F442271

General Info

Members Datasets Scaffolds Average Seq Length
430 407 137 288

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2889790730|2889793007
Length 305
Sequence APIAASPTASPATLRRLTDGKALPIAIVVASIVLIWYGFTVYLNAPWQIGLYQRAGAEWTASDLVRDTMAQERPVLPAPHQVVAEMWKTTVETRPTSNRSLLNHAWITLSSTLLGFAIGTTLGVLLAVGIVHNRAMDKSVMPWVIASQTIPILAIAPMIIVVLNAIGLSGILPKALISTYLSFFPVVVGMVKGFRSPEAIQLDLMRTYNASRTQTFFRLRWPSALPFLFTSMKVAVAISLVGAIVGELPTGAVAGLGARLLAGSYYGQTIQIWAALFMAAALAAILVALVGLAQRLVMARMGARP

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
14 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
15 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
16 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
17 2516143018 Ensifer sp. BR816 Isolate Nodule
18 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
19 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
20 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
21 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
22 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
23 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
24 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
25 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
26 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
27 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
28 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
29 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
30 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
31 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
32 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
33 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
34 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
35 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
36 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
37 2643221557 Ensifer sp. Root558 Isolate Unclassified
38 2643221558 Rhizobium sp. Root149 Isolate Unclassified
39 2643221580 Devosia sp. Root635 Isolate Unclassified
40 2643221607 Rhizobium sp. Root73 Isolate Unclassified
41 2643221610 Ensifer sp. Root74 Isolate Unclassified
42 2643221618 Ensifer sp. Root231 Isolate Unclassified
43 2643221626 Ensifer sp. Root31 Isolate Unclassified
44 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
45 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
46 2643221655 Ensifer sp. Root1252 Isolate Unclassified
47 2643221659 Ensifer sp. Root127 Isolate Unclassified
48 2643221668 Ensifer sp. Root423 Isolate Unclassified
49 2643221675 Ensifer sp. Root1298 Isolate Unclassified
50 2643221680 Ensifer sp. Root1312 Isolate Unclassified
51 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
52 2643221688 Rhizobium sp. Root482 Isolate Unclassified
53 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
54 2643221698 Ensifer sp. Root142 Isolate Unclassified
55 2643221712 Ensifer sp. Root258 Isolate Unclassified
56 2643221718 Rhizobium sp. Root268 Isolate Unclassified
57 2643221723 Ensifer sp. Root278 Isolate Unclassified
58 2643221726 Ensifer sp. Root954 Isolate Unclassified
59 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
60 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
61 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
62 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
63 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
64 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
65 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
66 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
67 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
68 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
69 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
70 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
71 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
72 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
73 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
74 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
75 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
76 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
77 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
78 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
79 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
80 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
81 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
82 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
83 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
84 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
85 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
86 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
87 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
88 2844163670 Ensifer sp. 1H6 Isolate Unclassified
89 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
90 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
91 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
92 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
93 2854911287 Brucella lupini LUP21 Isolate Unclassified
94 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
95 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
96 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
97 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
98 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
99 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
100 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
101 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
102 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
103 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
104 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
105 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
106 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
107 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
108 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
109 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
110 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
111 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
112 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
113 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
114 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
115 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
116 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
117 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
118 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
119 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
120 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
121 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
122 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
123 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
124 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
125 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
126 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
127 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
128 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
129 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
130 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
131 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
132 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
133 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
134 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
135 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
136 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
137 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
138 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
139 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
140 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
141 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
142 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
143 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
144 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
145 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
146 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
147 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
148 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
149 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
150 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
151 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
152 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
153 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
154 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
155 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
156 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
157 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
158 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
159 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
160 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
161 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
162 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
163 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
164 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
165 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
166 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
167 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
168 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
169 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
170 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
171 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
172 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
173 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
174 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
175 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
176 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
177 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
178 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
179 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
180 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
181 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
182 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
183 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
184 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
185 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
186 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
187 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
188 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
189 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
190 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
191 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
192 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
193 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
194 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
195 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
196 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
197 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
198 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
199 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
200 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
201 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
202 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
203 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
204 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
205 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
206 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
207 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
208 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
209 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
210 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
211 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
212 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
213 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
214 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
215 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
216 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
217 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
218 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
219 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
220 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
221 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
222 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
223 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
224 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
225 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
226 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
227 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
228 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
229 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
230 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
231 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
232 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
233 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
234 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
235 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
236 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
237 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
238 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
239 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
240 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
241 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
242 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
243 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
244 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
245 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
246 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
247 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
248 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
249 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
250 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
251 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
252 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
253 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
254 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
255 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
256 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
257 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
258 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
259 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
260 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
261 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
262 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
263 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
264 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
265 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
266 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
267 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
268 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
269 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
270 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
271 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
272 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
273 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
274 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
275 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
276 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
277 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
278 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
279 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
280 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
281 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
282 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
283 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
284 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
285 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
286 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
287 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
288 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
289 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
290 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
291 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
292 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
293 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
294 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
295 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
296 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
297 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
298 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
299 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
300 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
301 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
302 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
303 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
304 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
305 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
306 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
307 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
308 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
309 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
310 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
311 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
312 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
313 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
314 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
315 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
316 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
317 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
318 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
319 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
320 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
321 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
322 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
324 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
327 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
328 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
337 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
338 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
339 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
340 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
341 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
342 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
343 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
344 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
345 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
346 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
347 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
348 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
349 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
350 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
351 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
352 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
353 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
354 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
355 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
356 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
357 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
358 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
359 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
360 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
361 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
362 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
363 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
364 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
365 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
366 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
367 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
393 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
394 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
395 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
396 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
397 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
400 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
401 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
402 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
403 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
404 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
405 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
406 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
407 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 31.63
Metatranscriptomes 0.23
Isolates 68.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.91
Nodule 53.26
Rhizoplane 1.16
Rhizosphere 19.53
Stem 0
Stem Tuber 0
Unclassified 18.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000008 3300002987 Bacteria 172667
2 JGI25160J50197_1000033 3300003354 Bacteria 172667
3 JGI25161J50226_1001306 3300003374 Bacteria 7853
4 Ga0006562J51391_1004059 3300003578 Bacteria 7408
5 Ga0055526_1000653 3300003771 Bacteria 26790
6 Ga0055524_1003306 3300003775 Bacteria 7872
7 Ga0055536_1004025 3300003781 Bacteria 7663
8 Ga0055531_10027789 3300003794 Bacteria 1972
9 Ga0055543_1000026 3300004625 Bacteria 136177
10 Ga0065165_1000178 3300005262 Bacteria 113319
11 Ga0070661_100004986 3300005344 Bacteria 9143
12 Ga0070661_100017373 3300005344 Bacteria 5104
13 Ga0070668_100012105 3300005347 Bacteria 6425
14 Ga0070667_100502757 3300005367 Bacteria 1111
15 Ga0068853_100000271 3300005539 Bacteria 36616
16 Ga0070686_100063210 3300005544 Bacteria 2397
17 Ga0068857_100125082 3300005577 Bacteria 2317
18 Ga0068854_100055149 3300005578 Bacteria 2860
19 Ga0068852_100006113 3300005616 Bacteria 8681
20 Ga0068851_10003553 3300005834 Bacteria 6941
21 Ga0075368_10036869 3300006042 Bacteria 1911
22 Ga0075363_100031257 3300006048 Bacteria 2759
23 Ga0075364_10012404 3300006051 Bacteria 5211
24 Ga0075362_10002360 3300006177 Bacteria 6320
25 Ga0075369_10166470 3300006186 Bacteria 1011
26 Ga0079104_1001481 3300006946 Bacteria 15645
27 Ga0079104_1009204 3300006946 Bacteria 3366
28 Ga0105243_10153629 3300009148 Bacteria 1977
29 Ga0105241_10014223 3300009174 Bacteria 5830
30 Ga0105238_10072179 3300009551 Bacteria 3449
31 Ga0105239_10579818 3300010375 Bacteria 1279
32 Ga0171463_1007 3300013249 Bacteria 301198
33 Ga0157378_10227522 3300013297 Bacteria 1775
34 Ga0183363_1084 3300015690 Bacteria 28436
35 Ga0214544_1000010 3300021320 Bacteria 270164
36 Ga0214542_1000023 3300021321 Bacteria 191557
37 Ga0214543_1000019 3300021327 Bacteria 267908
38 Ga0214543_1000022 3300021327 Bacteria 241930
39 Ga0228711_1000017 3300022739 Bacteria 121084
40 Ga0228710_1000005 3300022740 Bacteria 233531
41 Ga0209130_1000017 3300025284 Bacteria 388431
42 Ga0209676_1001868 3300025292 Bacteria 17327
43 Ga0209025_1000153 3300025294 Bacteria 170548
44 Ga0209564_1000013 3300025295 Bacteria 775755
45 Ga0209050_1003752 3300025298 Bacteria 10896
46 Ga0209256_1000211 3300025299 Bacteria 110131
47 Ga0209256_1009453 3300025299 Bacteria 4271
48 Ga0207426_1000006 3300025302 Bacteria 1025969
49 Ga0209257_1013610 3300025304 Bacteria 3593
50 Ga0207656_10003678 3300025321 Bacteria 5306
51 Ga0207649_10001014 3300025920 Bacteria 17344
52 Ga0207709_10008159 3300025935 Bacteria 5799
53 Ga0207640_10019181 3300025981 Bacteria 4035
54 Ga0207639_10001237 3300026041 Bacteria 17295
55 Ga0207674_10209108 3300026116 Bacteria 1900
56 Ga0207698_10015221 3300026142 Bacteria 5147
57 Ga0209281_1000082 3300027111 Bacteria 257684
58 Ga0209281_1000484 3300027111 Bacteria 55133
59 Ga0209282_1000006 3300027666 Bacteria 276998
60 Ga0307515_10000017 3300028794 Bacteria 550465
61 Ga0307515_10016027 3300028794 Bacteria 13756
62 Ga0307513_10000852 3300031456 Bacteria 44393
63 Ga0307513_10026587 3300031456 Bacteria 6668
64 Ga0316576_10041834 3300031727 Bacteria 3300
65 Ga0316578_10020559 3300031728 Bacteria 3650
66 Ga0307406_10037366 3300031901 Bacteria 2999
67 Ga0307412_10496561 3300031911 Bacteria 1015
68 Ga0315914_1000003 3300031967 Bacteria 314370
69 Ga0315913_1000001 3300033430 Bacteria 284459
70 Ga0315915_1000008 3300033464 Bacteria 258517
71 Ga0373935_0232142 3300035692 Bacteria 1285
72 Ga0373927_0002185 3300035695 Bacteria 14378
73 Ga0316584_0065527 3300036712 Bacteria 2721
74 Ga0316584_0142952 3300036712 Bacteria 1783
75 Ga0373925_0002324 3300037068 Bacteria 15297
76 Ga0400483_048939 3300039062 Bacteria 1726
77 Ga0400483_064186 3300039062 Bacteria 26495
78 Ga0400483_274439 3300039062 Bacteria 13218
79 Ga0436361_0923664 3300039447 Bacteria 3916
80 Ga0439436_0002887 3300041404 Bacteria 5222
81 Ga0439439_0031912 3300041406 Bacteria 1344
82 Ga0439465_0016416 3300041413 Bacteria 2309
83 Ga0451807_0877284 3300041486 Bacteria 1145
84 Ga0439449_0028381 3300042007 Bacteria 2086
85 Ga0439449_0103321 3300042007 Bacteria 1054
86 Ga0450906_014998 3300042145 Bacteria 1412
87 Ga0466965_0027951 3300044683 Bacteria 2739
88 Ga0451576_0018873 3300045051 Bacteria 7538
89 Ga0495638_0186998 3300046460 Bacteria 1178
90 Ga0495633_0064807 3300046558 Bacteria 1708
91 Ga0496116_0081633 3300048919 Bacteria 2003
92 Ga0496117_0014050 3300048920 Bacteria 6926
93 Ga0496118_0034836 3300048921 Bacteria 4100
94 Ga0496119_0017908 3300048922 Bacteria 5304
95 Ga0496120_0032322 3300048923 Bacteria 3156
96 Ga0496121_0000003 3300048924 Bacteria 1191431
97 Ga0496121_0043175 3300048924 Bacteria 3909
98 Ga0496122_0132086 3300048925 Bacteria 1583
99 Ga0496124_0000067 3300048927 Bacteria 222576
100 Ga0496124_0013289 3300048927 Bacteria 8045
101 Ga0496125_0000262 3300048928 Bacteria 108389
102 Ga0496126_0031796 3300048929 Bacteria 4980
103 Ga0496126_0120519 3300048929 Bacteria 2276
104 Ga0496126_0148529 3300048929 Bacteria 2011
105 Ga0496126_0265368 3300048929 Bacteria 1426
106 Ga0501032_0115820 3300049569 Bacteria 1772
107 Ga0501033_0227212 3300049570 Bacteria 1327
108 Ga0501034_0000012 3300049571 Bacteria 310504
109 Ga0501037_0040170 3300049573 Bacteria 3443
110 Ga0501037_0184681 3300049573 Bacteria 1478
111 Ga0501038_0122453 3300049574 Bacteria 2143
112 Ga0501038_0440626 3300049574 Bacteria 1003
113 Ga0501039_0100010 3300049575 Bacteria 2263
114 Ga0501043_0129745 3300049579 Bacteria 1976
115 Ga0501043_0302654 3300049579 Bacteria 1221
116 Ga0501047_0165955 3300049581 Bacteria 2078
117 Ga0501068_0255716 3300049584 Bacteria 1117
118 Ga0501070_0032344 3300049586 Bacteria 4377
119 Ga0501072_0201341 3300049588 Bacteria 1588
120 Ga0501073_0304715 3300049589 Bacteria 1099
121 Ga0501079_0214739 3300049741 Bacteria 1503
122 Ga0501080_0210434 3300049742 Bacteria 1782
123 Ga0501280_004079 3300049776 Bacteria 2173
124 Ga0501044_0256703 3300049823 Bacteria 1687
125 Ga0501044_0453255 3300049823 Bacteria 1189
126 nmdc:mga03683_4236_c1 3300050489 Bacteria 4729
127 nmdc:mga00v17_11871_c1 3300050491 Bacteria 4795
128 nmdc:mga00v17_34229_c1 3300050491 Bacteria 3015
129 nmdc:mga0sz30_148215_c1 3300050516 Bacteria 1037
130 Ga0500644_0002531 3300053088 Bacteria 4566
131 Ga0500618_004184 3300053125 Bacteria 4700
132 Ga0500573_0001859 3300053140 Bacteria 10276
133 Ga0500573_0092770 3300053140 Bacteria 1704
134 Ga0500577_0048876 3300053142 Bacteria 1580
135 Ga0500588_0009446 3300053146 Bacteria 2318
136 Ga0500622_0032103 3300053156 Bacteria 2753
137 Ga0501084_0416424 3300054114 Bacteria 1136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0120519 Ga0496126_0120519_1526_2263 244
2 3300053140 Ga0500573_0001859 Ga0500573_0001859_6625_7515 249
3 iso_pu_bacteria 2937868953 2937876050 249
4 3300039062 Ga0400483_048939 Ga0400483_048939_902_1708 254
5 3300010375 Ga0105239_10579818 Ga0105239_105798181 256
6 3300039062 Ga0400483_064186 Ga0400483_064186_5276_6151 257
7 3300039062 Ga0400483_274439 Ga0400483_274439_5459_6334 257
8 3300042007 Ga0439449_0103321 Ga0439449_0103321_21_872 259
9 3300049570 Ga0501033_0227212 Ga0501033_0227212_63_989 259
10 3300049823 Ga0501044_0256703 Ga0501044_0256703_507_1433 259
11 3300049823 Ga0501044_0453255 Ga0501044_0453255_125_961 260
12 3300005344 Ga0070661_100017373 Ga0070661_1000173735 262
13 3300009148 Ga0105243_10153629 Ga0105243_101536292 263
14 3300049589 Ga0501073_0304715 Ga0501073_0304715_47_925 263
15 3300005344 Ga0070661_100004986 Ga0070661_1000049864 265
16 3300005539 Ga0068853_100000271 Ga0068853_1000002718 265
17 3300005577 Ga0068857_100125082 Ga0068857_1001250822 265
18 3300005578 Ga0068854_100055149 Ga0068854_1000551492 265
19 3300005616 Ga0068852_100006113 Ga0068852_1000061134 265
20 3300005834 Ga0068851_10003553 Ga0068851_100035534 265
21 3300009174 Ga0105241_10014223 Ga0105241_100142233 265
22 3300009551 Ga0105238_10072179 Ga0105238_100721793 265
23 3300025321 Ga0207656_10003678 Ga0207656_100036784 265
24 3300025920 Ga0207649_10001014 Ga0207649_100010144 265
25 3300025981 Ga0207640_10019181 Ga0207640_100191812 265
26 3300026041 Ga0207639_10001237 Ga0207639_1000123713 265
27 3300026116 Ga0207674_10209108 Ga0207674_102091082 265
28 3300026142 Ga0207698_10015221 Ga0207698_100152214 265
29 3300053140 Ga0500573_0092770 Ga0500573_0092770_101_985 265
30 3300013297 Ga0157378_10227522 Ga0157378_102275222 267
31 3300003578 Ga0006562J51391_1004059 Ga0006562J51391_10040594 268
32 3300025935 Ga0207709_10008159 Ga0207709_100081594 268
33 3300049571 Ga0501034_0000012 Ga0501034_0000012_137295_138158 268
34 3300036712 Ga0316584_0065527 Ga0316584_0065527_156_1028 269
35 3300006042 Ga0075368_10036869 Ga0075368_100368691 270
36 3300041404 Ga0439436_0002887 Ga0439436_0002887_345_1229 270
37 3300041413 Ga0439465_0016416 Ga0439465_0016416_148_1032 270
38 3300048924 Ga0496121_0043175 Ga0496121_0043175_357_1226 270
39 3300049569 Ga0501032_0115820 Ga0501032_0115820_815_1741 270
40 3300049573 Ga0501037_0184681 Ga0501037_0184681_346_1272 270
41 3300049574 Ga0501038_0122453 Ga0501038_0122453_262_1188 270
42 3300049575 Ga0501039_0100010 Ga0501039_0100010_821_1747 270
43 3300049579 Ga0501043_0302654 Ga0501043_0302654_264_1190 270
44 3300049581 Ga0501047_0165955 Ga0501047_0165955_441_1367 270
45 3300049584 Ga0501068_0255716 Ga0501068_0255716_65_991 270
46 3300049586 Ga0501070_0032344 Ga0501070_0032344_2354_3280 270
47 3300049742 Ga0501080_0210434 Ga0501080_0210434_783_1709 270
48 3300005347 Ga0070668_100012105 Ga0070668_1000121055 271
49 3300039447 Ga0436361_0923664 Ga0436361_0923664_1348_2169 272
50 3300048919 Ga0496116_0081633 Ga0496116_0081633_860_1735 272
51 3300049776 Ga0501280_004079 Ga0501280_004079_628_1515 272
52 3300005544 Ga0070686_100063210 Ga0070686_1000632103 273
53 3300049741 Ga0501079_0214739 Ga0501079_0214739_525_1397 273
54 3300042007 Ga0439449_0028381 Ga0439449_0028381_1246_2070 274
55 3300053146 Ga0500588_0009446 Ga0500588_0009446_520_1491 274
56 3300053088 Ga0500644_0002531 Ga0500644_0002531_2839_3726 276
57 3300053142 Ga0500577_0048876 Ga0500577_0048876_108_995 276
58 3300053156 Ga0500622_0032103 Ga0500622_0032103_99_986 276
59 3300006048 Ga0075363_100031257 Ga0075363_1000312573 277
60 3300006177 Ga0075362_10002360 Ga0075362_100023602 277
61 3300006186 Ga0075369_10166470 Ga0075369_101664701 277
62 3300028794 Ga0307515_10000017 Ga0307515_10000017235 277
63 3300031456 Ga0307513_10000852 Ga0307513_1000085216 277
64 3300050489 nmdc:mga03683_4236_c1 nmdc:mga03683_4236_c1_2170_3051 277
65 3300050516 nmdc:mga0sz30_148215_c1 nmdc:mga0sz30_148215_c1_63_944 277
66 3300053125 Ga0500618_004184 Ga0500618_004184_1628_2533 277
67 3300005367 Ga0070667_100502757 Ga0070667_1005027571 279
68 3300049588 Ga0501072_0201341 Ga0501072_0201341_560_1405 280
69 iso_pu_bacteria 2791355094 2792638758 280
70 3300031456 Ga0307513_10026587 Ga0307513_100265877 281
71 3300044683 Ga0466965_0027951 Ga0466965_0027951_421_1299 281
72 3300048927 Ga0496124_0000067 Ga0496124_0000067_77698_78576 281
73 3300049579 Ga0501043_0129745 Ga0501043_0129745_381_1262 281
74 3300054114 Ga0501084_0416424 Ga0501084_0416424_25_870 281
75 3300046460 Ga0495638_0186998 Ga0495638_0186998_90_962 282
76 3300031727 Ga0316576_10041834 Ga0316576_100418343 283
77 3300031728 Ga0316578_10020559 Ga0316578_100205592 283
78 3300036712 Ga0316584_0142952 Ga0316584_0142952_393_1271 283
79 iso_pu_bacteria 2643221580 2643910802 283
80 iso_pu_bacteria 2713897090 2715500681 283
81 iso_pu_bacteria 2840878972 2840879378 283
82 iso_pu_bacteria 2854681122 2854681685 283
83 iso_pu_bacteria 2898795034 2898796403 283
84 iso_pu_bacteria 2919679072 2919681491 283
85 3300021327 Ga0214543_1000022 Ga0214543_1000022225 286
86 3300049573 Ga0501037_0040170 Ga0501037_0040170_113_997 286
87 3300049574 Ga0501038_0440626 Ga0501038_0440626_27_911 286
88 iso_pu_bacteria 2599185156 2599332123 286
89 iso_pu_bacteria 2643221637 2644208670 286
90 iso_pu_bacteria 2643221718 2644652200 286
91 iso_pu_bacteria 2842922631 2842924478 286
92 3300041486 Ga0451807_0877284 Ga0451807_0877284_78_944 287
93 3300045051 Ga0451576_0018873 Ga0451576_0018873_1754_2620 287
94 iso_pu_bacteria 2765235802 2765465955 287
95 iso_pu_bacteria 2767802442 2770196590 287
96 iso_pu_bacteria 2775506902 2776269302 287
97 iso_pu_bacteria 2775506904 2776283559 287
98 iso_pu_bacteria 2840764183 2840766595 287
99 iso_pu_bacteria 2894652903 2894653456 287
100 iso_pu_bacteria 2904578770 2904579714 287
101 iso_pu_bacteria 2919119836 2919120619 287
102 iso_pu_bacteria 2929138655 2929141163 287
103 iso_pu_bacteria 3002141150 3002141929 287
104 3300048929 Ga0496126_0148529 Ga0496126_0148529_316_1188 288
105 iso_pu_bacteria 2839993093 2839993588 288
106 iso_pu_bacteria 2854911287 2854914157 288
107 iso_pu_bacteria 3000405567 3000407579 288
108 3300035692 Ga0373935_0232142 Ga0373935_0232142_362_1243 289
109 3300035695 Ga0373927_0002185 Ga0373927_0002185_563_1444 289
110 3300037068 Ga0373925_0002324 Ga0373925_0002324_13002_13883 289
111 3300050491 nmdc:mga00v17_34229_c1 nmdc:mga00v17_34229_c1_532_1413 289
112 iso_pu_bacteria 8055431914 8055435371 289
113 iso_pu_bacteria 2509276019 2509376800 290
114 iso_pu_bacteria 2510065057 2510304097 290
115 iso_pu_bacteria 2510461069 2510839327 290
116 iso_pu_bacteria 2511231052 2511502531 290
117 iso_pu_bacteria 2512047086 2512533905 290
118 iso_pu_bacteria 2512875026 2512970336 290
119 iso_pu_bacteria 2513237086 2513583164 290
120 iso_pu_bacteria 2513237089 2513601400 290
121 iso_pu_bacteria 2513237091 2513620310 290
122 iso_pu_bacteria 2513237140 2513881782 290
123 iso_pu_bacteria 2513237143 2513904926 290
124 iso_pu_bacteria 2513237156 2513983597 290
125 iso_pu_bacteria 2513237159 2513997547 290
126 iso_pu_bacteria 2513237160 2514003153 290
127 iso_pu_bacteria 2515154107 2515609318 290
128 iso_pu_bacteria 2516143018 2516206048 290
129 iso_pu_bacteria 2516653046 2516893906 290
130 iso_pu_bacteria 2517487022 2517570626 290
131 iso_pu_bacteria 2524023207 2524448271 290
132 iso_pu_bacteria 2551306084 2551675298 290
133 iso_pu_bacteria 2551306084 2551676708 290
134 iso_pu_bacteria 2551306085 2551689418 290
135 iso_pu_bacteria 2551306086 2551696008 290
136 iso_pu_bacteria 2551306087 2551697245 290
137 iso_pu_bacteria 2551306089 2551708854 290
138 iso_pu_bacteria 2551306090 2551716341 290
139 iso_pu_bacteria 2551306091 2551726451 290
140 iso_pu_bacteria 2551306092 2551731804 290
141 iso_pu_bacteria 2551306093 2551740969 290
142 iso_pu_bacteria 2558860100 2558865842 290
143 iso_pu_bacteria 2582581283 2585167581 290
144 iso_pu_bacteria 2582581306 2585265811 290
145 iso_pu_bacteria 2582581865 2585389058 290
146 iso_pu_bacteria 2582581866 2585395201 290
147 iso_pu_bacteria 2599185352 2600196046 290
148 iso_pu_bacteria 2643221557 2643804413 290
149 iso_pu_bacteria 2643221607 2644052073 290
150 iso_pu_bacteria 2643221610 2644065183 290
151 iso_pu_bacteria 2643221636 2644204866 290
152 iso_pu_bacteria 2643221668 2644377593 290
153 iso_pu_bacteria 2643221675 2644416855 290
154 iso_pu_bacteria 2643221680 2644449895 290
155 iso_pu_bacteria 2643221686 2644484816 290
156 iso_pu_bacteria 2643221688 2644494187 290
157 iso_pu_bacteria 2643221689 2644500628 290
158 iso_pu_bacteria 2643221723 2644672751 290
159 iso_pu_bacteria 2643221726 2644690030 290
160 iso_pu_bacteria 2657244999 2657684842 290
161 iso_pu_bacteria 2690316117 2692315156 290
162 iso_pu_bacteria 2751185821 2753463331 290
163 iso_pu_bacteria 2775507049 2776914322 290
164 iso_pu_bacteria 2791355082 2792581560 290
165 iso_pu_bacteria 2791355091 2792620457 290
166 iso_pu_bacteria 2791355092 2792625815 290
167 iso_pu_bacteria 2791355253 2793283771 290
168 iso_pu_bacteria 2802428858 2802716693 290
169 iso_pu_bacteria 2802428859 2802725504 290
170 iso_pu_bacteria 2802428860 2802730404 290
171 iso_pu_bacteria 2802428861 2802737624 290
172 iso_pu_bacteria 2802428862 2802742986 290
173 iso_pu_bacteria 2802428863 2802750410 290
174 iso_pu_bacteria 2802429268 2804753028 290
175 iso_pu_bacteria 2838074704 2838079649 290
176 iso_pu_bacteria 2842521101 2842522210 290
177 iso_pu_bacteria 2847417321 2847419788 290
178 iso_pu_bacteria 2848992105 2848994804 290
179 iso_pu_bacteria 2850079185 2850081803 290
180 iso_pu_bacteria 2855825444 2855826631 290
181 iso_pu_bacteria 2855839649 2855842022 290
182 iso_pu_bacteria 2855872281 2855877304 290
183 iso_pu_bacteria 2858800743 2858802696 290
184 iso_pu_bacteria 2896384573 2896391238 290
185 iso_pu_bacteria 2899803654 2899806705 290
186 iso_pu_bacteria 2913295892 2913299094 290
187 iso_pu_bacteria 2915980308 2915981166 290
188 iso_pu_bacteria 2915986958 2915989941 290
189 iso_pu_bacteria 2915993759 2915998536 290
190 iso_pu_bacteria 2916000859 2916005073 290
191 iso_pu_bacteria 2916007675 2916012987 290
192 iso_pu_bacteria 2916014648 2916021087 290
193 iso_pu_bacteria 2916021584 2916023044 290
194 iso_pu_bacteria 2916028427 2916034206 290
195 iso_pu_bacteria 2916035215 2916039336 290
196 iso_pu_bacteria 2916041962 2916044400 290
197 iso_pu_bacteria 2916048683 2916050448 290
198 iso_pu_bacteria 2916055098 2916061505 290
199 iso_pu_bacteria 2916061851 2916062029 290
200 iso_pu_bacteria 2916068649 2916069358 290
201 iso_pu_bacteria 2916076590 2916080498 290
202 iso_pu_bacteria 2920760137 2920761161 290
203 iso_pu_bacteria 2920822456 2920825651 290
204 iso_pu_bacteria 2921201388 2921205503 290
205 iso_pu_bacteria 2921208531 2921209701 290
206 iso_pu_bacteria 2921237296 2921239284 290
207 iso_pu_bacteria 2921244191 2921247818 290
208 iso_pu_bacteria 2921250672 2921251675 290
209 iso_pu_bacteria 2921257292 2921262628 290
210 iso_pu_bacteria 2921263974 2921269639 290
211 iso_pu_bacteria 2921282425 2921287158 290
212 iso_pu_bacteria 2921289301 2921294094 290
213 iso_pu_bacteria 2921296804 2921300505 290
214 iso_pu_bacteria 2924144063 2924148558 290
215 iso_pu_bacteria 2924150972 2924151505 290
216 iso_pu_bacteria 2924158325 2924159911 290
217 iso_pu_bacteria 2924165586 2924167539 290
218 iso_pu_bacteria 2924172951 2924174621 290
219 iso_pu_bacteria 2924179722 2924183751 290
220 iso_pu_bacteria 2924186466 2924193115 290
221 iso_pu_bacteria 2924193448 2924196465 290
222 iso_pu_bacteria 2924200457 2924203915 290
223 iso_pu_bacteria 2924207177 2924210826 290
224 iso_pu_bacteria 2924214083 2924218204 290
225 iso_pu_bacteria 2924221636 2924227405 290
226 iso_pu_bacteria 2924228884 2924233246 290
227 iso_pu_bacteria 2936996657 2937002782 290
228 iso_pu_bacteria 2937002841 2937005347 290
229 iso_pu_bacteria 2937009748 2937012882 290
230 iso_pu_bacteria 2937016420 2937021852 290
231 iso_pu_bacteria 2937023124 2937027357 290
232 iso_pu_bacteria 2937029754 2937035657 290
233 iso_pu_bacteria 2937042894 2937043859 290
234 iso_pu_bacteria 2937049772 2937050304 290
235 iso_pu_bacteria 2937056579 2937058369 290
236 iso_pu_bacteria 2937063883 2937068671 290
237 iso_pu_bacteria 2937071275 2937072393 290
238 iso_pu_bacteria 2937078374 2937080719 290
239 iso_pu_bacteria 2937084907 2937090110 290
240 iso_pu_bacteria 2937091812 2937097413 290
241 iso_pu_bacteria 2937098957 2937101128 290
242 iso_pu_bacteria 2937106411 2937110235 290
243 iso_pu_bacteria 2937113482 2937117660 290
244 iso_pu_bacteria 2937119839 2937124492 290
245 iso_pu_bacteria 2937126314 2937131438 290
246 iso_pu_bacteria 2957375807 2957380668 290
247 iso_pu_bacteria 2957382221 2957382535 290
248 iso_pu_bacteria 2957388812 2957389485 290
249 iso_pu_bacteria 2957395598 2957397274 290
250 iso_pu_bacteria 2957402308 2957408338 290
251 iso_pu_bacteria 2957408893 2957412906 290
252 iso_pu_bacteria 2957415311 2957418959 290
253 iso_pu_bacteria 2957422303 2957426788 290
254 iso_pu_bacteria 2957430029 2957435887 290
255 iso_pu_bacteria 2957437181 2957440155 290
256 iso_pu_bacteria 2957443900 2957450589 290
257 iso_pu_bacteria 2957450854 2957455313 290
258 iso_pu_bacteria 2957457609 2957460433 290
259 iso_pu_bacteria 2957464669 2957468837 290
260 iso_pu_bacteria 2957471148 2957472914 290
261 iso_pu_bacteria 2957478035 2957483578 290
262 iso_pu_bacteria 2957484790 2957489161 290
263 iso_pu_bacteria 2957491536 2957497972 290
264 iso_pu_bacteria 2957498199 2957501710 290
265 iso_pu_bacteria 2957505466 2957507338 290
266 iso_pu_bacteria 2960584000 2960586173 290
267 iso_pu_bacteria 2960591022 2960591832 290
268 iso_pu_bacteria 2960597568 2960602088 290
269 iso_pu_bacteria 2960603979 2960610426 290
270 iso_pu_bacteria 2960610863 2960614846 290
271 iso_pu_bacteria 2960617483 2960618014 290
272 iso_pu_bacteria 2960624210 2960630081 290
273 iso_pu_bacteria 2960631154 2960634033 290
274 iso_pu_bacteria 2960637947 2960638967 290
275 iso_pu_bacteria 2960645483 2960651131 290
276 iso_pu_bacteria 2960652885 2960658502 290
277 iso_pu_bacteria 2960660292 2960667144 290
278 iso_pu_bacteria 2960667422 2960670743 290
279 iso_pu_bacteria 2960674078 2960675878 290
280 iso_pu_bacteria 2960680706 2960680784 290
281 iso_pu_bacteria 2960687367 2960688220 290
282 iso_pu_bacteria 2960693952 2960696565 290
283 iso_pu_bacteria 2964607997 2964614180 290
284 iso_pu_bacteria 2964615318 2964617153 290
285 iso_pu_bacteria 2964621998 2964622770 290
286 iso_pu_bacteria 2964628898 2964632828 290
287 iso_pu_bacteria 2964636051 2964639125 290
288 iso_pu_bacteria 2964643177 2964646267 290
289 iso_pu_bacteria 2964649959 2964651230 290
290 iso_pu_bacteria 2964656573 2964663325 290
291 iso_pu_bacteria 2964663802 2964667647 290
292 iso_pu_bacteria 2964670856 2964673325 290
293 iso_pu_bacteria 2964678106 2964680038 290
294 iso_pu_bacteria 2964685014 2964689202 290
295 iso_pu_bacteria 2964691889 2964694822 290
296 iso_pu_bacteria 2964698721 2964699319 290
297 iso_pu_bacteria 2964705432 2964706481 290
298 iso_pu_bacteria 2964712639 2964718773 290
299 iso_pu_bacteria 2964719344 2964722233 290
300 iso_pu_bacteria 2967664464 2967666734 290
301 iso_pu_bacteria 2967671571 2967673250 290
302 iso_pu_bacteria 2967678726 2967685841 290
303 iso_pu_bacteria 2967686174 2967690020 290
304 iso_pu_bacteria 2967693043 2967699040 290
305 iso_pu_bacteria 2967699805 2967702237 290
306 iso_pu_bacteria 2967706974 2967712879 290
307 iso_pu_bacteria 2967714385 2967720404 290
308 iso_pu_bacteria 2967721400 2967722372 290
309 iso_pu_bacteria 2967728569 2967732316 290
310 iso_pu_bacteria 2967735183 2967739881 290
311 iso_pu_bacteria 2967742019 2967744912 290
312 iso_pu_bacteria 2967748971 2967749324 290
313 iso_pu_bacteria 2967755722 2967759634 290
314 iso_pu_bacteria 2967762386 2967763602 290
315 iso_pu_bacteria 2967769361 2967772720 290
316 iso_pu_bacteria 2967775926 2967776362 290
317 iso_pu_bacteria 2970019648 2970024300 290
318 iso_pu_bacteria 2970026789 2970027562 290
319 iso_pu_bacteria 2970033650 2970036000 290
320 iso_pu_bacteria 2970040964 2970045183 290
321 iso_pu_bacteria 2970047711 2970049058 290
322 iso_pu_bacteria 2970054988 2970056243 290
323 iso_pu_bacteria 2970061556 2970066029 290
324 iso_pu_bacteria 2970068827 2970071009 290
325 iso_pu_bacteria 2970076120 2970079438 290
326 iso_pu_bacteria 2970082768 2970084594 290
327 iso_pu_bacteria 2970088815 2970094256 290
328 iso_pu_bacteria 2970095765 2970097194 290
329 iso_pu_bacteria 2970102677 2970103951 290
330 iso_pu_bacteria 2970109326 2970111877 290
331 iso_pu_bacteria 2970116247 2970120576 290
332 iso_pu_bacteria 2970122695 2970126351 290
333 iso_pu_bacteria 2970129317 2970135869 290
334 iso_pu_bacteria 2970136068 2970141803 290
335 iso_pu_bacteria 2970143518 2970147153 290
336 iso_pu_bacteria 2970149975 2970152474 290
337 iso_pu_bacteria 2970156795 2970162625 290
338 iso_pu_bacteria 2970164137 2970168292 290
339 iso_pu_bacteria 2970177841 2970181089 290
340 iso_pu_bacteria 2970184632 2970186261 290
341 iso_pu_bacteria 2970191845 2970196132 290
342 iso_pu_bacteria 2977516862 2977519329 290
343 iso_pu_bacteria 2977523885 2977524433 290
344 iso_pu_bacteria 2977530762 2977536373 290
345 iso_pu_bacteria 2977537788 2977543320 290
346 iso_pu_bacteria 2977544691 2977549650 290
347 iso_pu_bacteria 2977551784 2977553042 290
348 iso_pu_bacteria 2977558990 2977559937 290
349 iso_pu_bacteria 2977565890 2977568838 290
350 iso_pu_bacteria 2977572785 2977574070 290
351 iso_pu_bacteria 2977579622 2977585929 290
352 iso_pu_bacteria 2989349275 2989351060 290
353 iso_pu_bacteria 2989771324 2989773330 290
354 iso_pu_bacteria 3003930520 3003934671 290
355 iso_pu_bacteria 643692032 643826682 290
356 iso_pu_bacteria 648276728 648739520 290
357 iso_pu_bacteria 8003992118 8003994457 290
358 iso_pu_bacteria 8003999396 8004002163 290
359 iso_pu_bacteria 8005246636 8005249804 290
360 iso_pu_bacteria 8018150411 8018154091 290
361 iso_pu_bacteria 8049293176 8049295642 290
362 iso_pu_bacteria 8054558443 8054561903 290
363 3300006051 Ga0075364_10012404 Ga0075364_100124042 291
364 3300048920 Ga0496117_0014050 Ga0496117_0014050_786_1661 291
365 3300048921 Ga0496118_0034836 Ga0496118_0034836_1884_2759 291
366 3300048922 Ga0496119_0017908 Ga0496119_0017908_2308_3183 291
367 3300048923 Ga0496120_0032322 Ga0496120_0032322_1295_2170 291
368 3300048924 Ga0496121_0000003 Ga0496121_0000003_777232_778107 291
369 3300048925 Ga0496122_0132086 Ga0496122_0132086_454_1329 291
370 3300048927 Ga0496124_0013289 Ga0496124_0013289_149_1024 291
371 3300048928 Ga0496125_0000262 Ga0496125_0000262_25084_25959 291
372 3300048929 Ga0496126_0265368 Ga0496126_0265368_131_1006 291
373 3300050491 nmdc:mga00v17_11871_c1 nmdc:mga00v17_11871_c1_3339_4214 291
374 iso_pu_bacteria 2508501122 2509108020 291
375 iso_pu_bacteria 2818991272 2819240971 291
376 iso_pu_bacteria 2989776772 2989779582 291
377 iso_pu_bacteria 2643221558 2643811097 292
378 iso_pu_bacteria 2643221618 2644105476 292
379 iso_pu_bacteria 2643221626 2644146479 292
380 iso_pu_bacteria 2643221655 2644308227 292
381 iso_pu_bacteria 2643221659 2644334051 292
382 iso_pu_bacteria 2643221698 2644541648 292
383 iso_pu_bacteria 2643221712 2644615509 292
384 iso_pu_bacteria 2738543031 2739347123 292
385 iso_pu_bacteria 2844163670 2844166390 292
386 iso_pu_bacteria 2941499720 2941504582 292
387 iso_pu_bacteria 2928521798 2928522514 293
388 3300002987 JGI25159J45721_1000008 JGI25159J45721_100000884 294
389 3300003354 JGI25160J50197_1000033 JGI25160J50197_100003391 294
390 3300003374 JGI25161J50226_1001306 JGI25161J50226_10013069 294
391 3300003771 Ga0055526_1000653 Ga0055526_100065320 294
392 3300003775 Ga0055524_1003306 Ga0055524_10033067 294
393 3300003781 Ga0055536_1004025 Ga0055536_10040255 294
394 3300003794 Ga0055531_10027789 Ga0055531_100277893 294
395 3300004625 Ga0055543_1000026 Ga0055543_100002649 294
396 3300005262 Ga0065165_1000178 Ga0065165_100017891 294
397 3300006946 Ga0079104_1001481 Ga0079104_100148113 294
398 3300006946 Ga0079104_1009204 Ga0079104_10092042 294
399 3300013249 Ga0171463_1007 Ga0171463_1007216 294
400 3300015690 Ga0183363_1084 Ga0183363_10845 294
401 3300021320 Ga0214544_1000010 Ga0214544_1000010148 294
402 3300021321 Ga0214542_1000023 Ga0214542_1000023102 294
403 3300021327 Ga0214543_1000019 Ga0214543_1000019177 294
404 3300022739 Ga0228711_1000017 Ga0228711_100001771 294
405 3300022740 Ga0228710_1000005 Ga0228710_1000005182 294
406 3300025284 Ga0209130_1000017 Ga0209130_100001786 294
407 3300025292 Ga0209676_1001868 Ga0209676_10018685 294
408 3300025294 Ga0209025_1000153 Ga0209025_100015391 294
409 3300025295 Ga0209564_1000013 Ga0209564_1000013535 294
410 3300025298 Ga0209050_1003752 Ga0209050_10037522 294
411 3300025299 Ga0209256_1000211 Ga0209256_100021126 294
412 3300025299 Ga0209256_1009453 Ga0209256_10094534 294
413 3300025302 Ga0207426_1000006 Ga0207426_100000685 294
414 3300025304 Ga0209257_1013610 Ga0209257_10136102 294
415 3300027111 Ga0209281_1000082 Ga0209281_1000082130 294
416 3300027111 Ga0209281_1000484 Ga0209281_100048452 294
417 3300027666 Ga0209282_1000006 Ga0209282_1000006152 294
418 3300028794 Ga0307515_10016027 Ga0307515_100160276 294
419 3300031901 Ga0307406_10037366 Ga0307406_100373662 294
420 3300031911 Ga0307412_10496561 Ga0307412_104965611 294
421 3300031967 Ga0315914_1000003 Ga0315914_1000003207 294
422 3300033430 Ga0315913_1000001 Ga0315913_1000001158 294
423 3300033464 Ga0315915_1000008 Ga0315915_1000008129 294
424 3300041406 Ga0439439_0031912 Ga0439439_0031912_342_1226 294
425 3300042145 Ga0450906_014998 Ga0450906_014998_387_1271 294
426 3300046558 Ga0495633_0064807 Ga0495633_0064807_777_1661 294
427 3300048929 Ga0496126_0031796 Ga0496126_0031796_809_1693 294
428 iso_pu_bacteria 2889790730 2889793007 294
429 iso_pu_bacteria 2889914905 2889919414 294
430 iso_pu_bacteria 2937843397 2937848075 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

303

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8479 90 286
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7766 90 286
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7508 71 289
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7389 90 289
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7337 79 289
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.944 93 283 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9255 89 283 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9249 93 286 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.912 93 289 1.10.3720.10
af_O69722_23_210_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9073 92 282 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2P7BLB9-F1-model_v4 ABC transporter permease 0.9762 6 294 GO:0005886
GO:0055085
AF-A0A382EI94-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9758 50 294 GO:0005886
GO:0055085
AF-A0A528CYA0-F1-model_v4 ABC transporter permease 0.9723 48 294 GO:0005886
GO:0055085
AF-A0A382EI94-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9719 50 294 GO:0005886
GO:0055085
AF-A0A6I6IVB8-F1-model_v4 ABC transporter permease 0.9705 9 293 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.87 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map