_100203322 408
242 3300013307 Ga0157372_10031294 Ga0157372_100312944 408
243 3300013308 Ga0157375_10006104 Ga0157375_100061046 408
244 3300013308 Ga0157375_10090069 Ga0157375_100900691 408
245 3300014325 Ga0163163_10287558 Ga0163163_102875582 408
246 3300014326 Ga0157380_10003346 Ga0157380_100033463 408
247 3300014326 Ga0157380_10156621 Ga0157380_101566212 408
248 3300014968 Ga0157379_10141225 Ga0157379_101412253 408
249 3300014969 Ga0157376_10036171 Ga0157376_100361714 408
250 3300017792 Ga0163161_10001520 Ga0163161_100015209 408
251 3300025303 Ga0209051_1000033 Ga0209051_1000033327 408
252 3300025303 Ga0209051_1000776 Ga0209051_100077618 408
253 3300025303 Ga0209051_1002729 Ga0209051_10027292 408
254 3300025303 Ga0209051_1005787 Ga0209051_10057875 408
255 3300025898 Ga0207692_10039680 Ga0207692_100396803 408
256 3300025900 Ga0207710_10000066 Ga0207710_10000066114 408
257 3300025901 Ga0207688_10001970 Ga0207688_100019709 408
258 3300025901 Ga0207688_10003152 Ga0207688_100031526 408
259 3300025904 Ga0207647_10009472 Ga0207647_100094725 408
260 3300025911 Ga0207654_10109952 Ga0207654_101099522 408
261 3300025914 Ga0207671_10012965 Ga0207671_100129652 408
262 3300025914 Ga0207671_10049217 Ga0207671_100492173 408
263 3300025915 Ga0207693_10000197 Ga0207693_1000019712 408
264 3300025915 Ga0207693_10002311 Ga0207693_1000231112 408
265 3300025919 Ga0207657_10051362 Ga0207657_100513622 408
266 3300025923 Ga0207681_10016969 Ga0207681_100169693 408
267 3300025926 Ga0207659_10198284 Ga0207659_101982842 408
268 3300025927 Ga0207687_10008880 Ga0207687_100088804 408
269 3300025927 Ga0207687_10084242 Ga0207687_100842422 408
270 3300025931 Ga0207644_10061739 Ga0207644_100617392 408
271 3300025933 Ga0207706_10002775 Ga0207706_1000277513 408
272 3300025934 Ga0207686_10034402 Ga0207686_100344023 408
273 3300025935 Ga0207709_10037832 Ga0207709_100378323 408
274 3300025936 Ga0207670_10013985 Ga0207670_100139855 408
275 3300025937 Ga0207669_10044479 Ga0207669_100444791 408
276 3300025938 Ga0207704_10068503 Ga0207704_100685032 408
277 3300025939 Ga0207665_10059714 Ga0207665_100597142 408
278 3300025940 Ga0207691_10159805 Ga0207691_101598052 408
279 3300025941 Ga0207711_10000058 Ga0207711_1000005810 408
280 3300025942 Ga0207689_10005569 Ga0207689_100055695 408
281 3300025942 Ga0207689_10016496 Ga0207689_100164966 408
282 3300025961 Ga0207712_10000038 Ga0207712_10000038127 408
283 3300025961 Ga0207712_10139280 Ga0207712_101392802 408
284 3300025972 Ga0207668_10010715 Ga0207668_100107153 408
285 3300025972 Ga0207668_10113083 Ga0207668_101130832 408
286 3300025981 Ga0207640_10005779 Ga0207640_100057795 408
287 3300025986 Ga0207658_10004152 Ga0207658_100041527 408
288 3300025986 Ga0207658_10009345 Ga0207658_100093452 408
289 3300025986 Ga0207658_10323076 Ga0207658_103230762 408
290 3300026023 Ga0207677_10155887 Ga0207677_101558871 408
291 3300026041 Ga0207639_10093536 Ga0207639_100935362 408
292 3300026067 Ga0207678_10026326 Ga0207678_100263265 408
293 3300026075 Ga0207708_10003700 Ga0207708_1000370012 408
294 3300026075 Ga0207708_10011368 Ga0207708_100113686 408
295 3300026088 Ga0207641_10000232 Ga0207641_1000023235 408
296 3300026088 Ga0207641_10026891 Ga0207641_100268913 408
297 3300026089 Ga0207648_10001194 Ga0207648_100011945 408
298 3300026089 Ga0207648_10032137 Ga0207648_100321372 408
299 3300026118 Ga0207675_100003156 Ga0207675_10000315613 408
300 3300026118 Ga0207675_100037624 Ga0207675_1000376243 408
301 3300026121 Ga0207683_10003067 Ga0207683_100030675 408
302 3300026142 Ga0207698_10119794 Ga0207698_101197942 408
303 3300027907 Ga0207428_10162449 Ga0207428_101624492 408
304 3300028379 Ga0268266_10024036 Ga0268266_100240365 408
305 3300028379 Ga0268266_10046953 Ga0268266_100469532 408
306 3300028380 Ga0268265_10000053 Ga0268265_1000005336 408
307 3300028380 Ga0268265_10064147 Ga0268265_100641473 408
308 3300028380 Ga0268265_10078959 Ga0268265_100789592 408
309 3300028381 Ga0268264_10000017 Ga0268264_10000017112 408
310 3300031731 Ga0307405_10019352 Ga0307405_100193524 408
311 3300031852 Ga0307410_10012128 Ga0307410_100121286 408
312 3300031995 Ga0307409_100004501 Ga0307409_1000045019 408
313 3300031995 Ga0307409_100027438 Ga0307409_1000274383 408
314 3300032002 Ga0307416_100007223 Ga0307416_1000072238 408
315 3300032004 Ga0307414_10153466 Ga0307414_101534662 408
316 3300032126 Ga0307415_100001675 Ga0307415_10000167511 408
317 3300041413 Ga0439465_0000749 Ga0439465_0000749_3603_4829 408
318 3300041413 Ga0439465_0003963 Ga0439465_0003963_214_1440 408
319 3300041452 Ga0451793_1237962 Ga0451793_1237962_291_1517 408
320 3300042004 Ga0439445_0004457 Ga0439445_0004457_378_1604 408
321 3300042005 Ga0439448_0003211 Ga0439448_0003211_2948_4174 408
322 3300044658 Ga0466972_0004673 Ga0466972_0004673_5243_6469 408
323 3300044683 Ga0466965_0052693 Ga0466965_0052693_301_1527 408
324 3300044684 Ga0466966_0009663 Ga0466966_0009663_3050_4276 408
325 3300044693 Ga0466961_0020083 Ga0466961_0020083_2237_3463 408
326 3300044719 Ga0466971_0056385 Ga0466971_0056385_111_1337 408
327 3300044765 Ga0466970_0075175 Ga0466970_0075175_448_1674 408
328 3300045976 Ga0466967_0096953 Ga0466967_0096953_957_2183 408
329 3300045976 Ga0466967_0149467 Ga0466967_0149467_793_2019 408
330 3300046460 Ga0495638_0004575 Ga0495638_0004575_6624_7859 408
331 3300046473 Ga0495582_0113308 Ga0495582_0113308_61_1287 408
332 3300046524 Ga0495648_0002131 Ga0495648_0002131_14873_16099 408
333 3300047320 Ga0495672_0004722 Ga0495672_0004722_7129_8355 408
334 3300047320 Ga0495672_0018408 Ga0495672_0018408_2203_3438 408
335 3300047321 Ga0495676_0058378 Ga0495676_0058378_1219_2445 408
336 3300047469 Ga0495673_0002114 Ga0495673_0002114_9236_10462 408
337 3300048091 Ga0495626_0030021 Ga0495626_0030021_949_2175 408
338 3300048903 Ga0496100_0000029 Ga0496100_0000029_89044_90270 408
339 3300048903 Ga0496100_0034281 Ga0496100_0034281_445_1671 408
340 3300048903 Ga0496100_0077693 Ga0496100_0077693_562_1788 408
341 3300048903 Ga0496100_0184545 Ga0496100_0184545_269_1495 408
342 3300048904 Ga0496101_0000015 Ga0496101_0000015_44428_45654 408
343 3300048904 Ga0496101_0000031 Ga0496101_0000031_19779_21005 408
344 3300048905 Ga0496102_0000065 Ga0496102_0000065_66368_67594 408
345 3300048905 Ga0496102_0000559 Ga0496102_0000559_33480_34706 408
346 3300048905 Ga0496102_0004254 Ga0496102_0004254_7068_8294 408
347 3300048905 Ga0496102_0050553 Ga0496102_0050553_234_1460 408
348 3300048906 Ga0496103_0000048 Ga0496103_0000048_65909_67135 408
349 3300048906 Ga0496103_0001418 Ga0496103_0001418_8399_9625 408
350 3300048906 Ga0496103_0013949 Ga0496103_0013949_2575_3801 408
351 3300048906 Ga0496103_0034139 Ga0496103_0034139_1785_3011 408
352 3300048906 Ga0496103_0131756 Ga0496103_0131756_309_1535 408
353 3300048907 Ga0496104_0121012 Ga0496104_0121012_258_1484 408
354 3300048908 Ga0496105_0090729 Ga0496105_0090729_874_2100 408
355 3300048909 Ga0496106_0000396 Ga0496106_0000396_15992_17218 408
356 3300048909 Ga0496106_0011084 Ga0496106_0011084_2181_3407 408
357 3300048910 Ga0496107_0000330 Ga0496107_0000330_20968_22194 408
358 3300048910 Ga0496107_0011248 Ga0496107_0011248_3952_5178 408
359 3300048911 Ga0496108_0010614 Ga0496108_0010614_5630_6856 408
360 3300048911 Ga0496108_0052762 Ga0496108_0052762_423_1649 408
361 3300048912 Ga0496109_0000134 Ga0496109_0000134_2205_3431 408
362 3300048912 Ga0496109_0020199 Ga0496109_0020199_1017_2243 408
363 3300048912 Ga0496109_0026118 Ga0496109_0026118_3456_4682 408
364 3300048913 Ga0496110_0003464 Ga0496110_0003464_328_1554 408
365 3300048913 Ga0496110_0092103 Ga0496110_0092103_500_1726 408
366 3300048914 Ga0496111_0049081 Ga0496111_0049081_1368_2594 408
367 3300048915 Ga0496112_0036807 Ga0496112_0036807_2108_3334 408
368 3300048915 Ga0496112_0218960 Ga0496112_0218960_392_1618 408
369 3300048917 Ga0496114_0000716 Ga0496114_0000716_21317_22543 408
370 3300048917 Ga0496114_0002600 Ga0496114_0002600_683_1909 408
371 3300048917 Ga0496114_0020921 Ga0496114_0020921_2768_3994 408
372 3300048917 Ga0496114_0211728 Ga0496114_0211728_159_1385 408
373 3300048918 Ga0496115_0003676 Ga0496115_0003676_1676_2902 408
374 3300048919 Ga0496116_0000125 Ga0496116_0000125_93777_95003 408
375 3300048919 Ga0496116_0033785 Ga0496116_0033785_1860_3086 408
376 3300048920 Ga0496117_0000111 Ga0496117_0000111_93777_95003 408
377 3300048920 Ga0496117_0001352 Ga0496117_0001352_19963_21189 408
378 3300048921 Ga0496118_0000083 Ga0496118_0000083_93777_95003 408
379 3300048921 Ga0496118_0003684 Ga0496118_0003684_851_2077 408
380 3300048921 Ga0496118_0009678 Ga0496118_0009678_5805_7031 408
381 3300048922 Ga0496119_0004014 Ga0496119_0004014_3621_4847 408
382 3300048922 Ga0496119_0016106 Ga0496119_0016106_1029_2255 408
383 3300048922 Ga0496119_0026863 Ga0496119_0026863_1282_2508 408
384 3300048923 Ga0496120_0001769 Ga0496120_0001769_16091_17317 408
385 3300048923 Ga0496120_0030132 Ga0496120_0030132_179_1405 408
386 3300048924 Ga0496121_0000004 Ga0496121_0000004_579558_580784 408
387 3300048924 Ga0496121_0001000 Ga0496121_0001000_47345_48571 408
388 3300048924 Ga0496121_0009728 Ga0496121_0009728_3163_4389 408
389 3300048925 Ga0496122_0000138 Ga0496122_0000138_81541_82767 408
390 3300048926 Ga0496123_0007870 Ga0496123_0007870_5086_6312 408
391 3300048927 Ga0496124_0000012 Ga0496124_0000012_304351_305577 408
392 3300048927 Ga0496124_0186126 Ga0496124_0186126_12_1238 408
393 3300048928 Ga0496125_0000003 Ga0496125_0000003_608984_610210 408
394 3300048929 Ga0496126_0000001 Ga0496126_0000001_579558_580784 408
395 3300048929 Ga0496126_0000220 Ga0496126_0000220_23824_25050 408
396 3300048929 Ga0496126_0035022 Ga0496126_0035022_1869_3116 408
397 3300048929 Ga0496126_0060597 Ga0496126_0060597_2145_3371 408
398 3300048929 Ga0496126_0132094 Ga0496126_0132094_184_1410 408
399 3300049571 Ga0501034_0004099 Ga0501034_0004099_17_1243 408
400 3300049571 Ga0501034_0335112 Ga0501034_0335112_119_1345 408
401 3300049572 Ga0501036_0008446 Ga0501036_0008446_7076_8302 408
402 3300049573 Ga0501037_0000219 Ga0501037_0000219_15879_17105 408
403 3300049574 Ga0501038_0007713 Ga0501038_0007713_5613_6839 408
404 3300049575 Ga0501039_0000675 Ga0501039_0000675_12882_14108 408
405 3300049579 Ga0501043_0001226 Ga0501043_0001226_10828_12054 408
406 3300049589 Ga0501073_0011919 Ga0501073_0011919_137_1363 408
407 3300050490 nmdc:mga03n38_49999_c1 nmdc:mga03n38_49999_c1_620_1846 408
408 3300050490 nmdc:mga03n38_5397_c1 nmdc:mga03n38_5397_c1_2294_3520 408
409 3300050490 nmdc:mga03n38_7338_c1 nmdc:mga03n38_7338_c1_2478_3704 408
410 3300050491 nmdc:mga00v17_129765_c1 nmdc:mga00v17_129765_c1_324_1550 408
411 3300050491 nmdc:mga00v17_681_c1 nmdc:mga00v17_681_c1_9754_10980 408
412 3300050492 nmdc:mga0yw44_56427_c1 nmdc:mga0yw44_56427_c1_851_2077 408
413 3300050492 nmdc:mga0yw44_712_c1 nmdc:mga0yw44_712_c1_8235_9470 408
414 3300050496 nmdc:mga07m45_11216_c1 nmdc:mga07m45_11216_c1_302_1528 408
415 3300050496 nmdc:mga07m45_12284_c1 nmdc:mga07m45_12284_c1_1588_2814 408
416 3300050496 nmdc:mga07m45_2345_c1 nmdc:mga07m45_2345_c1_1503_2729 408
417 3300050496 nmdc:mga07m45_9863_c1 nmdc:mga07m45_9863_c1_1829_3055 408
418 3300050507 nmdc:mga05p37_61841_c1 nmdc:mga05p37_61841_c1_1628_2854 408
419 3300050509 nmdc:mga0qj67_4393_c1 nmdc:mga0qj67_4393_c1_2205_3431 408
420 3300050510 nmdc:mga06r32_23972_c1 nmdc:mga06r32_23972_c1_2070_3296 408
421 3300050511 nmdc:mga08y16_177904_c1 nmdc:mga08y16_177904_c1_416_1642 408
422 3300050516 nmdc:mga0sz30_1058_c1 nmdc:mga0sz30_1058_c1_7892_9118 408
423 3300050516 nmdc:mga0sz30_58921_c1 nmdc:mga0sz30_58921_c1_248_1483 408
424 3300050516 nmdc:mga0sz30_8956_c1 nmdc:mga0sz30_8956_c1_2150_3376 408
425 3300053077 Ga0495601_0133258 Ga0495601_0133258_196_1422 408
426 3300053087 Ga0500643_001730 Ga0500643_001730_1377_2603 408
427 3300053108 Ga0500562_002979 Ga0500562_002979_2749_3975 408
428 3300053153 Ga0500616_0011843 Ga0500616_0011843_553_1779 408
429 3300053158 Ga0500627_0009630 Ga0500627_0009630_471_1706 408
430 3300053730 Ga0500645_000081 Ga0500645_000081_65507_66754 408
431 3300061719 Ga0466962_0014394 Ga0466962_0014394_2434_3660 408

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bjn-assembly1.cif.gz_A x-ray structure of human tpc6 0.5801 19 174
2bjn-assembly1.cif.gz_A x-ray structure of human tpc6 0.5521 19 174
7e2d-assembly1.cif.gz_C monomer of trappii (closed) 0.5373 32 183
7b70-assembly1.cif.gz_A trappcore plus c8 (355-596) and c11 (1-718) from minitrappiii 0.532 20 181
7vqf-assembly1.cif.gz_A phenol binding protein, mopr 0.5275 20 181
ID Description Score Start End Superfamily
af_Q54TK7_127_281_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.5728 35 175 3.30.1380.20
af_A0A0G2JUE2_1_92_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.5419 355 380 2.60.40.60
af_Q54TK7_127_281_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.5235 35 175 3.30.1380.20
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.5205 230 299 1.20.120.1760
af_P34605_1_180_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.5009 245 381 3.30.1380.20
ID Description Score Start End GO Terms
AF-A0A7G1ILI5-F1-model_v4 Uncharacterized protein 0.9969 1 363
AF-X8FFA7-F1-model_v4 deleted 0.9966 8 408
AF-A0A132TCQ8-F1-model_v4 Uncharacterized protein 0.996 1 362
AF-A0A1V3WR59-F1-model_v4 Uncharacterized protein 0.9941 2 309
AF-X8FFA7-F1-model_v4 deleted 0.9941 8 408

Feature Viewer

pLDDT pTM Quality
94.31 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map