F442247

General Info

Members Datasets Scaffolds Average Seq Length
430 241 860 89

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0057533|Ga0501067_0057533_30_323
Length 97
Sequence VGDNSRVAIVRRRVVAHGHVQGVFFRETTRRRAESAGVTGWVRNVPDGSVEAVFEGDAESVEVLLRFCERGPRGARVEWVDVSSEPPERLSGFSVRG

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
128 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
129 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
223 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
232 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 6.51
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 15.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0057533 3300049583 Bacteria 2153
2 Ga0065712_10316031 3300005290 Bacteria 786
3 Ga0065715_10649247 3300005293 Bacteria 679
4 Ga0070683_100885678 3300005329 Bacteria 856
5 Ga0070670_101994285 3300005331 Bacteria 535
6 Ga0068868_101298975 3300005338 Bacteria 676
7 Ga0070660_100707304 3300005339 Bacteria 845
8 Ga0070668_100793673 3300005347 Bacteria 841
9 Ga0070668_101245058 3300005347 Bacteria 675
10 Ga0070675_100175666 3300005354 Bacteria 1849
11 Ga0070671_101099320 3300005355 Bacteria 698
12 Ga0070671_101702427 3300005355 Bacteria 560
13 Ga0070674_100043865 3300005356 Bacteria 3045
14 Ga0070674_100933321 3300005356 Bacteria 758
15 Ga0070673_100632726 3300005364 Bacteria 978
16 Ga0070659_101275017 3300005366 Unclassified 651
17 Ga0070667_101644151 3300005367 Bacteria 604
18 Ga0070701_10309443 3300005438 Bacteria 974
19 Ga0070701_10781120 3300005438 Unclassified 650
20 Ga0070711_100169278 3300005439 Bacteria 1664
21 Ga0070700_100462534 3300005441 Bacteria 968
22 Ga0070678_100376329 3300005456 Bacteria 1227
23 Ga0070662_100808851 3300005457 Bacteria 797
24 Ga0070662_100865365 3300005457 Unclassified 770
25 Ga0070662_100976200 3300005457 Bacteria 725
26 Ga0070679_101832749 3300005530 Unclassified 555
27 Ga0070684_101538631 3300005535 Unclassified 627
28 Ga0068853_102334838 3300005539 Unclassified 518
29 Ga0070672_100077881 3300005543 Bacteria 2652
30 Ga0070672_100296845 3300005543 Unclassified 1369
31 Ga0070704_100608537 3300005549 Unclassified 961
32 Ga0068856_100795159 3300005614 Unclassified 966
33 Ga0070702_101189135 3300005615 Bacteria 614
34 Ga0068852_101084472 3300005616 Unclassified 821
35 Ga0068866_10287704 3300005718 Bacteria 1021
36 Ga0068866_10406234 3300005718 Bacteria 880
37 Ga0068861_100579405 3300005719 Unclassified 1027
38 Ga0068861_101966539 3300005719 Bacteria 583
39 Ga0068863_100984587 3300005841 Bacteria 846
40 Ga0068863_101502267 3300005841 Unclassified 682
41 Ga0068860_101129756 3300005843 Unclassified 803
42 Ga0068862_101512420 3300005844 Bacteria 677
43 Ga0068862_101993441 3300005844 Unclassified 591
44 Ga0081455_10075590 3300005937 Bacteria 2778
45 Ga0081455_10641867 3300005937 Bacteria 685
46 Ga0081538_10343021 3300005981 Bacteria 541
47 Ga0081540_1000408 3300005983 Bacteria 42368
48 Ga0081539_10018037 3300005985 Bacteria 4919
49 Ga0081539_10030087 3300005985 Bacteria 3379
50 Ga0097621_100471164 3300006237 Bacteria 1134
51 Ga0068871_100062028 3300006358 Bacteria 3055
52 Ga0075430_100709622 3300006846 Unclassified 829
53 Ga0068865_100297236 3300006881 Bacteria 1291
54 Ga0111539_11000281 3300009094 Bacteria 972
55 Ga0111539_12080348 3300009094 Bacteria 659
56 Ga0105245_11031641 3300009098 Unclassified 867
57 Ga0105245_11642671 3300009098 Bacteria 694
58 Ga0105243_10392729 3300009148 Bacteria 1286
59 Ga0105243_10757706 3300009148 Bacteria 952
60 Ga0105243_10812489 3300009148 Bacteria 923
61 Ga0105242_10412211 3300009176 Bacteria 1264
62 Ga0105248_10290786 3300009177 Bacteria 1840
63 Ga0105248_12866808 3300009177 Unclassified 550
64 Ga0105238_12970734 3300009551 Unclassified 510
65 Ga0105249_10279121 3300009553 Bacteria 1667
66 Ga0105249_11674357 3300009553 Bacteria 709
67 Ga0105239_11096667 3300010375 Unclassified 916
68 Ga0157316_1044981 3300012510 Unclassified 590
69 Ga0157371_11664398 3300013102 Bacteria 500
70 Ga0157370_11907983 3300013104 Unclassified 533
71 Ga0157374_12117249 3300013296 Bacteria 589
72 Ga0163162_10099840 3300013306 Bacteria 2993
73 Ga0163162_12870418 3300013306 Bacteria 554
74 Ga0157372_12183419 3300013307 Unclassified 636
75 Ga0157375_10045857 3300013308 Bacteria 4257
76 Ga0157375_11159245 3300013308 Bacteria 906
77 Ga0157375_12036556 3300013308 Bacteria 683
78 Ga0157375_12386005 3300013308 Unclassified 631
79 Ga0157375_12954762 3300013308 Unclassified 568
80 Ga0163163_10641457 3300014325 Bacteria 1125
81 Ga0157380_11097663 3300014326 Bacteria 834
82 Ga0157380_11510851 3300014326 Bacteria 725
83 Ga0157380_11560985 3300014326 Bacteria 715
84 Ga0157377_11029899 3300014745 Bacteria 626
85 Ga0163161_10015740 3300017792 Bacteria 5274
86 Ga0207663_10390601 3300025916 Unclassified 1062
87 Ga0207657_10472769 3300025919 Bacteria 983
88 Ga0207659_10042996 3300025926 Bacteria 3170
89 Ga0207687_10100752 3300025927 Bacteria 2125
90 Ga0207687_10727625 3300025927 Unclassified 843
91 Ga0207644_10108346 3300025931 Bacteria 2097
92 Ga0207706_10513786 3300025933 Bacteria 1033
93 Ga0207706_10818076 3300025933 Unclassified 790
94 Ga0207706_10825114 3300025933 Bacteria 787
95 Ga0207706_10874245 3300025933 Bacteria 760
96 Ga0207706_11414800 3300025933 Bacteria 570
97 Ga0207709_11047462 3300025935 Bacteria 668
98 Ga0207670_10759593 3300025936 Unclassified 806
99 Ga0207669_10237130 3300025937 Bacteria 1350
100 Ga0207669_10627767 3300025937 Bacteria 876
101 Ga0207704_10497967 3300025938 Bacteria 981
102 Ga0207691_10037780 3300025940 Bacteria 4470
103 Ga0207691_10234586 3300025940 Bacteria 1588
104 Ga0207691_10302529 3300025940 Bacteria 1374
105 Ga0207661_11112682 3300025944 Bacteria 727
106 Ga0207661_12110209 3300025944 Bacteria 510
107 Ga0207651_10095567 3300025960 Bacteria 2189
108 Ga0207712_10327007 3300025961 Bacteria 1267
109 Ga0207668_10362552 3300025972 Bacteria 1215
110 Ga0207668_11414545 3300025972 Bacteria 627
111 Ga0207668_11697121 3300025972 Unclassified 570
112 Ga0207668_11814060 3300025972 Bacteria 550
113 Ga0207640_10811023 3300025981 Unclassified 811
114 Ga0207658_10955348 3300025986 Bacteria 781
115 Ga0207677_10073987 3300026023 Bacteria 2415
116 Ga0207677_10180795 3300026023 Bacteria 1659
117 Ga0207678_10569922 3300026067 Bacteria 991
118 Ga0207708_10267357 3300026075 Bacteria 1382
119 Ga0207708_10647493 3300026075 Bacteria 899
120 Ga0207702_10359806 3300026078 Bacteria 1395
121 Ga0207702_10606829 3300026078 Unclassified 1074
122 Ga0207702_11514850 3300026078 Unclassified 664
123 Ga0207641_10974871 3300026088 Unclassified 844
124 Ga0207641_11006427 3300026088 Bacteria 830
125 Ga0207675_100183139 3300026118 Bacteria 2007
126 Ga0207675_100935000 3300026118 Bacteria 884
127 Ga0207675_101148412 3300026118 Bacteria 797
128 Ga0207675_101893966 3300026118 Unclassified 615
129 Ga0207683_10574375 3300026121 Bacteria 1043
130 Ga0207683_10796855 3300026121 Unclassified 877
131 Ga0209983_1020387 3300027665 Bacteria 1382
132 Ga0209971_1008771 3300027682 Bacteria 2398
133 Ga0209974_10010057 3300027876 Bacteria 3198
134 Ga0268265_10616876 3300028380 Unclassified 1039
135 Ga0268265_11544372 3300028380 Bacteria 668
136 Ga0268265_11739834 3300028380 Unclassified 630
137 Ga0268264_11477972 3300028381 Unclassified 690
138 Ga0268264_12072036 3300028381 Unclassified 578
139 Ga0307408_100013315 3300031548 Bacteria 5459
140 Ga0307408_100182917 3300031548 Bacteria 1682
141 Ga0307405_10174590 3300031731 Bacteria 1536
142 Ga0307405_10452528 3300031731 Bacteria 1018
143 Ga0307405_11911915 3300031731 Unclassified 529
144 Ga0307413_10130929 3300031824 Bacteria 1717
145 Ga0307413_11335520 3300031824 Bacteria 628
146 Ga0307410_10015410 3300031852 Bacteria 4533
147 Ga0307410_10026754 3300031852 Bacteria 3636
148 Ga0307410_10036771 3300031852 Bacteria 3192
149 Ga0307410_10475101 3300031852 Bacteria 1024
150 Ga0307406_10038653 3300031901 Bacteria 2955
151 Ga0307406_10038915 3300031901 Bacteria 2946
152 Ga0307406_10567567 3300031901 Bacteria 931
153 Ga0307406_11276803 3300031901 Unclassified 640
154 Ga0307407_10037453 3300031903 Bacteria 2680
155 Ga0307407_10091747 3300031903 Bacteria 1863
156 Ga0307407_10223175 3300031903 Unclassified 1275
157 Ga0307407_10475535 3300031903 Bacteria 911
158 Ga0307407_10665132 3300031903 Bacteria 781
159 Ga0307412_10113011 3300031911 Bacteria 1942
160 Ga0307412_10190699 3300031911 Bacteria 1549
161 Ga0307409_100024308 3300031995 Bacteria 4223
162 Ga0307409_100130805 3300031995 Bacteria 2144
163 Ga0307409_100148974 3300031995 Bacteria 2028
164 Ga0307409_100427416 3300031995 Bacteria 1272
165 Ga0307409_101226754 3300031995 Bacteria 774
166 Ga0307416_100038665 3300032002 Bacteria 3683
167 Ga0307416_100064334 3300032002 Bacteria 3008
168 Ga0307416_100068664 3300032002 Bacteria 2929
169 Ga0307416_100469710 3300032002 Bacteria 1315
170 Ga0307416_103090349 3300032002 Bacteria 557
171 Ga0307414_10141656 3300032004 Bacteria 1883
172 Ga0307414_11989997 3300032004 Bacteria 542
173 Ga0307411_10423523 3300032005 Bacteria 1106
174 Ga0307415_100028679 3300032126 Bacteria 3545
175 Ga0307415_100036597 3300032126 Bacteria 3218
176 Ga0307415_100067212 3300032126 Bacteria 2504
177 Ga0307415_100109509 3300032126 Bacteria 2046
178 Ga0307415_100269785 3300032126 Bacteria 1393
179 Ga0307415_102223719 3300032126 Bacteria 537
180 Ga0307507_10242751 3300033179 Unclassified 1176
181 Ga0373934_0013221 3300035086 Bacteria 3119
182 Ga0373923_0124405 3300035111 Bacteria 1154
183 Ga0373936_0004817 3300035113 Bacteria 5092
184 Ga0373953_0006116 3300035117 Bacteria 3948
185 Ga0373956_0112395 3300035119 Bacteria 1268
186 Ga0373957_0001085 3300035120 Bacteria 7185
187 Ga0373943_0543213 3300035170 Bacteria 682
188 Ga0373946_0143436 3300035171 Bacteria 1109
189 Ga0373955_0005311 3300035172 Bacteria 5783
190 Ga0373924_0008377 3300035410 Bacteria 3754
191 Ga0373935_0015204 3300035692 Bacteria 4649
192 Ga0373933_0008236 3300035724 Bacteria 5688
193 Ga0373947_0479355 3300035725 Bacteria 844
194 Ga0373937_0062528 3300036401 Bacteria 3422
195 Ga0373925_0061088 3300037068 Bacteria 2830
196 Ga0373925_0091602 3300037068 Bacteria 2325
197 Ga0395899_0062845 3300037312 Bacteria 2733
198 Ga0395900_0002076 3300037418 Bacteria 22475
199 Ga0395900_0126619 3300037418 Bacteria 2620
200 Ga0395898_0019920 3300037466 Bacteria 6822
201 Ga0395898_0959906 3300037466 Unclassified 792
202 Ga0395905_0007606 3300037471 Bacteria 10757
203 Ga0395905_0734210 3300037471 Bacteria 890
204 Ga0395901_0037217 3300038443 Bacteria 5033
205 Ga0395901_0087444 3300038443 Bacteria 3258
206 Ga0395901_0348722 3300038443 Unclassified 1528
207 Ga0395901_0770095 3300038443 Bacteria 954
208 Ga0439438_104500 3300041405 Bacteria 686
209 Ga0439461_0008467 3300041410 Bacteria 1844
210 Ga0439465_0201338 3300041413 Bacteria 726
211 Ga0451807_2388984 3300041486 Bacteria 817
212 Ga0439431_0012029 3300041997 Bacteria 1984
213 Ga0439432_011074 3300042006 Bacteria 3110
214 Ga0439457_011516 3300042014 Bacteria 2011
215 Ga0439462_0001377 3300042015 Bacteria 5375
216 Ga0439446_0010975 3300042156 Bacteria 2451
217 Ga0439446_0033676 3300042156 Bacteria 1489
218 Ga0439434_0014406 3300042435 Bacteria 2352
219 Ga0466965_0618055 3300044683 Bacteria 617
220 Ga0466964_0381296 3300044706 Bacteria 732
221 Ga0466960_0050345 3300044901 Bacteria 2008
222 Ga0466960_0174942 3300044901 Bacteria 1161
223 Ga0466960_0417970 3300044901 Bacteria 775
224 Ga0466960_0880636 3300044901 Unclassified 545
225 Ga0466967_0009553 3300045976 Bacteria 7206
226 Ga0466967_2609994 3300045976 Bacteria 500
227 Ga0495627_226804 3300046453 Bacteria 513
228 Ga0495592_0307044 3300046454 Bacteria 1029
229 Ga0495590_0212664 3300046457 Bacteria 713
230 Ga0495629_0005346 3300046459 Bacteria 9589
231 Ga0495641_0427265 3300046461 Unclassified 602
232 Ga0495651_0037021 3300046462 Bacteria 3798
233 Ga0495653_0061389 3300046463 Bacteria 2844
234 Ga0495582_0039140 3300046473 Bacteria 2610
235 Ga0495582_0222296 3300046473 Bacteria 1081
236 Ga0495662_0009955 3300046476 Bacteria 4670
237 Ga0495664_0183702 3300046477 Bacteria 1267
238 Ga0495584_0183629 3300046491 Bacteria 1063
239 Ga0495584_0342919 3300046491 Bacteria 759
240 Ga0495585_0169160 3300046492 Bacteria 1130
241 Ga0495608_0011051 3300046511 Bacteria 6291
242 Ga0495618_0008633 3300046514 Bacteria 6157
243 Ga0495628_0591132 3300046516 Bacteria 793
244 Ga0495630_0028363 3300046517 Bacteria 4159
245 Ga0495644_0066316 3300046523 Bacteria 1356
246 Ga0495644_0098319 3300046523 Bacteria 1107
247 Ga0495666_0200730 3300046526 Bacteria 917
248 Ga0495652_0065148 3300046529 Bacteria 3062
249 Ga0495665_0005938 3300046531 Bacteria 6577
250 Ga0495640_0129837 3300046533 Bacteria 1631
251 Ga0495586_0021765 3300046535 Bacteria 3420
252 Ga0495587_0010491 3300046536 Bacteria 5892
253 Ga0495645_0272112 3300046543 Bacteria 1117
254 Ga0495667_0022639 3300046559 Bacteria 4233
255 Ga0495656_0131693 3300046615 Unclassified 1191
256 Ga0495656_0184257 3300046615 Bacteria 1028
257 Ga0495634_0189278 3300046642 Bacteria 1284
258 Ga0495635_0022056 3300046663 Bacteria 4437
259 Ga0495657_0079437 3300046675 Bacteria 2124
260 Ga0495599_0090827 3300046678 Bacteria 1905
261 Ga0495623_0024711 3300046679 Bacteria 3868
262 Ga0495646_0110768 3300046680 Bacteria 1563
263 Ga0495658_0130242 3300046683 Bacteria 1530
264 Ga0495658_0200122 3300046683 Bacteria 1245
265 Ga0495613_0011101 3300046689 Bacteria 6685
266 Ga0495624_0023626 3300046690 Bacteria 4052
267 Ga0495589_0285399 3300046794 Bacteria 767
268 Ga0495600_0032405 3300046809 Bacteria 3390
269 Ga0495581_0050416 3300047315 Bacteria 2404
270 Ga0495581_0095876 3300047315 Bacteria 1723
271 Ga0495604_0039546 3300047317 Bacteria 3706
272 Ga0495674_0153130 3300047319 Bacteria 1932
273 Ga0495680_0005436 3300047322 Bacteria 11988
274 Ga0495675_0005200 3300047444 Bacteria 7919
275 Ga0495684_0177110 3300047471 Bacteria 1582
276 Ga0495593_0007726 3300047673 Bacteria 6272
277 Ga0495602_0185045 3300048088 Bacteria 1602
278 Ga0495614_0203708 3300048089 Bacteria 896
279 Ga0495626_0275956 3300048091 Unclassified 669
280 Ga0496100_0005112 3300048903 Bacteria 7031
281 Ga0496100_0315685 3300048903 Bacteria 1173
282 Ga0496101_0495349 3300048904 Bacteria 965
283 Ga0496101_1153748 3300048904 Unclassified 608
284 Ga0496102_0013248 3300048905 Bacteria 7137
285 Ga0496102_0405618 3300048905 Bacteria 1281
286 Ga0496104_0014704 3300048907 Bacteria 7072
287 Ga0496105_0026023 3300048908 Bacteria 4769
288 Ga0496106_0040097 3300048909 Bacteria 3506
289 Ga0496107_0012489 3300048910 Bacteria 5927
290 Ga0496107_0110532 3300048910 Bacteria 2020
291 Ga0496107_0206400 3300048910 Bacteria 1460
292 Ga0496108_0005751 3300048911 Bacteria 10042
293 Ga0496109_0000470 3300048912 Bacteria 34274
294 Ga0496109_0223462 3300048912 Bacteria 1771
295 Ga0496110_0010597 3300048913 Bacteria 7504
296 Ga0496110_0012265 3300048913 Bacteria 7043
297 Ga0496110_0495597 3300048913 Unclassified 1112
298 Ga0496111_0055354 3300048914 Bacteria 2869
299 Ga0496111_0171419 3300048914 Bacteria 1612
300 Ga0496111_0285764 3300048914 Bacteria 1223
301 Ga0496112_0253796 3300048915 Bacteria 1709
302 Ga0496113_0007031 3300048916 Bacteria 7199
303 Ga0496113_0417106 3300048916 Bacteria 1078
304 Ga0496113_0585274 3300048916 Bacteria 894
305 Ga0496114_0032249 3300048917 Bacteria 4310
306 Ga0496114_0212313 3300048917 Bacteria 1698
307 Ga0501031_0001029 3300049568 Bacteria 16912
308 Ga0501031_0021796 3300049568 Bacteria 4175
309 Ga0501031_0028554 3300049568 Bacteria 3637
310 Ga0501031_0201263 3300049568 Bacteria 1299
311 Ga0501031_0412779 3300049568 Bacteria 873
312 Ga0501032_0010586 3300049569 Bacteria 6646
313 Ga0501033_0184618 3300049570 Unclassified 1494
314 Ga0501034_0018102 3300049571 Bacteria 7230
315 Ga0501036_0009848 3300049572 Bacteria 7867
316 Ga0501036_0076156 3300049572 Bacteria 2838
317 Ga0501036_0084118 3300049572 Bacteria 2690
318 Ga0501036_0121858 3300049572 Bacteria 2202
319 Ga0501036_0236635 3300049572 Bacteria 1532
320 Ga0501036_0446162 3300049572 Bacteria 1078
321 Ga0501037_0325712 3300049573 Bacteria 1063
322 Ga0501038_0003169 3300049574 Bacteria 15341
323 Ga0501038_0033268 3300049574 Bacteria 4542
324 Ga0501038_0086410 3300049574 Bacteria 2635
325 Ga0501038_0613993 3300049574 Bacteria 822
326 Ga0501039_0018802 3300049575 Bacteria 5303
327 Ga0501039_0018960 3300049575 Bacteria 5280
328 Ga0501040_0000149 3300049576 Bacteria 38433
329 Ga0501040_0004339 3300049576 Bacteria 9217
330 Ga0501040_0108202 3300049576 Bacteria 1943
331 Ga0501040_0147755 3300049576 Bacteria 1657
332 Ga0501041_0010176 3300049577 Bacteria 5543
333 Ga0501041_0024785 3300049577 Bacteria 3602
334 Ga0501041_0329838 3300049577 Bacteria 963
335 Ga0501042_0027504 3300049578 Bacteria 3999
336 Ga0501042_0274018 3300049578 Bacteria 1218
337 Ga0501043_0016867 3300049579 Bacteria 5725
338 Ga0501043_0127760 3300049579 Bacteria 1993
339 Ga0501043_0232916 3300049579 Unclassified 1422
340 Ga0501046_0004457 3300049580 Bacteria 12702
341 Ga0501046_0009354 3300049580 Bacteria 8475
342 Ga0501046_0017984 3300049580 Bacteria 5891
343 Ga0501046_0757148 3300049580 Bacteria 682
344 Ga0501047_0015599 3300049581 Bacteria 7240
345 Ga0501048_0002992 3300049582 Bacteria 12902
346 Ga0501048_0009610 3300049582 Bacteria 7256
347 Ga0501048_0068148 3300049582 Bacteria 2514
348 Ga0501048_0685919 3300049582 Bacteria 735
349 Ga0501067_0054903 3300049583 Bacteria 2207
350 Ga0501067_0067411 3300049583 Bacteria 1981
351 Ga0501068_0023951 3300049584 Bacteria 3581
352 Ga0501068_0080985 3300049584 Bacteria 1993
353 Ga0501069_0006914 3300049585 Bacteria 5930
354 Ga0501069_0138373 3300049585 Bacteria 1396
355 Ga0501069_0177043 3300049585 Unclassified 1232
356 Ga0501069_0775778 3300049585 Unclassified 580
357 Ga0501070_0030147 3300049586 Bacteria 4546
358 Ga0501070_0199807 3300049586 Unclassified 1642
359 Ga0501070_0242205 3300049586 Bacteria 1476
360 Ga0501071_0014547 3300049587 Bacteria 5383
361 Ga0501071_0160581 3300049587 Unclassified 1679
362 Ga0501071_0297271 3300049587 Bacteria 1223
363 Ga0501071_0453801 3300049587 Bacteria 981
364 Ga0501071_0668486 3300049587 Unclassified 799
365 Ga0501071_0846353 3300049587 Bacteria 705
366 Ga0501072_0000465 3300049588 Bacteria 29220
367 Ga0501072_0004492 3300049588 Bacteria 10600
368 Ga0501072_0171731 3300049588 Bacteria 1730
369 Ga0501072_0174397 3300049588 Bacteria 1715
370 Ga0501073_0667871 3300049589 Unclassified 717
371 Ga0501074_0002129 3300049590 Bacteria 13684
372 Ga0501074_0085494 3300049590 Bacteria 2260
373 Ga0501074_0150453 3300049590 Bacteria 1664
374 Ga0501074_0373283 3300049590 Bacteria 1012
375 Ga0501075_0006016 3300049591 Bacteria 8316
376 Ga0501075_0059857 3300049591 Bacteria 2870
377 Ga0501075_0061164 3300049591 Bacteria 2837
378 Ga0501075_0241382 3300049591 Bacteria 1377
379 Ga0501075_0267946 3300049591 Bacteria 1302
380 Ga0501075_0937040 3300049591 Bacteria 658
381 Ga0501076_0000195 3300049592 Bacteria 36390
382 Ga0501076_0029964 3300049592 Bacteria 4236
383 Ga0501076_0037186 3300049592 Bacteria 3816
384 Ga0501076_0215055 3300049592 Bacteria 1571
385 Ga0501077_0063174 3300049593 Bacteria 2349
386 Ga0501077_0343311 3300049593 Unclassified 952
387 Ga0501077_0729657 3300049593 Unclassified 637
388 Ga0501202_043046 3300049652 Bacteria 981
389 Ga0501216_079390 3300049660 Bacteria 692
390 Ga0501079_0004199 3300049741 Bacteria 10677
391 Ga0501079_0011634 3300049741 Bacteria 6719
392 Ga0501079_0515785 3300049741 Bacteria 940
393 Ga0501080_1688354 3300049742 Unclassified 534
394 Ga0501081_0008744 3300049743 Bacteria 6582
395 Ga0501081_0072327 3300049743 Bacteria 2404
396 Ga0501081_0186211 3300049743 Bacteria 1502
397 Ga0501083_0004814 3300049744 Bacteria 9542
398 Ga0501083_0035018 3300049744 Bacteria 3431
399 Ga0501083_0779554 3300049744 Unclassified 622
400 Ga0501035_0020439 3300049822 Bacteria 6080
401 Ga0501035_0151862 3300049822 Bacteria 2009
402 Ga0501035_0396135 3300049822 Unclassified 1149
403 Ga0501035_0731792 3300049822 Bacteria 795
404 Ga0501044_0209374 3300049823 Bacteria 1905
405 Ga0501044_0387674 3300049823 Bacteria 1311
406 Ga0501045_0000251 3300049824 Bacteria 30848
407 Ga0501045_0008068 3300049824 Bacteria 7335
408 Ga0501045_0015697 3300049824 Bacteria 5373
409 Ga0501045_0027310 3300049824 Bacteria 4112
410 Ga0501045_0205329 3300049824 Bacteria 1468
411 Ga0501204_111966 3300049850 Bacteria 500
412 Ga0501212_085192 3300049851 Bacteria 577
413 nmdc:mga00v17_154644_c1 3300050491 Unclassified 1474
414 nmdc:mga0qj67_394348_c1 3300050509 Unclassified 1117
415 nmdc:mga06r32_511009_c1 3300050510 Bacteria 1178
416 Ga0495612_0019228 3300053078 Bacteria 2736
417 Ga0495595_0087886 3300053084 Bacteria 1488
418 Ga0495619_0001873 3300053085 Bacteria 14008
419 Ga0501084_0001614 3300054114 Bacteria 17884
420 Ga0501084_0002592 3300054114 Bacteria 14567
421 Ga0501084_0092537 3300054114 Bacteria 2538
422 Ga0501084_1410148 3300054114 Bacteria 583
423 Ga0501082_0002033 3300060353 Bacteria 17790
424 Ga0501082_0003094 3300060353 Bacteria 14505
425 Ga0501082_0003917 3300060353 Bacteria 12992
426 Ga0501082_0114319 3300060353 Bacteria 2337
427 Ga0501082_0345590 3300060353 Bacteria 1296
428 Ga0530510_0003695 3300061734 Bacteria 10526
429 Ga0530510_0035271 3300061734 Bacteria 3605
430 Ga0530510_0042354 3300061734 Bacteria 3289
431 Ga0501067_0057533
432 Ga0065712_10316031
433 Ga0065715_10649247
434 Ga0070683_100885678
435 Ga0070670_101994285
436 Ga0068868_101298975
437 Ga0070660_100707304
438 Ga0070668_100793673
439 Ga0070668_101245058
440 Ga0070675_100175666
441 Ga0070671_101099320
442 Ga0070671_101702427
443 Ga0070674_100043865
444 Ga0070674_100933321
445 Ga0070673_100632726
446 Ga0070659_101275017
447 Ga0070667_101644151
448 Ga0070701_10309443
449 Ga0070701_10781120
450 Ga0070711_100169278
451 Ga0070700_100462534
452 Ga0070678_100376329
453 Ga0070662_100808851
454 Ga0070662_100865365
455 Ga0070662_100976200
456 Ga0070679_101832749
457 Ga0070684_101538631
458 Ga0068853_102334838
459 Ga0070672_100077881
460 Ga0070672_100296845
461 Ga0070704_100608537
462 Ga0068856_100795159
463 Ga0070702_101189135
464 Ga0068852_101084472
465 Ga0068866_10287704
466 Ga0068866_10406234
467 Ga0068861_100579405
468 Ga0068861_101966539
469 Ga0068863_100984587
470 Ga0068863_101502267
471 Ga0068860_101129756
472 Ga0068862_101512420
473 Ga0068862_101993441
474 Ga0081455_10075590
475 Ga0081455_10641867
476 Ga0081538_10343021
477 Ga0081540_1000408
478 Ga0081539_10018037
479 Ga0081539_10030087
480 Ga0097621_100471164
481 Ga0068871_100062028
482 Ga0075430_100709622
483 Ga0068865_100297236
484 Ga0111539_11000281
485 Ga0111539_12080348
486 Ga0105245_11031641
487 Ga0105245_11642671
488 Ga0105243_10392729
489 Ga0105243_10757706
490 Ga0105243_10812489
491 Ga0105242_10412211
492 Ga0105248_10290786
493 Ga0105248_12866808
494 Ga0105238_12970734
495 Ga0105249_10279121
496 Ga0105249_11674357
497 Ga0105239_11096667
498 Ga0157316_1044981
499 Ga0157371_11664398
500 Ga0157370_11907983
501 Ga0157374_12117249
502 Ga0163162_10099840
503 Ga0163162_12870418
504 Ga0157372_12183419
505 Ga0157375_10045857
506 Ga0157375_11159245
507 Ga0157375_12036556
508 Ga0157375_12386005
509 Ga0157375_12954762
510 Ga0163163_10641457
511 Ga0157380_11097663
512 Ga0157380_11510851
513 Ga0157380_11560985
514 Ga0157377_11029899
515 Ga0163161_10015740
516 Ga0207663_10390601
517 Ga0207657_10472769
518 Ga0207659_10042996
519 Ga0207687_10100752
520 Ga0207687_10727625
521 Ga0207644_10108346
522 Ga0207706_10513786
523 Ga0207706_10818076
524 Ga0207706_10825114
525 Ga0207706_10874245
526 Ga0207706_11414800
527 Ga0207709_11047462
528 Ga0207670_10759593
529 Ga0207669_10237130
530 Ga0207669_10627767
531 Ga0207704_10497967
532 Ga0207691_10037780
533 Ga0207691_10234586
534 Ga0207691_10302529
535 Ga0207661_11112682
536 Ga0207661_12110209
537 Ga0207651_10095567
538 Ga0207712_10327007
539 Ga0207668_10362552
540 Ga0207668_11414545
541 Ga0207668_11697121
542 Ga0207668_11814060
543 Ga0207640_10811023
544 Ga0207658_10955348
545 Ga0207677_10073987
546 Ga0207677_10180795
547 Ga0207678_10569922
548 Ga0207708_10267357
549 Ga0207708_10647493
550 Ga0207702_10359806
551 Ga0207702_10606829
552 Ga0207702_11514850
553 Ga0207641_10974871
554 Ga0207641_11006427
555 Ga0207675_100183139
556 Ga0207675_100935000
557 Ga0207675_101148412
558 Ga0207675_101893966
559 Ga0207683_10574375
560 Ga0207683_10796855
561 Ga0209983_1020387
562 Ga0209971_1008771
563 Ga0209974_10010057
564 Ga0268265_10616876
565 Ga0268265_11544372
566 Ga0268265_11739834
567 Ga0268264_11477972
568 Ga0268264_12072036
569 Ga0307408_100013315
570 Ga0307408_100182917
571 Ga0307405_10174590
572 Ga0307405_10452528
573 Ga0307405_11911915
574 Ga0307413_10130929
575 Ga0307413_11335520
576 Ga0307410_10015410
577 Ga0307410_10026754
578 Ga0307410_10036771
579 Ga0307410_10475101
580 Ga0307406_10038653
581 Ga0307406_10038915
582 Ga0307406_10567567
583 Ga0307406_11276803
584 Ga0307407_10037453
585 Ga0307407_10091747
586 Ga0307407_10223175
587 Ga0307407_10475535
588 Ga0307407_10665132
589 Ga0307412_10113011
590 Ga0307412_10190699
591 Ga0307409_100024308
592 Ga0307409_100130805
593 Ga0307409_100148974
594 Ga0307409_100427416
595 Ga0307409_101226754
596 Ga0307416_100038665
597 Ga0307416_100064334
598 Ga0307416_100068664
599 Ga0307416_100469710
600 Ga0307416_103090349
601 Ga0307414_10141656
602 Ga0307414_11989997
603 Ga0307411_10423523
604 Ga0307415_100028679
605 Ga0307415_100036597
606 Ga0307415_100067212
607 Ga0307415_100109509
608 Ga0307415_100269785
609 Ga0307415_102223719
610 Ga0307507_10242751
611 Ga0373934_0013221
612 Ga0373923_0124405
613 Ga0373936_0004817
614 Ga0373953_0006116
615 Ga0373956_0112395
616 Ga0373957_0001085
617 Ga0373943_0543213
618 Ga0373946_0143436
619 Ga0373955_0005311
620 Ga0373924_0008377
621 Ga0373935_0015204
622 Ga0373933_0008236
623 Ga0373947_0479355
624 Ga0373937_0062528
625 Ga0373925_0061088
626 Ga0373925_0091602
627 Ga0395899_0062845
628 Ga0395900_0002076
629 Ga0395900_0126619
630 Ga0395898_0019920
631 Ga0395898_0959906
632 Ga0395905_0007606
633 Ga0395905_0734210
634 Ga0395901_0037217
635 Ga0395901_0087444
636 Ga0395901_0348722
637 Ga0395901_0770095
638 Ga0439438_104500
639 Ga0439461_0008467
640 Ga0439465_0201338
641 Ga0451807_2388984
642 Ga0439431_0012029
643 Ga0439432_011074
644 Ga0439457_011516
645 Ga0439462_0001377
646 Ga0439446_0010975
647 Ga0439446_0033676
648 Ga0439434_0014406
649 Ga0466965_0618055
650 Ga0466964_0381296
651 Ga0466960_0050345
652 Ga0466960_0174942
653 Ga0466960_0417970
654 Ga0466960_0880636
655 Ga0466967_0009553
656 Ga0466967_2609994
657 Ga0495627_226804
658 Ga0495592_0307044
659 Ga0495590_0212664
660 Ga0495629_0005346
661 Ga0495641_0427265
662 Ga0495651_0037021
663 Ga0495653_0061389
664 Ga0495582_0039140
665 Ga0495582_0222296
666 Ga0495662_0009955
667 Ga0495664_0183702
668 Ga0495584_0183629
669 Ga0495584_0342919
670 Ga0495585_0169160
671 Ga0495608_0011051
672 Ga0495618_0008633
673 Ga0495628_0591132
674 Ga0495630_0028363
675 Ga0495644_0066316
676 Ga0495644_0098319
677 Ga0495666_0200730
678 Ga0495652_0065148
679 Ga0495665_0005938
680 Ga0495640_0129837
681 Ga0495586_0021765
682 Ga0495587_0010491
683 Ga0495645_0272112
684 Ga0495667_0022639
685 Ga0495656_0131693
686 Ga0495656_0184257
687 Ga0495634_0189278
688 Ga0495635_0022056
689 Ga0495657_0079437
690 Ga0495599_0090827
691 Ga0495623_0024711
692 Ga0495646_0110768
693 Ga0495658_0130242
694 Ga0495658_0200122
695 Ga0495613_0011101
696 Ga0495624_0023626
697 Ga0495589_0285399
698 Ga0495600_0032405
699 Ga0495581_0050416
700 Ga0495581_0095876
701 Ga0495604_0039546
702 Ga0495674_0153130
703 Ga0495680_0005436
704 Ga0495675_0005200
705 Ga0495684_0177110
706 Ga0495593_0007726
707 Ga0495602_0185045
708 Ga0495614_0203708
709 Ga0495626_0275956
710 Ga0496100_0005112
711 Ga0496100_0315685
712 Ga0496101_0495349
713 Ga0496101_1153748
714 Ga0496102_0013248
715 Ga0496102_0405618
716 Ga0496104_0014704
717 Ga0496105_0026023
718 Ga0496106_0040097
719 Ga0496107_0012489
720 Ga0496107_0110532
721 Ga0496107_0206400
722 Ga0496108_0005751
723 Ga0496109_0000470
724 Ga0496109_0223462
725 Ga0496110_0010597
726 Ga0496110_0012265
727 Ga0496110_0495597
728 Ga0496111_0055354
729 Ga0496111_0171419
730 Ga0496111_0285764
731 Ga0496112_0253796
732 Ga0496113_0007031
733 Ga0496113_0417106
734 Ga0496113_0585274
735 Ga0496114_0032249
736 Ga0496114_0212313
737 Ga0501031_0001029
738 Ga0501031_0021796
739 Ga0501031_0028554
740 Ga0501031_0201263
741 Ga0501031_0412779
742 Ga0501032_0010586
743 Ga0501033_0184618
744 Ga0501034_0018102
745 Ga0501036_0009848
746 Ga0501036_0076156
747 Ga0501036_0084118
748 Ga0501036_0121858
749 Ga0501036_0236635
750 Ga0501036_0446162
751 Ga0501037_0325712
752 Ga0501038_0003169
753 Ga0501038_0033268
754 Ga0501038_0086410
755 Ga0501038_0613993
756 Ga0501039_0018802
757 Ga0501039_0018960
758 Ga0501040_0000149
759 Ga0501040_0004339
760 Ga0501040_0108202
761 Ga0501040_0147755
762 Ga0501041_0010176
763 Ga0501041_0024785
764 Ga0501041_0329838
765 Ga0501042_0027504
766 Ga0501042_0274018
767 Ga0501043_0016867
768 Ga0501043_0127760
769 Ga0501043_0232916
770 Ga0501046_0004457
771 Ga0501046_0009354
772 Ga0501046_0017984
773 Ga0501046_0757148
774 Ga0501047_0015599
775 Ga0501048_0002992
776 Ga0501048_0009610
777 Ga0501048_0068148
778 Ga0501048_0685919
779 Ga0501067_0054903
780 Ga0501067_0067411
781 Ga0501068_0023951
782 Ga0501068_0080985
783 Ga0501069_0006914
784 Ga0501069_0138373
785 Ga0501069_0177043
786 Ga0501069_0775778
787 Ga0501070_0030147
788 Ga0501070_0199807
789 Ga0501070_0242205
790 Ga0501071_0014547
791 Ga0501071_0160581
792 Ga0501071_0297271
793 Ga0501071_0453801
794 Ga0501071_0668486
795 Ga0501071_0846353
796 Ga0501072_0000465
797 Ga0501072_0004492
798 Ga0501072_0171731
799 Ga0501072_0174397
800 Ga0501073_0667871
801 Ga0501074_0002129
802 Ga0501074_0085494
803 Ga0501074_0150453
804 Ga0501074_0373283
805 Ga0501075_0006016
806 Ga0501075_0059857
807 Ga0501075_0061164
808 Ga0501075_0241382
809 Ga0501075_0267946
810 Ga0501075_0937040
811 Ga0501076_0000195
812 Ga0501076_0029964
813 Ga0501076_0037186
814 Ga0501076_0215055
815 Ga0501077_0063174
816 Ga0501077_0343311
817 Ga0501077_0729657
818 Ga0501202_043046
819 Ga0501216_079390
820 Ga0501079_0004199
821 Ga0501079_0011634
822 Ga0501079_0515785
823 Ga0501080_1688354
824 Ga0501081_0008744
825 Ga0501081_0072327
826 Ga0501081_0186211
827 Ga0501083_0004814
828 Ga0501083_0035018
829 Ga0501083_0779554
830 Ga0501035_0020439
831 Ga0501035_0151862
832 Ga0501035_0396135
833 Ga0501035_0731792
834 Ga0501044_0209374
835 Ga0501044_0387674
836 Ga0501045_0000251
837 Ga0501045_0008068
838 Ga0501045_0015697
839 Ga0501045_0027310
840 Ga0501045_0205329
841 Ga0501204_111966
842 Ga0501212_085192
843 nmdc:mga00v17_154644_c1
844 nmdc:mga0qj67_394348_c1
845 nmdc:mga06r32_511009_c1
846 Ga0495612_0019228
847 Ga0495595_0087886
848 Ga0495619_0001873
849 Ga0501084_0001614
850 Ga0501084_0002592
851 Ga0501084_0092537
852 Ga0501084_1410148
853 Ga0501082_0002033
854 Ga0501082_0003094
855 Ga0501082_0003917
856 Ga0501082_0114319
857 Ga0501082_0345590
858 Ga0530510_0003695
859 Ga0530510_0035271
860 Ga0530510_0042354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00708

Acylphosphatase

Acylphosphatase

12

95

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w4d-assembly1.cif.gz_B acylphosphatase variant g91a from pyrococcus horikoshii 0.9765 1 90
3tnv-assembly1.cif.gz_A acylphosphatase with thermophilic surface and mesophilic core 0.9756 1 90
4ojh-assembly2.cif.gz_B the crystal structure of truncated, y86e mutant of s. solfataricus acylphosphatase 0.9721 1 89
8jfs-assembly2.cif.gz_B phosphate bound acylphosphatase from deinococcus radiodurans at 1 angstrom resolution 0.9699 3 89
1v3z-assembly1.cif.gz_B crystal structure of acylphosphatase from pyrococcus horikoshii 0.9681 1 90
ID Description Score Start End Superfamily
af_K7LZQ3_146_256_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9834 1 89 3.30.70.100
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9756 1 90 3.30.70.100
af_C0PM37_2_111_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9741 2 89 3.30.70.100
af_Q4D7T9_41_155_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9652 2 90 3.30.70.100
af_K7LZQ3_146_256_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.962 1 89 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1W1XYD5-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.003 2 89 GO:0003998
AF-A0A4U0PER1-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.001 3 89 GO:0003998
AF-A0A1I1FMR1-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.001 3 89 GO:0003998
AF-A0A1I4X7H3-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.001 3 89 GO:0003998
AF-A0A350JF37-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.001 1 90 GO:0003998

Map