metagRoot

F442421

General Info

Members	Datasets	Scaffolds	Average Seq Length
431	247	429	372

Family's Representative Sequence

Representative Sequence	3300039062\|Ga0400483_035242\|Ga0400483_035242_3538_4776
Length	412
Sequence	LDVECSSVLLHFPFKQPFYTLTPHSISHIFRKLHLKTKGHFMIRVGFVGWRGMVGSVLMERMLAENDFSGYEPLFFTTSQVGQDGPDIGRSIPPLQDAKDLSILKNQDIIVTCQGSGYTKEMYPKLRDAGWEGYWIDAASALRMEDTSVIVLDPVNRNVINDALDKGVKDYVGGNCTVSLMLMAIGGLFQNGYIEWLTSMTYQAASGAGAQNMRELVSQMDAIGNGARAMVDNPATAILDIDRQVLSTMKGPEFPDDNFGVPLAGSVIPWIDTRMPSGQSREEWKGYAETNKILQTPSPIPIDGICVRIGSMRCHSQALTIKLDRDLPLEEIAAIIRNANDWVKVVPNNKEDSLRDLTPTAVTGTLDVPVGRIRKLNMGPEYITLFTVGDQLLWGAAEPIRRMLRILLTRLA

Samples

	Sample ID	Description	Type	Environment
1	2990196909	Pseudomonas mangrovi TC-11	Isolate	Unclassified
2	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
6	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
7	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
8	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
9	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
10	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
11	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
12	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
13	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
14	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
15	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
20	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
21	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
22	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
23	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
24	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
25	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
26	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
27	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
28	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
29	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
30	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
31	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
32	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
33	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
34	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
35	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
36	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
37	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
38	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
39	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
40	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
41	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
42	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
43	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
44	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
45	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
46	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
47	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
48	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
49	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
50	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
51	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
52	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
53	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
54	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
55	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
56	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
59	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
60	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
61	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
62	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
63	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
64	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
65	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
66	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
67	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
68	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
69	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
70	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
105	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
107	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
108	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
109	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
110	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
111	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
112	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
113	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
114	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
115	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
116	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
117	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
118	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
119	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
120	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
121	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
122	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
123	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
124	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
125	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
126	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
127	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
128	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
129	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
130	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
131	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
132	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
133	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
134	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
135	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
136	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
137	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
138	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
139	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
140	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
141	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
142	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
143	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
144	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
145	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
146	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
147	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
148	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
149	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
150	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
151	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
152	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
153	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
154	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
155	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
156	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
157	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
158	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
159	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
160	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
161	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
162	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
163	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
164	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
165	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
166	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
167	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
168	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
169	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
170	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
171	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
172	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
173	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
174	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
175	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
176	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
177	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
178	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
179	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
180	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
181	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
182	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
183	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
184	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
185	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
186	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
187	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
188	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
189	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
190	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
191	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
192	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
193	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
194	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
195	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
196	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
197	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
198	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
199	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
200	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
204	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
205	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
206	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
207	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
212	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
213	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
214	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
215	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
216	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
217	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
218	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
219	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
221	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
223	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
228	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
229	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
230	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
231	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
232	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
233	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
234	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
235	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
236	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
237	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
238	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
239	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
240	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
241	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
242	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
243	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
244	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
245	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
246	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
247	8057160832	Larsenimonas rhizosphaerae GH2-1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.61
Metatranscriptomes	0.93
Isolates	0.46

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.46
Nodule	0
Rhizoplane	1.16
Rhizosphere	96.75
Stem	0
Stem Tuber	0
Unclassified	1.62

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH2_10006072	3300003320	Bacteria	6565
2	Ga0065712_10068246	3300005290	Bacteria	12486
3	Ga0065715_10120194	3300005293	Bacteria	2264
4	Ga0065715_10129737	3300005293	Bacteria	2040
5	Ga0065707_10133812	3300005295	Bacteria	1868
6	Ga0070670_100005617	3300005331	Bacteria	10584
7	Ga0068869_100002894	3300005334	Bacteria	10431
8	Ga0068869_100104233	3300005334	Bacteria	2150
9	Ga0068869_100158333	3300005334	Bacteria	1761
10	Ga0070680_100091927	3300005336	Bacteria	2512
11	Ga0068868_100213483	3300005338	Bacteria	1613
12	Ga0070660_100024901	3300005339	Bacteria	4444
13	Ga0070660_100054346	3300005339	Bacteria	3092
14	Ga0070661_100064918	3300005344	Bacteria	2682
15	Ga0070692_10006751	3300005345	Bacteria	5003
16	Ga0070669_100001314	3300005353	Bacteria	17949
17	Ga0070669_100082908	3300005353	Bacteria	2391
18	Ga0070675_100016050	3300005354	Bacteria	5935
19	Ga0070675_100037409	3300005354	Bacteria	3953
20	Ga0070671_100016453	3300005355	Bacteria	5980
21	Ga0070674_100272329	3300005356	Bacteria	1338
22	Ga0070673_100099108	3300005364	Bacteria	2396
23	Ga0070659_100070708	3300005366	Bacteria	2773
24	Ga0070713_100122349	3300005436	Bacteria	2284
25	Ga0070700_100000221	3300005441	Bacteria	31693
26	Ga0070694_100013749	3300005444	Bacteria	5060
27	Ga0070663_100176479	3300005455	Bacteria	1655
28	Ga0070678_100007178	3300005456	Bacteria	6591
29	Ga0070678_100294453	3300005456	Bacteria	1377
30	Ga0070662_100053657	3300005457	Bacteria	2919
31	Ga0070662_100170537	3300005457	Bacteria	1709
32	Ga0068867_100001201	3300005459	Bacteria	17780
33	Ga0070706_100022447	3300005467	Bacteria	5808
34	Ga0070706_100072556	3300005467	Bacteria	3185
35	Ga0070707_100199185	3300005468	Bacteria	1952
36	Ga0070698_100008781	3300005471	Bacteria	10875
37	Ga0070698_100112275	3300005471	Bacteria	2691
38	Ga0070699_100005918	3300005518	Bacteria	10685
39	Ga0070699_100008878	3300005518	Bacteria	8704
40	Ga0070699_100009968	3300005518	Bacteria	8230
41	Ga0070672_100185991	3300005543	Bacteria	1732
42	Ga0070686_100016639	3300005544	Bacteria	4281
43	Ga0070686_100104009	3300005544	Bacteria	1923
44	Ga0070696_100005433	3300005546	Bacteria	8499
45	Ga0070696_100089235	3300005546	Bacteria	2192
46	Ga0070696_100113661	3300005546	Bacteria	1952
47	Ga0070693_100002818	3300005547	Bacteria	7999
48	Ga0070693_100041287	3300005547	Bacteria	2594
49	Ga0070704_100002610	3300005549	Bacteria	10174
50	Ga0070704_100111891	3300005549	Bacteria	2079
51	Ga0070664_100036359	3300005564	Bacteria	4137
52	Ga0068854_100023556	3300005578	Bacteria	4207
53	Ga0068852_100219731	3300005616	Bacteria	1806
54	Ga0068859_100127849	3300005617	Bacteria	2611
55	Ga0068859_100216091	3300005617	Bacteria	2005
56	Ga0068866_10001227	3300005718	Bacteria	11133
57	Ga0068861_100000142	3300005719	Bacteria	36697
58	Ga0068862_100003980	3300005844	Bacteria	12543
59	Ga0068862_100046930	3300005844	Bacteria	3685
60	Ga0081539_10000178	3300005985	Bacteria	149201
61	Ga0075368_10014605	3300006042	Bacteria	2903
62	Ga0070716_100009221	3300006173	Bacteria	4916
63	Ga0097621_100002990	3300006237	Bacteria	11616
64	Ga0097621_100051308	3300006237	Bacteria	3357
65	Ga0068871_100001696	3300006358	Bacteria	14784
66	Ga0075430_100010647	3300006846	Bacteria	7792
67	Ga0075431_100058963	3300006847	Bacteria	3961
68	Ga0075431_100118920	3300006847	Bacteria	2726
69	Ga0075433_10004102	3300006852	Bacteria	11299
70	Ga0075434_100000784	3300006871	Bacteria	25133
71	Ga0075434_100230858	3300006871	Bacteria	1870
72	Ga0075429_100101732	3300006880	Bacteria	2509
73	Ga0097620_100127855	3300006931	Bacteria	2611
74	Ga0097620_100216091	3300006931	Bacteria	2005
75	Ga0075435_100000429	3300007076	Bacteria	25739
76	Ga0075435_100004718	3300007076	Bacteria	9403
77	Ga0075435_100011300	3300007076	Bacteria	6561
78	Ga0075435_100066131	3300007076	Bacteria	2940
79	Ga0099794_10011616	3300007265	Bacteria	3775
80	Ga0105240_10126977	3300009093	Bacteria	3063
81	Ga0111539_10004725	3300009094	Bacteria	17800
82	Ga0111539_10019636	3300009094	Bacteria	8338
83	Ga0111539_10039390	3300009094	Bacteria	5697
84	Ga0111539_10053525	3300009094	Bacteria	4804
85	Ga0111539_10094991	3300009094	Bacteria	3503
86	Ga0114129_10073210	3300009147	Bacteria	4773
87	Ga0105243_10007217	3300009148	Bacteria	8539
88	Ga0105243_10114428	3300009148	Bacteria	2264
89	Ga0105242_10001474	3300009176	Bacteria	18518
90	Ga0105242_10090278	3300009176	Bacteria	2577
91	Ga0105248_10114465	3300009177	Bacteria	3042
92	Ga0105237_10148095	3300009545	Bacteria	2343
93	Ga0105238_10036590	3300009551	Bacteria	4991
94	Ga0105249_10018029	3300009553	Bacteria	6275
95	Ga0105246_10024318	3300011119	Bacteria	3933
96	Ga0157371_10086380	3300013102	Bacteria	2222
97	Ga0163162_10063718	3300013306	Bacteria	3730
98	Ga0157375_10058985	3300013308	Bacteria	3800
99	Ga0157375_10294378	3300013308	Bacteria	1786
100	Ga0157380_10003254	3300014326	Bacteria	11120
101	Ga0182008_10011146	3300014497	Bacteria	4795
102	Ga0207642_10025693	3300025899	Bacteria	2387
103	Ga0207645_10035816	3300025907	Bacteria	3187
104	Ga0207645_10138241	3300025907	Bacteria	1587
105	Ga0207684_10041255	3300025910	Bacteria	3914
106	Ga0207693_10036959	3300025915	Bacteria	3850
107	Ga0207662_10051285	3300025918	Bacteria	2455
108	Ga0207662_10201293	3300025918	Bacteria	1289
109	Ga0207657_10009257	3300025919	Bacteria	9922
110	Ga0207646_10098311	3300025922	Bacteria	2623
111	Ga0207681_10000523	3300025923	Bacteria	26591
112	Ga0207659_10003815	3300025926	Bacteria	9086
113	Ga0207659_10028943	3300025926	Bacteria	3769
114	Ga0207687_10064921	3300025927	Bacteria	2591
115	Ga0207700_10015586	3300025928	Bacteria	5019
116	Ga0207706_10013632	3300025933	Bacteria	7383
117	Ga0207706_10036417	3300025933	Bacteria	4371
118	Ga0207706_10054351	3300025933	Bacteria	3534
119	Ga0207686_10000911	3300025934	Bacteria	17729
120	Ga0207686_10088427	3300025934	Bacteria	2039
121	Ga0207709_10001456	3300025935	Bacteria	16481
122	Ga0207709_10094307	3300025935	Bacteria	1964
123	Ga0207670_10136386	3300025936	Bacteria	1804
124	Ga0207669_10013877	3300025937	Bacteria	4021
125	Ga0207704_10000910	3300025938	Bacteria	13103
126	Ga0207704_10293605	3300025938	Bacteria	1242
127	Ga0207665_10016489	3300025939	Bacteria	4850
128	Ga0207665_10033934	3300025939	Bacteria	3385
129	Ga0207691_10004771	3300025940	Bacteria	13114
130	Ga0207689_10204140	3300025942	Bacteria	1632
131	Ga0207651_10057675	3300025960	Bacteria	2679
132	Ga0207712_10006125	3300025961	Bacteria	7585
133	Ga0207668_10013743	3300025972	Bacteria	4994
134	Ga0207640_10015799	3300025981	Bacteria	4378
135	Ga0207703_10070491	3300026035	Bacteria	2885
136	Ga0207708_10000324	3300026075	Bacteria	37852
137	Ga0207708_10110756	3300026075	Bacteria	2131
138	Ga0207702_10069716	3300026078	Bacteria	3023
139	Ga0207702_10087610	3300026078	Bacteria	2718
140	Ga0207648_10000680	3300026089	Bacteria	38152
141	Ga0207648_10057635	3300026089	Bacteria	3389
142	Ga0207648_10173333	3300026089	Bacteria	1907
143	Ga0207674_10010529	3300026116	Bacteria	10468
144	Ga0207674_10153729	3300026116	Bacteria	2257
145	Ga0207675_100279145	3300026118	Bacteria	1623
146	Ga0207683_10211285	3300026121	Bacteria	1766
147	Ga0210000_1000944	3300027462	Bacteria	4066
148	Ga0209588_1020498	3300027671	Bacteria	2071
149	Ga0209971_1015435	3300027682	Bacteria	1810
150	Ga0207428_10011687	3300027907	Bacteria	7743
151	Ga0207428_10032582	3300027907	Bacteria	4284
152	Ga0207428_10098727	3300027907	Bacteria	2259
153	Ga0268265_10000691	3300028380	Bacteria	33178
154	Ga0268265_10014612	3300028380	Bacteria	5353
155	Ga0265338_10024819	3300028800	Bacteria	6109
156	Ga0307511_10022197	3300030521	Bacteria	5951
157	Ga0265325_10010523	3300031241	Bacteria	5352
158	Ga0265325_10077398	3300031241	Bacteria	1658
159	Ga0265331_10043938	3300031250	Bacteria	2162
160	Ga0265327_10011526	3300031251	Bacteria	6072
161	Ga0307408_100148039	3300031548	Bacteria	1851
162	Ga0316575_10003117	3300031665	Bacteria	5660
163	Ga0316575_10016768	3300031665	Bacteria	2776
164	Ga0316579_10008210	3300031691	Bacteria	4343
165	Ga0316576_10007932	3300031727	Bacteria	6721
166	Ga0316576_10011968	3300031727	Bacteria	5709
167	Ga0316576_10120887	3300031727	Bacteria	1966
168	Ga0316576_10251864	3300031727	Bacteria	1326
169	Ga0316578_10015765	3300031728	Bacteria	4072
170	Ga0307405_10074939	3300031731	Bacteria	2190
171	Ga0316577_10000133	3300031733	Bacteria	21962
172	Ga0316577_10014241	3300031733	Bacteria	4365
173	Ga0307416_100119596	3300032002	Bacteria	2344
174	Ga0316583_10000416	3300032133	Bacteria	12491
175	Ga0316583_10007677	3300032133	Bacteria	3888
176	Ga0316583_10010466	3300032133	Bacteria	3346
177	Ga0316593_10004478	3300032168	Bacteria	3593
178	Ga0316593_10018127	3300032168	Bacteria	2158
179	Ga0316593_10041218	3300032168	Bacteria	1536
180	Ga0316596_1000646	3300033541	Bacteria	6237
181	Ga0373926_0058553	3300035083	Bacteria	1401
182	Ga0373934_0004134	3300035086	Bacteria	5349
183	Ga0373944_0029087	3300035089	Bacteria	1650
184	Ga0373923_0000364	3300035111	Bacteria	10292
185	Ga0373953_0002878	3300035117	Bacteria	5252
186	Ga0373954_0008376	3300035118	Bacteria	4535
187	Ga0373956_0004044	3300035119	Bacteria	5887
188	Ga0373956_0008747	3300035119	Bacteria	4101
189	Ga0373957_0034573	3300035120	Bacteria	1872
190	Ga0373946_0014973	3300035171	Bacteria	2933
191	Ga0373946_0024871	3300035171	Bacteria	2351
192	Ga0373955_0018074	3300035172	Bacteria	3499
193	Ga0373955_0199322	3300035172	Bacteria	1191
194	Ga0316574_0003177	3300035398	Bacteria	8410
195	Ga0373935_0014761	3300035692	Bacteria	4715
196	Ga0373927_0014228	3300035695	Bacteria	5275
197	Ga0373933_0014539	3300035724	Bacteria	4379
198	Ga0373933_0023963	3300035724	Bacteria	3492
199	Ga0373933_0031919	3300035724	Bacteria	3058
200	Ga0373937_0003868	3300036401	Bacteria	12664
201	Ga0373937_0031795	3300036401	Bacteria	4784
202	Ga0373937_0055168	3300036401	Bacteria	3647
203	Ga0373937_0085405	3300036401	Bacteria	2920
204	Ga0373937_0210035	3300036401	Bacteria	1831
205	Ga0373937_0288920	3300036401	Bacteria	1549
206	Ga0316582_0011200	3300036647	Bacteria	4949
207	Ga0316582_0023431	3300036647	Bacteria	3680
208	Ga0316582_0091213	3300036647	Bacteria	2006
209	Ga0316582_0144705	3300036647	Bacteria	1604
210	Ga0316584_0000202	3300036712	Bacteria	29256
211	Ga0316584_0007804	3300036712	Bacteria	7339
212	Ga0316584_0051542	3300036712	Bacteria	3077
213	Ga0373925_0014304	3300037068	Bacteria	5740
214	Ga0316581_0010679	3300037588	Bacteria	2551
215	Ga0400483_035242	3300039062	Bacteria	5502
216	Ga0400483_052553	3300039062	Bacteria	2040
217	Ga0400489_25171	3300039093	Bacteria	1307
218	Ga0439446_0002505	3300042156	Bacteria	4416
219	Ga0439434_0000318	3300042435	Bacteria	13727
220	Ga0439435_0000030	3300042436	Bacteria	15777
221	Ga0439435_0005802	3300042436	Bacteria	2737
222	Ga0451577_0003282	3300042876	Bacteria	18198
223	Ga0451577_0019982	3300042876	Bacteria	6152
224	Ga0451577_0023997	3300042876	Bacteria	5554
225	Ga0451577_0031083	3300042876	Bacteria	4820
226	Ga0451577_0032688	3300042876	Bacteria	4688
227	Ga0451577_0096655	3300042876	Bacteria	2637
228	Ga0451577_0100195	3300042876	Bacteria	2588
229	Ga0451577_0236009	3300042876	Bacteria	1654
230	Ga0451577_0269176	3300042876	Bacteria	1543
231	Ga0451577_0466113	3300042876	Bacteria	1147
232	Ga0453683_0000068	3300044673	Bacteria	164042
233	Ga0453683_0000121	3300044673	Bacteria	116746
234	Ga0453683_0000138	3300044673	Bacteria	105792
235	Ga0453683_0001770	3300044673	Bacteria	17924
236	Ga0453683_0026449	3300044673	Bacteria	3684
237	Ga0453683_0074548	3300044673	Bacteria	2124
238	Ga0453684_0000954	3300044712	Bacteria	95326
239	Ga0453684_0004694	3300044712	Bacteria	28275
240	Ga0453684_0005168	3300044712	Bacteria	26252
241	Ga0453684_0008095	3300044712	Bacteria	18995
242	Ga0453684_0008234	3300044712	Bacteria	18793
243	Ga0453684_0008607	3300044712	Bacteria	18195
244	Ga0453684_0009367	3300044712	Bacteria	17156
245	Ga0453684_0009380	3300044712	Bacteria	17141
246	Ga0453684_0021707	3300044712	Bacteria	9572
247	Ga0453684_0025096	3300044712	Bacteria	8670
248	Ga0453684_0053422	3300044712	Bacteria	5274
249	Ga0453684_0121546	3300044712	Bacteria	3151
250	Ga0453684_0140652	3300044712	Bacteria	2882
251	Ga0453684_0382503	3300044712	Bacteria	1580
252	Ga0451576_0000839	3300045051	Bacteria	59904
253	Ga0451576_0001455	3300045051	Bacteria	40266
254	Ga0451576_0004758	3300045051	Bacteria	17424
255	Ga0451576_0008879	3300045051	Bacteria	11738
256	Ga0451576_0064376	3300045051	Bacteria	3819
257	Ga0451576_0177465	3300045051	Bacteria	2224
258	Ga0466967_0018751	3300045976	Bacteria	5542
259	Ga0495592_0008089	3300046454	Bacteria	7897
260	Ga0495603_0040699	3300046455	Bacteria	2781
261	Ga0495629_0200756	3300046459	Bacteria	1379
262	Ga0495641_0003419	3300046461	Bacteria	11893
263	Ga0495651_0002367	3300046462	Bacteria	14567
264	Ga0495651_0094224	3300046462	Bacteria	2241
265	Ga0495653_0011578	3300046463	Bacteria	7201
266	Ga0495580_0009276	3300046472	Bacteria	7743
267	Ga0495580_0035253	3300046472	Bacteria	3598
268	Ga0495582_0008048	3300046473	Bacteria	5819
269	Ga0495639_0035170	3300046475	Bacteria	2241
270	Ga0495639_0051999	3300046475	Bacteria	1864
271	Ga0495662_0003158	3300046476	Bacteria	8314
272	Ga0495664_0035768	3300046477	Bacteria	2926
273	Ga0495584_0134722	3300046491	Bacteria	1254
274	Ga0495608_0008197	3300046511	Bacteria	7336
275	Ga0495618_0014417	3300046514	Bacteria	4816
276	Ga0495630_0001696	3300046517	Bacteria	15381
277	Ga0495666_0004093	3300046526	Bacteria	7367
278	Ga0495652_0036258	3300046529	Bacteria	4290
279	Ga0495652_0108527	3300046529	Bacteria	2237
280	Ga0495665_0078251	3300046531	Bacteria	1740
281	Ga0495640_0013772	3300046533	Bacteria	6145
282	Ga0495586_0020917	3300046535	Bacteria	3486
283	Ga0495586_0037297	3300046535	Bacteria	2609
284	Ga0495587_0007279	3300046536	Bacteria	7174
285	Ga0495598_0017808	3300046537	Bacteria	1837
286	Ga0495598_0022822	3300046537	Bacteria	1678
287	Ga0495621_0002478	3300046539	Bacteria	4985
288	Ga0495667_0006341	3300046559	Bacteria	8026
289	Ga0495667_0096135	3300046559	Bacteria	1918
290	Ga0495634_0015282	3300046642	Bacteria	5518
291	Ga0495657_0002998	3300046675	Bacteria	13974
292	Ga0495647_0000579	3300046681	Bacteria	10830
293	Ga0495647_0006235	3300046681	Bacteria	3940
294	Ga0495658_0022356	3300046683	Bacteria	3343
295	Ga0495658_0024873	3300046683	Bacteria	3195
296	Ga0495669_0003438	3300046684	Bacteria	6522
297	Ga0495669_0069750	3300046684	Bacteria	1600
298	Ga0495613_0009944	3300046689	Bacteria	7069
299	Ga0495613_0056790	3300046689	Bacteria	2874
300	Ga0495600_0007539	3300046809	Bacteria	6660
301	Ga0495600_0080668	3300046809	Bacteria	2124
302	Ga0495581_0008903	3300047315	Bacteria	5813
303	Ga0495604_0011861	3300047317	Bacteria	6932
304	Ga0495674_0016800	3300047319	Bacteria	6825
305	Ga0495680_0060438	3300047322	Bacteria	2920
306	Ga0495684_0024837	3300047471	Bacteria	4608
307	Ga0495614_0045106	3300048089	Bacteria	1891
308	Ga0495615_0003451	3300048090	Bacteria	2650
309	Ga0496102_0225682	3300048905	Bacteria	1766
310	Ga0496103_0046596	3300048906	Bacteria	2677
311	Ga0496104_0312890	3300048907	Bacteria	1483
312	Ga0496108_0329154	3300048911	Bacteria	1332
313	Ga0496109_0068740	3300048912	Bacteria	3247
314	Ga0496125_0005039	3300048928	Bacteria	14904
315	Ga0501031_0011697	3300049568	Bacteria	5723
316	Ga0501031_0015905	3300049568	Bacteria	4885
317	Ga0501031_0035280	3300049568	Bacteria	3262
318	Ga0501031_0047486	3300049568	Bacteria	2799
319	Ga0501032_0019127	3300049569	Bacteria	4791
320	Ga0501033_0001039	3300049570	Bacteria	25285
321	Ga0501033_0002048	3300049570	Bacteria	17526
322	Ga0501033_0004798	3300049570	Bacteria	10798
323	Ga0501033_0019009	3300049570	Bacteria	5194
324	Ga0501034_0135495	3300049571	Bacteria	2443
325	Ga0501034_0317009	3300049571	Bacteria	1492
326	Ga0501036_0000101	3300049572	Bacteria	53813
327	Ga0501036_0001533	3300049572	Bacteria	17849
328	Ga0501036_0002719	3300049572	Bacteria	13979
329	Ga0501037_0009039	3300049573	Bacteria	7302
330	Ga0501037_0017516	3300049573	Bacteria	5272
331	Ga0501038_0004165	3300049574	Bacteria	13449
332	Ga0501038_0005798	3300049574	Bacteria	11439
333	Ga0501038_0038076	3300049574	Bacteria	4212
334	Ga0501038_0123434	3300049574	Bacteria	2133
335	Ga0501038_0153192	3300049574	Bacteria	1878
336	Ga0501038_0240904	3300049574	Bacteria	1436
337	Ga0501039_0000117	3300049575	Bacteria	54402
338	Ga0501039_0003988	3300049575	Bacteria	11099
339	Ga0501039_0183048	3300049575	Bacteria	1648
340	Ga0501040_0001575	3300049576	Bacteria	14528
341	Ga0501040_0053395	3300049576	Bacteria	2768
342	Ga0501041_0000040	3300049577	Bacteria	43977
343	Ga0501042_0000026	3300049578	Bacteria	48274
344	Ga0501042_0049205	3300049578	Bacteria	3007
345	Ga0501043_0003181	3300049579	Bacteria	13581
346	Ga0501043_0008119	3300049579	Bacteria	8284
347	Ga0501043_0043418	3300049579	Bacteria	3533
348	Ga0501046_0004663	3300049580	Bacteria	12375
349	Ga0501046_0007305	3300049580	Bacteria	9717
350	Ga0501046_0010695	3300049580	Bacteria	7870
351	Ga0501046_0146157	3300049580	Bacteria	1785
352	Ga0501047_0010563	3300049581	Bacteria	8731
353	Ga0501047_0286714	3300049581	Bacteria	1490
354	Ga0501048_0001267	3300049582	Bacteria	19120
355	Ga0501048_0003867	3300049582	Bacteria	11408
356	Ga0501067_0006547	3300049583	Bacteria	6455
357	Ga0501068_0000246	3300049584	Bacteria	26620
358	Ga0501068_0017968	3300049584	Bacteria	4094
359	Ga0501068_0027286	3300049584	Bacteria	3371
360	Ga0501070_0001668	3300049586	Bacteria	19679
361	Ga0501070_0004954	3300049586	Bacteria	11364
362	Ga0501070_0153632	3300049586	Bacteria	1898
363	Ga0501071_0011883	3300049587	Bacteria	5880
364	Ga0501072_0000528	3300049588	Bacteria	27443
365	Ga0501072_0023023	3300049588	Bacteria	4837
366	Ga0501073_0000328	3300049589	Bacteria	31945
367	Ga0501073_0000741	3300049589	Bacteria	23102
368	Ga0501074_0004886	3300049590	Bacteria	9612
369	Ga0501074_0037840	3300049590	Bacteria	3496
370	Ga0501075_0000036	3300049591	Bacteria	55260
371	Ga0501076_0001556	3300049592	Bacteria	15362
372	Ga0501077_0005681	3300049593	Bacteria	7605
373	Ga0501077_0104220	3300049593	Bacteria	1797
374	Ga0501079_0000807	3300049741	Bacteria	21328
375	Ga0501079_0006073	3300049741	Bacteria	9053
376	Ga0501080_0001508	3300049742	Bacteria	19649
377	Ga0501080_0015116	3300049742	Bacteria	7114
378	Ga0501080_0026338	3300049742	Bacteria	5403
379	Ga0501081_0000074	3300049743	Bacteria	39073
380	Ga0501081_0166059	3300049743	Bacteria	1592
381	Ga0501083_0011951	3300049744	Bacteria	6082
382	Ga0501083_0040297	3300049744	Bacteria	3170
383	Ga0501035_0001691	3300049822	Bacteria	22319
384	Ga0501035_0003534	3300049822	Bacteria	14929
385	Ga0501035_0015579	3300049822	Bacteria	7014
386	Ga0501035_0116071	3300049822	Bacteria	2343
387	Ga0501035_0250079	3300049822	Bacteria	1505
388	Ga0501044_0008317	3300049823	Bacteria	11370
389	Ga0501044_0089194	3300049823	Bacteria	3112
390	Ga0501044_0354728	3300049823	Bacteria	1385
391	Ga0501045_0000438	3300049824	Bacteria	25526
392	Ga0501045_0004188	3300049824	Bacteria	9958
393	Ga0501045_0158087	3300049824	Bacteria	1686
394	nmdc:mga0k408_218941_c1	3300050493	Bacteria	1137
395	nmdc:mga05p37_293615_c1	3300050507	Bacteria	1934
396	nmdc:mga05p37_82549_c1	3300050507	Bacteria	3960
397	nmdc:mga09592_105501_c1	3300050508	Bacteria	2416
398	nmdc:mga09592_157620_c1	3300050508	Bacteria	1960
399	nmdc:mga09592_23595_c1	3300050508	Bacteria	5081
400	nmdc:mga09592_285552_c1	3300050508	Bacteria	1431
401	nmdc:mga0qj67_5829_c1	3300050509	Bacteria	9016
402	nmdc:mga06r32_331911_c1	3300050510	Bacteria	1506
403	nmdc:mga08y16_22563_c1	3300050511	Bacteria	4835
404	nmdc:mga08y16_40554_c1	3300050511	Bacteria	4879
405	nmdc:mga0n895_16516_c1	3300050512	Bacteria	6776
406	nmdc:mga0n895_181584_c1	3300050512	Bacteria	2136
407	nmdc:mga0n895_301341_c1	3300050512	Bacteria	1625
408	nmdc:mga0n895_3499_c1	3300050512	Bacteria	12688
409	nmdc:mga0n895_43823_c1	3300050512	Bacteria	4362
410	nmdc:mga0n895_44804_c1	3300050512	Bacteria	4315
411	nmdc:mga0n895_57510_c1	3300050512	Bacteria	3833
412	nmdc:mga0rr50_2558_c1	3300050513	Bacteria	10305
413	nmdc:mga08x19_233640_c1	3300050514	Bacteria	1266
414	nmdc:mga0a205_965_c1	3300050515	Bacteria	23733
415	Ga0495601_0019455	3300053077	Bacteria	4140
416	Ga0495612_0070998	3300053078	Bacteria	1452
417	Ga0495595_0005823	3300053084	Bacteria	4991
418	Ga0495595_0020718	3300053084	Bacteria	2864
419	Ga0495619_0007201	3300053085	Bacteria	7047
420	Ga0495619_0009522	3300053085	Bacteria	6130
421	Ga0501084_0000883	3300054114	Bacteria	23188
422	Ga0501084_0116492	3300054114	Bacteria	2246
423	Ga0590071_012635	3300059421	Bacteria	1978
424	Ga0590075_000333	3300059424	Bacteria	13147
425	Ga0590077_000187	3300059426	Bacteria	17698
426	Ga0501082_0000619	3300060353	Bacteria	31222
427	Ga0501082_0023994	3300060353	Bacteria	5260
428	Ga0530510_0000117	3300061734	Bacteria	45062
429	Ga0530510_0124356	3300061734	Bacteria	1895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025918	Ga0207662_10201293	Ga0207662_102012931	285
2	3300050493	nmdc:mga0k408_218941_c1	nmdc:mga0k408_218941_c1_117_1103	328
3	3300049568	Ga0501031_0035280	Ga0501031_0035280_2241_3236	330
4	3300044712	Ga0453684_0000954	Ga0453684_0000954_59171_60289	337
5	3300036712	Ga0316584_0007804	Ga0316584_0007804_4808_5857	338
6	3300036647	Ga0316582_0023431	Ga0316582_0023431_2511_3560	339
7	3300036712	Ga0316584_0000202	Ga0316584_0000202_27763_28812	339
8	3300049586	Ga0501070_0004954	Ga0501070_0004954_8298_9380	344
9	3300049590	Ga0501074_0004886	Ga0501074_0004886_7023_8105	344
10	3300042876	Ga0451577_0023997	Ga0451577_0023997_450_1493	346
11	3300042876	Ga0451577_0032688	Ga0451577_0032688_3339_4385	346
12	3300045051	Ga0451576_0177465	Ga0451576_0177465_584_1630	346
13	3300031727	Ga0316576_10007932	Ga0316576_100079324	347
14	3300031728	Ga0316578_10015765	Ga0316578_100157653	348
15	3300031733	Ga0316577_10014241	Ga0316577_100142413	348
16	3300042876	Ga0451577_0466113	Ga0451577_0466113_29_1081	349
17	3300048911	Ga0496108_0329154	Ga0496108_0329154_21_1073	349
18	3300049824	Ga0501045_0158087	Ga0501045_0158087_26_1126	351
19	3300050512	nmdc:mga0n895_301341_c1	nmdc:mga0n895_301341_c1_62_1153	351
20	3300042876	Ga0451577_0003282	Ga0451577_0003282_16376_17494	352
21	3300044673	Ga0453683_0026449	Ga0453683_0026449_1875_2993	352
22	3300044712	Ga0453684_0008095	Ga0453684_0008095_8620_9738	352
23	3300044712	Ga0453684_0008607	Ga0453684_0008607_16376_17494	352
24	3300044712	Ga0453684_0009367	Ga0453684_0009367_7358_8476	352
25	3300045051	Ga0451576_0004758	Ga0451576_0004758_15601_16719	352
26	3300048928	Ga0496125_0005039	Ga0496125_0005039_14_1075	352
27	3300025972	Ga0207668_10013743	Ga0207668_100137433	355
28	3300028800	Ga0265338_10024819	Ga0265338_100248195	355
29	3300031241	Ga0265325_10010523	Ga0265325_100105235	355
30	3300031241	Ga0265325_10077398	Ga0265325_100773982	355
31	3300031251	Ga0265327_10011526	Ga0265327_100115264	355
32	3300042876	Ga0451577_0019982	Ga0451577_0019982_4303_5406	355
33	3300042876	Ga0451577_0096655	Ga0451577_0096655_966_2039	355
34	3300042876	Ga0451577_0100195	Ga0451577_0100195_632_1732	355
35	3300042876	Ga0451577_0236009	Ga0451577_0236009_120_1193	355
36	3300042876	Ga0451577_0269176	Ga0451577_0269176_155_1255	355
37	3300044673	Ga0453683_0000068	Ga0453683_0000068_161494_162594	355
38	3300044673	Ga0453683_0000121	Ga0453683_0000121_8001_9101	355
39	3300044673	Ga0453683_0000138	Ga0453683_0000138_96778_97881	355
40	3300044673	Ga0453683_0001770	Ga0453683_0001770_2488_3558	355
41	3300044673	Ga0453683_0074548	Ga0453683_0074548_1028_2098	355
42	3300044712	Ga0453684_0004694	Ga0453684_0004694_7752_8852	355
43	3300044712	Ga0453684_0005168	Ga0453684_0005168_3942_5012	355
44	3300044712	Ga0453684_0008234	Ga0453684_0008234_3286_4386	355
45	3300044712	Ga0453684_0009380	Ga0453684_0009380_6418_7488	355
46	3300044712	Ga0453684_0021707	Ga0453684_0021707_472_1572	355
47	3300044712	Ga0453684_0025096	Ga0453684_0025096_2853_3956	355
48	3300044712	Ga0453684_0053422	Ga0453684_0053422_625_1734	355
49	3300044712	Ga0453684_0140652	Ga0453684_0140652_1458_2558	355
50	3300044712	Ga0453684_0382503	Ga0453684_0382503_297_1367	355
51	3300045051	Ga0451576_0000839	Ga0451576_0000839_6878_7975	355
52	3300045051	Ga0451576_0001455	Ga0451576_0001455_13743_14813	355
53	3300045051	Ga0451576_0064376	Ga0451576_0064376_1580_2680	355
54	3300006042	Ga0075368_10014605	Ga0075368_100146053	356
55	3300031250	Ga0265331_10043938	Ga0265331_100439382	356
56	3300046455	Ga0495603_0040699	Ga0495603_0040699_503_1609	356
57	3300048090	Ga0495615_0003451	Ga0495615_0003451_350_1453	356
58	3300031548	Ga0307408_100148039	Ga0307408_1001480392	357
59	3300035119	Ga0373956_0004044	Ga0373956_0004044_2065_3174	357
60	3300005293	Ga0065715_10129737	Ga0065715_101297372	358
61	3300005331	Ga0070670_100005617	Ga0070670_1000056171	358
62	3300005334	Ga0068869_100158333	Ga0068869_1001583331	358
63	3300005336	Ga0070680_100091927	Ga0070680_1000919272	358
64	3300005338	Ga0068868_100213483	Ga0068868_1002134831	358
65	3300005339	Ga0070660_100024901	Ga0070660_1000249014	358
66	3300005339	Ga0070660_100054346	Ga0070660_1000543462	358
67	3300005344	Ga0070661_100064918	Ga0070661_1000649183	358
68	3300005355	Ga0070671_100016453	Ga0070671_1000164533	358
69	3300005366	Ga0070659_100070708	Ga0070659_1000707082	358
70	3300005444	Ga0070694_100013749	Ga0070694_1000137492	358
71	3300005455	Ga0070663_100176479	Ga0070663_1001764791	358
72	3300005456	Ga0070678_100007178	Ga0070678_1000071787	358
73	3300005457	Ga0070662_100053657	Ga0070662_1000536572	358
74	3300005457	Ga0070662_100170537	Ga0070662_1001705372	358
75	3300005467	Ga0070706_100022447	Ga0070706_1000224472	358
76	3300005471	Ga0070698_100112275	Ga0070698_1001122753	358
77	3300005518	Ga0070699_100008878	Ga0070699_1000088785	358
78	3300005546	Ga0070696_100089235	Ga0070696_1000892353	358
79	3300005547	Ga0070693_100002818	Ga0070693_1000028181	358
80	3300005547	Ga0070693_100041287	Ga0070693_1000412871	358
81	3300005549	Ga0070704_100111891	Ga0070704_1001118912	358
82	3300005564	Ga0070664_100036359	Ga0070664_1000363591	358
83	3300005578	Ga0068854_100023556	Ga0068854_1000235561	358
84	3300005616	Ga0068852_100219731	Ga0068852_1002197311	358
85	3300005718	Ga0068866_10001227	Ga0068866_100012279	358
86	3300006173	Ga0070716_100009221	Ga0070716_1000092212	358
87	3300007265	Ga0099794_10011616	Ga0099794_100116162	358
88	3300009093	Ga0105240_10126977	Ga0105240_101269773	358
89	3300009148	Ga0105243_10114428	Ga0105243_101144282	358
90	3300009176	Ga0105242_10090278	Ga0105242_100902781	358
91	3300009177	Ga0105248_10114465	Ga0105248_101144652	358
92	3300009545	Ga0105237_10148095	Ga0105237_101480953	358
93	3300009551	Ga0105238_10036590	Ga0105238_100365902	358
94	3300011119	Ga0105246_10024318	Ga0105246_100243184	358
95	3300013102	Ga0157371_10086380	Ga0157371_100863802	358
96	3300013306	Ga0163162_10063718	Ga0163162_100637181	358
97	3300013308	Ga0157375_10058985	Ga0157375_100589852	358
98	3300014497	Ga0182008_10011146	Ga0182008_100111462	358
99	3300025907	Ga0207645_10035816	Ga0207645_100358162	358
100	3300025910	Ga0207684_10041255	Ga0207684_100412553	358
101	3300025915	Ga0207693_10036959	Ga0207693_100369592	358
102	3300025919	Ga0207657_10009257	Ga0207657_100092576	358
103	3300025927	Ga0207687_10064921	Ga0207687_100649211	358
104	3300025933	Ga0207706_10013632	Ga0207706_100136322	358
105	3300025933	Ga0207706_10036417	Ga0207706_100364174	358
106	3300025933	Ga0207706_10054351	Ga0207706_100543513	358
107	3300025934	Ga0207686_10000911	Ga0207686_1000091117	358
108	3300025935	Ga0207709_10094307	Ga0207709_100943073	358
109	3300025939	Ga0207665_10016489	Ga0207665_100164892	358
110	3300025939	Ga0207665_10033934	Ga0207665_100339344	358
111	3300025942	Ga0207689_10204140	Ga0207689_102041402	358
112	3300025981	Ga0207640_10015799	Ga0207640_100157992	358
113	3300026035	Ga0207703_10070491	Ga0207703_100704912	358
114	3300026078	Ga0207702_10069716	Ga0207702_100697162	358
115	3300026078	Ga0207702_10087610	Ga0207702_100876101	358
116	3300026089	Ga0207648_10173333	Ga0207648_101733331	358
117	3300026116	Ga0207674_10010529	Ga0207674_100105298	358
118	3300027671	Ga0209588_1020498	Ga0209588_10204982	358
119	3300031727	Ga0316576_10011968	Ga0316576_100119684	358
120	3300031733	Ga0316577_10000133	Ga0316577_1000013311	358
121	3300032133	Ga0316583_10010466	Ga0316583_100104661	358
122	3300032168	Ga0316593_10004478	Ga0316593_100044782	358
123	3300032168	Ga0316593_10041218	Ga0316593_100412182	358
124	3300033541	Ga0316596_1000646	Ga0316596_10006462	358
125	3300035083	Ga0373926_0058553	Ga0373926_0058553_228_1340	358
126	3300035171	Ga0373946_0014973	Ga0373946_0014973_967_2079	358
127	3300035695	Ga0373927_0014228	Ga0373927_0014228_51_1130	358
128	3300035724	Ga0373933_0014539	Ga0373933_0014539_2948_4027	358
129	3300036401	Ga0373937_0003868	Ga0373937_0003868_11023_12135	358
130	3300036401	Ga0373937_0210035	Ga0373937_0210035_318_1430	358
131	3300036401	Ga0373937_0288920	Ga0373937_0288920_340_1488	358
132	3300036712	Ga0316584_0051542	Ga0316584_0051542_1636_2751	358
133	3300042876	Ga0451577_0031083	Ga0451577_0031083_3353_4480	358
134	3300046462	Ga0495651_0094224	Ga0495651_0094224_960_2072	358
135	3300046472	Ga0495580_0035253	Ga0495580_0035253_183_1295	358
136	3300046475	Ga0495639_0035170	Ga0495639_0035170_1115_2227	358
137	3300046475	Ga0495639_0051999	Ga0495639_0051999_502_1620	358
138	3300046477	Ga0495664_0035768	Ga0495664_0035768_644_1723	358
139	3300046559	Ga0495667_0096135	Ga0495667_0096135_67_1179	358
140	3300046681	Ga0495647_0006235	Ga0495647_0006235_2597_3709	358
141	3300046683	Ga0495658_0022356	Ga0495658_0022356_431_1543	358
142	3300046689	Ga0495613_0056790	Ga0495613_0056790_1006_2118	358
143	3300046809	Ga0495600_0080668	Ga0495600_0080668_241_1353	358
144	3300047315	Ga0495581_0008903	Ga0495581_0008903_2331_3443	358
145	3300047471	Ga0495684_0024837	Ga0495684_0024837_3184_4296	358
146	3300048089	Ga0495614_0045106	Ga0495614_0045106_268_1380	358
147	3300048905	Ga0496102_0225682	Ga0496102_0225682_88_1167	358
148	3300048906	Ga0496103_0046596	Ga0496103_0046596_256_1335	358
149	3300049584	Ga0501068_0000246	Ga0501068_0000246_8375_9454	358
150	3300049589	Ga0501073_0000741	Ga0501073_0000741_10751_11830	358
151	3300053084	Ga0495595_0020718	Ga0495595_0020718_285_1397	358
152	3300053085	Ga0495619_0009522	Ga0495619_0009522_4718_5830	358
153	iso_pu_bacteria	2990196909	2990199893	358
154	3300005290	Ga0065712_10068246	Ga0065712_100682461	359
155	3300005295	Ga0065707_10133812	Ga0065707_101338122	359
156	3300005334	Ga0068869_100002894	Ga0068869_1000028942	359
157	3300005354	Ga0070675_100037409	Ga0070675_1000374092	359
158	3300005364	Ga0070673_100099108	Ga0070673_1000991082	359
159	3300005543	Ga0070672_100185991	Ga0070672_1001859912	359
160	3300005544	Ga0070686_100016639	Ga0070686_1000166392	359
161	3300005546	Ga0070696_100113661	Ga0070696_1001136612	359
162	3300005617	Ga0068859_100127849	Ga0068859_1001278493	359
163	3300005617	Ga0068859_100216091	Ga0068859_1002160912	359
164	3300006846	Ga0075430_100010647	Ga0075430_1000106472	359
165	3300006847	Ga0075431_100058963	Ga0075431_1000589632	359
166	3300006847	Ga0075431_100118920	Ga0075431_1001189202	359
167	3300006852	Ga0075433_10004102	Ga0075433_100041024	359
168	3300006871	Ga0075434_100230858	Ga0075434_1002308582	359
169	3300006880	Ga0075429_100101732	Ga0075429_1001017322	359
170	3300006931	Ga0097620_100127855	Ga0097620_1001278553	359
171	3300006931	Ga0097620_100216091	Ga0097620_1002160912	359
172	3300007076	Ga0075435_100011300	Ga0075435_1000113004	359
173	3300009094	Ga0111539_10019636	Ga0111539_100196362	359
174	3300009094	Ga0111539_10053525	Ga0111539_100535253	359
175	3300025926	Ga0207659_10003815	Ga0207659_100038153	359
176	3300025936	Ga0207670_10136386	Ga0207670_101363861	359
177	3300025940	Ga0207691_10004771	Ga0207691_100047713	359
178	3300025960	Ga0207651_10057675	Ga0207651_100576753	359
179	3300026089	Ga0207648_10057635	Ga0207648_100576352	359
180	3300027907	Ga0207428_10098727	Ga0207428_100987272	359
181	3300031727	Ga0316576_10120887	Ga0316576_101208871	359
182	3300031727	Ga0316576_10251864	Ga0316576_102518642	359
183	3300032168	Ga0316593_10018127	Ga0316593_100181272	359
184	3300036647	Ga0316582_0144705	Ga0316582_0144705_108_1223	359
185	3300042436	Ga0439435_0005802	Ga0439435_0005802_357_1508	359
186	3300046537	Ga0495598_0017808	Ga0495598_0017808_70_1221	359
187	3300048912	Ga0496109_0068740	Ga0496109_0068740_64_1215	359
188	3300050508	nmdc:mga09592_105501_c1	nmdc:mga09592_105501_c1_209_1360	359
189	3300050508	nmdc:mga09592_157620_c1	nmdc:mga09592_157620_c1_59_1210	359
190	3300050508	nmdc:mga09592_23595_c1	nmdc:mga09592_23595_c1_49_1200	359
191	3300050509	nmdc:mga0qj67_5829_c1	nmdc:mga0qj67_5829_c1_817_1968	359
192	3300050510	nmdc:mga06r32_331911_c1	nmdc:mga06r32_331911_c1_192_1313	359
193	3300050511	nmdc:mga08y16_40554_c1	nmdc:mga08y16_40554_c1_351_1502	359
194	3300050512	nmdc:mga0n895_44804_c1	nmdc:mga0n895_44804_c1_2828_3985	359
195	3300050512	nmdc:mga0n895_57510_c1	nmdc:mga0n895_57510_c1_1247_2398	359
196	3300050515	nmdc:mga0a205_965_c1	nmdc:mga0a205_965_c1_4365_5522	359
197	3300003320	rootH2_10006072	rootH2_100060722	360
198	3300005293	Ga0065715_10120194	Ga0065715_101201942	360
199	3300005334	Ga0068869_100104233	Ga0068869_1001042333	360
200	3300005345	Ga0070692_10006751	Ga0070692_100067515	360
201	3300005353	Ga0070669_100001314	Ga0070669_10000131418	360
202	3300005353	Ga0070669_100082908	Ga0070669_1000829082	360
203	3300005354	Ga0070675_100016050	Ga0070675_1000160502	360
204	3300005356	Ga0070674_100272329	Ga0070674_1002723291	360
205	3300005436	Ga0070713_100122349	Ga0070713_1001223493	360
206	3300005441	Ga0070700_100000221	Ga0070700_10000022126	360
207	3300005456	Ga0070678_100294453	Ga0070678_1002944531	360
208	3300005459	Ga0068867_100001201	Ga0068867_1000012017	360
209	3300005467	Ga0070706_100072556	Ga0070706_1000725562	360
210	3300005468	Ga0070707_100199185	Ga0070707_1001991852	360
211	3300005471	Ga0070698_100008781	Ga0070698_10000878113	360
212	3300005518	Ga0070699_100005918	Ga0070699_1000059183	360
213	3300005518	Ga0070699_100009968	Ga0070699_1000099684	360
214	3300005544	Ga0070686_100104009	Ga0070686_1001040092	360
215	3300005546	Ga0070696_100005433	Ga0070696_1000054335	360
216	3300005549	Ga0070704_100002610	Ga0070704_1000026103	360
217	3300005719	Ga0068861_100000142	Ga0068861_1000001425	360
218	3300005844	Ga0068862_100003980	Ga0068862_1000039806	360
219	3300005844	Ga0068862_100046930	Ga0068862_1000469302	360
220	3300005985	Ga0081539_10000178	Ga0081539_1000017896	360
221	3300006237	Ga0097621_100002990	Ga0097621_10000299010	360
222	3300006237	Ga0097621_100051308	Ga0097621_1000513084	360
223	3300006358	Ga0068871_100001696	Ga0068871_1000016962	360
224	3300006871	Ga0075434_100000784	Ga0075434_10000078425	360
225	3300007076	Ga0075435_100000429	Ga0075435_1000004298	360
226	3300007076	Ga0075435_100004718	Ga0075435_1000047187	360
227	3300007076	Ga0075435_100066131	Ga0075435_1000661311	360
228	3300009094	Ga0111539_10004725	Ga0111539_100047255	360
229	3300009094	Ga0111539_10039390	Ga0111539_100393903	360
230	3300009094	Ga0111539_10094991	Ga0111539_100949911	360
231	3300009147	Ga0114129_10073210	Ga0114129_100732102	360
232	3300009148	Ga0105243_10007217	Ga0105243_100072177	360
233	3300009176	Ga0105242_10001474	Ga0105242_1000147416	360
234	3300009553	Ga0105249_10018029	Ga0105249_100180293	360
235	3300013308	Ga0157375_10294378	Ga0157375_102943782	360
236	3300014326	Ga0157380_10003254	Ga0157380_100032544	360
237	3300025899	Ga0207642_10025693	Ga0207642_100256932	360
238	3300025907	Ga0207645_10138241	Ga0207645_101382411	360
239	3300025918	Ga0207662_10051285	Ga0207662_100512852	360
240	3300025922	Ga0207646_10098311	Ga0207646_100983112	360
241	3300025923	Ga0207681_10000523	Ga0207681_1000052316	360
242	3300025926	Ga0207659_10028943	Ga0207659_100289432	360
243	3300025928	Ga0207700_10015586	Ga0207700_100155866	360
244	3300025934	Ga0207686_10088427	Ga0207686_100884272	360
245	3300025935	Ga0207709_10001456	Ga0207709_100014567	360
246	3300025937	Ga0207669_10013877	Ga0207669_100138772	360
247	3300025938	Ga0207704_10000910	Ga0207704_100009108	360
248	3300025938	Ga0207704_10293605	Ga0207704_102936051	360
249	3300025961	Ga0207712_10006125	Ga0207712_100061253	360
250	3300026075	Ga0207708_10000324	Ga0207708_1000032426	360
251	3300026075	Ga0207708_10110756	Ga0207708_101107562	360
252	3300026089	Ga0207648_10000680	Ga0207648_100006807	360
253	3300026116	Ga0207674_10153729	Ga0207674_101537292	360
254	3300026118	Ga0207675_100279145	Ga0207675_1002791452	360
255	3300026121	Ga0207683_10211285	Ga0207683_102112851	360
256	3300027462	Ga0210000_1000944	Ga0210000_10009442	360
257	3300027682	Ga0209971_1015435	Ga0209971_10154351	360
258	3300027907	Ga0207428_10011687	Ga0207428_100116876	360
259	3300027907	Ga0207428_10032582	Ga0207428_100325824	360
260	3300028380	Ga0268265_10000691	Ga0268265_1000069113	360
261	3300028380	Ga0268265_10014612	Ga0268265_100146123	360
262	3300030521	Ga0307511_10022197	Ga0307511_100221972	360
263	3300031665	Ga0316575_10003117	Ga0316575_100031175	360
264	3300031665	Ga0316575_10016768	Ga0316575_100167682	360
265	3300031691	Ga0316579_10008210	Ga0316579_100082102	360
266	3300031731	Ga0307405_10074939	Ga0307405_100749392	360
267	3300032002	Ga0307416_100119596	Ga0307416_1001195962	360
268	3300032133	Ga0316583_10000416	Ga0316583_1000041610	360
269	3300032133	Ga0316583_10007677	Ga0316583_100076772	360
270	3300035086	Ga0373934_0004134	Ga0373934_0004134_1485_2576	360
271	3300035089	Ga0373944_0029087	Ga0373944_0029087_428_1519	360
272	3300035111	Ga0373923_0000364	Ga0373923_0000364_4025_5116	360
273	3300035117	Ga0373953_0002878	Ga0373953_0002878_2466_3557	360
274	3300035118	Ga0373954_0008376	Ga0373954_0008376_1766_2857	360
275	3300035119	Ga0373956_0008747	Ga0373956_0008747_1020_2111	360
276	3300035120	Ga0373957_0034573	Ga0373957_0034573_728_1819	360
277	3300035171	Ga0373946_0024871	Ga0373946_0024871_760_1851	360
278	3300035172	Ga0373955_0018074	Ga0373955_0018074_841_1932	360
279	3300035172	Ga0373955_0199322	Ga0373955_0199322_78_1169	360
280	3300035398	Ga0316574_0003177	Ga0316574_0003177_7109_8230	360
281	3300035692	Ga0373935_0014761	Ga0373935_0014761_1127_2218	360
282	3300035724	Ga0373933_0023963	Ga0373933_0023963_862_1953	360
283	3300035724	Ga0373933_0031919	Ga0373933_0031919_1703_2794	360
284	3300036401	Ga0373937_0031795	Ga0373937_0031795_2595_3713	360
285	3300036401	Ga0373937_0055168	Ga0373937_0055168_830_1921	360
286	3300036401	Ga0373937_0085405	Ga0373937_0085405_830_1921	360
287	3300036647	Ga0316582_0011200	Ga0316582_0011200_11_1102	360
288	3300036647	Ga0316582_0091213	Ga0316582_0091213_795_1913	360
289	3300037068	Ga0373925_0014304	Ga0373925_0014304_1857_2948	360
290	3300037588	Ga0316581_0010679	Ga0316581_0010679_658_1749	360
291	3300039062	Ga0400483_035242	Ga0400483_035242_3538_4776	360
292	3300039062	Ga0400483_052553	Ga0400483_052553_334_1485	360
293	3300039093	Ga0400489_25171	Ga0400489_25171_87_1205	360
294	3300042156	Ga0439446_0002505	Ga0439446_0002505_1419_2543	360
295	3300042435	Ga0439434_0000318	Ga0439434_0000318_4856_5980	360
296	3300042436	Ga0439435_0000030	Ga0439435_0000030_11442_12566	360
297	3300044712	Ga0453684_0121546	Ga0453684_0121546_258_1346	360
298	3300045051	Ga0451576_0008879	Ga0451576_0008879_4844_5962	360
299	3300045976	Ga0466967_0018751	Ga0466967_0018751_400_1530	360
300	3300046454	Ga0495592_0008089	Ga0495592_0008089_4442_5533	360
301	3300046459	Ga0495629_0200756	Ga0495629_0200756_188_1306	360
302	3300046461	Ga0495641_0003419	Ga0495641_0003419_2595_3686	360
303	3300046462	Ga0495651_0002367	Ga0495651_0002367_5968_7059	360
304	3300046463	Ga0495653_0011578	Ga0495653_0011578_1661_2752	360
305	3300046472	Ga0495580_0009276	Ga0495580_0009276_1608_2699	360
306	3300046473	Ga0495582_0008048	Ga0495582_0008048_2823_3914	360
307	3300046476	Ga0495662_0003158	Ga0495662_0003158_250_1341	360
308	3300046491	Ga0495584_0134722	Ga0495584_0134722_83_1201	360
309	3300046511	Ga0495608_0008197	Ga0495608_0008197_2248_3339	360
310	3300046514	Ga0495618_0014417	Ga0495618_0014417_1998_3089	360
311	3300046517	Ga0495630_0001696	Ga0495630_0001696_10392_11483	360
312	3300046526	Ga0495666_0004093	Ga0495666_0004093_945_2036	360
313	3300046529	Ga0495652_0036258	Ga0495652_0036258_3031_4122	360
314	3300046529	Ga0495652_0108527	Ga0495652_0108527_911_2041	360
315	3300046531	Ga0495665_0078251	Ga0495665_0078251_276_1367	360
316	3300046533	Ga0495640_0013772	Ga0495640_0013772_1757_2848	360
317	3300046535	Ga0495586_0020917	Ga0495586_0020917_1559_2650	360
318	3300046535	Ga0495586_0037297	Ga0495586_0037297_1341_2432	360
319	3300046536	Ga0495587_0007279	Ga0495587_0007279_1647_2738	360
320	3300046537	Ga0495598_0022822	Ga0495598_0022822_280_1413	360
321	3300046539	Ga0495621_0002478	Ga0495621_0002478_1415_2530	360
322	3300046559	Ga0495667_0006341	Ga0495667_0006341_1549_2640	360
323	3300046642	Ga0495634_0015282	Ga0495634_0015282_1128_2219	360
324	3300046675	Ga0495657_0002998	Ga0495657_0002998_5594_6685	360
325	3300046681	Ga0495647_0000579	Ga0495647_0000579_5560_6651	360
326	3300046683	Ga0495658_0024873	Ga0495658_0024873_1366_2511	360
327	3300046684	Ga0495669_0003438	Ga0495669_0003438_2924_4042	360
328	3300046684	Ga0495669_0069750	Ga0495669_0069750_127_1260	360
329	3300046689	Ga0495613_0009944	Ga0495613_0009944_3905_4996	360
330	3300046809	Ga0495600_0007539	Ga0495600_0007539_1128_2219	360
331	3300047317	Ga0495604_0011861	Ga0495604_0011861_4036_5127	360
332	3300047319	Ga0495674_0016800	Ga0495674_0016800_343_1434	360
333	3300047322	Ga0495680_0060438	Ga0495680_0060438_830_1921	360
334	3300048907	Ga0496104_0312890	Ga0496104_0312890_217_1338	360
335	3300049568	Ga0501031_0011697	Ga0501031_0011697_1711_2871	360
336	3300049568	Ga0501031_0015905	Ga0501031_0015905_953_2113	360
337	3300049568	Ga0501031_0047486	Ga0501031_0047486_722_1852	360
338	3300049569	Ga0501032_0019127	Ga0501032_0019127_72_1232	360
339	3300049570	Ga0501033_0001039	Ga0501033_0001039_14454_15614	360
340	3300049570	Ga0501033_0002048	Ga0501033_0002048_12533_13660	360
341	3300049570	Ga0501033_0004798	Ga0501033_0004798_4628_5758	360
342	3300049570	Ga0501033_0019009	Ga0501033_0019009_2800_3960	360
343	3300049571	Ga0501034_0135495	Ga0501034_0135495_892_2052	360
344	3300049571	Ga0501034_0317009	Ga0501034_0317009_261_1421	360
345	3300049572	Ga0501036_0000101	Ga0501036_0000101_39109_40239	360
346	3300049572	Ga0501036_0001533	Ga0501036_0001533_1521_2681	360
347	3300049572	Ga0501036_0002719	Ga0501036_0002719_1734_2894	360
348	3300049573	Ga0501037_0009039	Ga0501037_0009039_3371_4531	360
349	3300049573	Ga0501037_0017516	Ga0501037_0017516_1676_2836	360
350	3300049574	Ga0501038_0004165	Ga0501038_0004165_2290_3420	360
351	3300049574	Ga0501038_0005798	Ga0501038_0005798_6378_7538	360
352	3300049574	Ga0501038_0038076	Ga0501038_0038076_2795_3955	360
353	3300049574	Ga0501038_0123434	Ga0501038_0123434_484_1611	360
354	3300049574	Ga0501038_0153192	Ga0501038_0153192_667_1827	360
355	3300049574	Ga0501038_0240904	Ga0501038_0240904_219_1349	360
356	3300049575	Ga0501039_0000117	Ga0501039_0000117_25729_26859	360
357	3300049575	Ga0501039_0003988	Ga0501039_0003988_2353_3513	360
358	3300049575	Ga0501039_0183048	Ga0501039_0183048_210_1340	360
359	3300049576	Ga0501040_0001575	Ga0501040_0001575_3572_4702	360
360	3300049576	Ga0501040_0053395	Ga0501040_0053395_433_1563	360
361	3300049577	Ga0501041_0000040	Ga0501041_0000040_18797_19927	360
362	3300049578	Ga0501042_0000026	Ga0501042_0000026_25355_26485	360
363	3300049578	Ga0501042_0049205	Ga0501042_0049205_163_1293	360
364	3300049579	Ga0501043_0003181	Ga0501043_0003181_553_1713	360
365	3300049579	Ga0501043_0008119	Ga0501043_0008119_4437_5567	360
366	3300049579	Ga0501043_0043418	Ga0501043_0043418_2100_3260	360
367	3300049580	Ga0501046_0004663	Ga0501046_0004663_8257_9417	360
368	3300049580	Ga0501046_0007305	Ga0501046_0007305_6980_8110	360
369	3300049580	Ga0501046_0010695	Ga0501046_0010695_904_2064	360
370	3300049580	Ga0501046_0146157	Ga0501046_0146157_318_1445	360
371	3300049581	Ga0501047_0010563	Ga0501047_0010563_3841_5001	360
372	3300049581	Ga0501047_0286714	Ga0501047_0286714_274_1434	360
373	3300049582	Ga0501048_0001267	Ga0501048_0001267_16576_17736	360
374	3300049582	Ga0501048_0003867	Ga0501048_0003867_5600_6730	360
375	3300049583	Ga0501067_0006547	Ga0501067_0006547_2380_3540	360
376	3300049584	Ga0501068_0017968	Ga0501068_0017968_2160_3320	360
377	3300049584	Ga0501068_0027286	Ga0501068_0027286_1498_2628	360
378	3300049586	Ga0501070_0001668	Ga0501070_0001668_5365_6525	360
379	3300049586	Ga0501070_0153632	Ga0501070_0153632_667_1827	360
380	3300049587	Ga0501071_0011883	Ga0501071_0011883_4313_5443	360
381	3300049588	Ga0501072_0000528	Ga0501072_0000528_7108_8238	360
382	3300049588	Ga0501072_0023023	Ga0501072_0023023_3677_4807	360
383	3300049589	Ga0501073_0000328	Ga0501073_0000328_10400_11560	360
384	3300049590	Ga0501074_0037840	Ga0501074_0037840_2265_3425	360
385	3300049591	Ga0501075_0000036	Ga0501075_0000036_16012_17142	360
386	3300049592	Ga0501076_0001556	Ga0501076_0001556_444_1574	360
387	3300049593	Ga0501077_0005681	Ga0501077_0005681_1000_2130	360
388	3300049593	Ga0501077_0104220	Ga0501077_0104220_103_1233	360
389	3300049741	Ga0501079_0000807	Ga0501079_0000807_15803_16933	360
390	3300049741	Ga0501079_0006073	Ga0501079_0006073_4447_5607	360
391	3300049742	Ga0501080_0001508	Ga0501080_0001508_3994_5154	360
392	3300049742	Ga0501080_0015116	Ga0501080_0015116_3028_4158	360
393	3300049742	Ga0501080_0026338	Ga0501080_0026338_4179_5339	360
394	3300049743	Ga0501081_0000074	Ga0501081_0000074_30836_31966	360
395	3300049743	Ga0501081_0166059	Ga0501081_0166059_242_1372	360
396	3300049744	Ga0501083_0011951	Ga0501083_0011951_83_1243	360
397	3300049744	Ga0501083_0040297	Ga0501083_0040297_756_1883	360
398	3300049822	Ga0501035_0001691	Ga0501035_0001691_7250_8377	360
399	3300049822	Ga0501035_0003534	Ga0501035_0003534_9793_10953	360
400	3300049822	Ga0501035_0015579	Ga0501035_0015579_4394_5524	360
401	3300049822	Ga0501035_0116071	Ga0501035_0116071_213_1343	360
402	3300049822	Ga0501035_0250079	Ga0501035_0250079_274_1434	360
403	3300049823	Ga0501044_0008317	Ga0501044_0008317_9235_10395	360
404	3300049823	Ga0501044_0089194	Ga0501044_0089194_1679_2839	360
405	3300049823	Ga0501044_0354728	Ga0501044_0354728_173_1300	360
406	3300049824	Ga0501045_0000438	Ga0501045_0000438_5728_6858	360
407	3300049824	Ga0501045_0004188	Ga0501045_0004188_6870_8030	360
408	3300050507	nmdc:mga05p37_293615_c1	nmdc:mga05p37_293615_c1_531_1661	360
409	3300050507	nmdc:mga05p37_82549_c1	nmdc:mga05p37_82549_c1_955_2079	360
410	3300050508	nmdc:mga09592_285552_c1	nmdc:mga09592_285552_c1_273_1397	360
411	3300050511	nmdc:mga08y16_22563_c1	nmdc:mga08y16_22563_c1_895_2028	360
412	3300050512	nmdc:mga0n895_16516_c1	nmdc:mga0n895_16516_c1_452_1588	360
413	3300050512	nmdc:mga0n895_181584_c1	nmdc:mga0n895_181584_c1_810_1958	360
414	3300050512	nmdc:mga0n895_3499_c1	nmdc:mga0n895_3499_c1_2776_3906	360
415	3300050512	nmdc:mga0n895_43823_c1	nmdc:mga0n895_43823_c1_3142_4260	360
416	3300050513	nmdc:mga0rr50_2558_c1	nmdc:mga0rr50_2558_c1_697_1827	360
417	3300050514	nmdc:mga08x19_233640_c1	nmdc:mga08x19_233640_c1_88_1236	360
418	3300053077	Ga0495601_0019455	Ga0495601_0019455_177_1268	360
419	3300053078	Ga0495612_0070998	Ga0495612_0070998_205_1296	360
420	3300053084	Ga0495595_0005823	Ga0495595_0005823_3038_4129	360
421	3300053085	Ga0495619_0007201	Ga0495619_0007201_4299_5390	360
422	3300054114	Ga0501084_0000883	Ga0501084_0000883_16118_17248	360
423	3300054114	Ga0501084_0116492	Ga0501084_0116492_988_2118	360
424	3300059421	Ga0590071_012635	Ga0590071_012635_493_1617	360
425	3300059424	Ga0590075_000333	Ga0590075_000333_2960_4171	360
426	3300059426	Ga0590077_000187	Ga0590077_000187_1757_2968	360
427	3300060353	Ga0501082_0000619	Ga0501082_0000619_21882_23012	360
428	3300060353	Ga0501082_0023994	Ga0501082_0023994_1620_2747	360
429	3300061734	Ga0530510_0000117	Ga0530510_0000117_25264_26394	360
430	3300061734	Ga0530510_0124356	Ga0530510_0124356_490_1620	360
431	iso_pu_bacteria	8057160832	8057161533	360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

185

394

0.95 PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

44

163

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1pqu-assembly2.cif.gz_B	crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with nadp, s-methyl cysteine sulfoxide and cacodylate	0.9873	1	356
7skb-assembly2.cif.gz_C	crystal structure of aspartate-semialdehyde dehydrogenase from acinetobacter baumannii	0.986	1	360
1t4d-assembly2.cif.gz_C-2	crystal structure of escherichia coli aspartate beta-semialdehyde dehydrogenase (ecasadh), at 1.95 angstrom resolution	0.9857	1	355
3pzr-assembly1.cif.gz_A	crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with nadp and product of s-carbamoyl-l-cysteine	0.9842	1	357
1gl3-assembly1.cif.gz_B	aspartate beta-semialdehyde dehydrogenase in complex with nadp and substrate analogue s-methyl cysteine sulfoxide	0.9833	1	355

ID	Description	Score	Start	End	Superfamily
1ozaA02	Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2	0.9891	124	338	3.30.360.10
af_P0A9Q9_5_251_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9792	1	239	3.90.180.10
af_P0A9Q9_3_137_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9772	1	125	3.40.50.720
1nx6A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9769	1	123	3.40.50.720
1ozaA02	Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2	0.9712	124	338	3.30.360.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2J4QDW8-F1-model_v4	Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)	1.002	285	355	GO:0004073 GO:0008652 GO:0046983
AF-A0A522BPK9-F1-model_v4	Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)	1.001	264	357	GO:0004073 GO:0008652 GO:0046983
AF-A0A7V5KW34-F1-model_v4	Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)	1	251	360	GO:0004073 GO:0009085 GO:0009086 GO:0019877 GO:0046983 GO:0050661
AF-A0A7V4UW60-F1-model_v4	Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)	0.9998	248	357	GO:0004073 GO:0009085 GO:0009086 GO:0019877 GO:0046983 GO:0050661
AF-A0A353NG78-F1-model_v4	Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)	0.9998	266	344	GO:0004073 GO:0008652 GO:0046983

Feature Viewer

pLDDT	pTM	Quality
95.2	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442421

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

185

394

0.95

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

44

163

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map