F442199

General Info

Members Datasets Scaffolds Average Seq Length
430 231 860 263

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0010228|Ga0466969_0010228_1596_2357
Length 253
Sequence MDSDNKRDNVIEVVNVSKAFGGLQALEHCSLNIPVGSITGLIGPNGSGKTTLFNAITGYERIDTGDILFQGKSIAKAKPEQIFRAGIGRTFQLTRIFPKLTVLENMHVAVQRHGRGGLFRSWSAAHEQRKALELLEFVGIVKHKDLLAGNLSYGQRKLLEFAFILIADPQIILLDEPAGGVNPTMIQYLADRIRTLHQQGLTFLIVEHNMEFVMSLCQQVAVMHRGSIIAQGTAEEVRSNPAVLDAYLGEGIQ

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.02
Nodule 0
Rhizoplane 5.58
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0010228 3300044656 Unclassified 4972
2 Ga0070658_10005337 3300005327 Bacteria 10434
3 Ga0070683_100001328 3300005329 Bacteria 18830
4 Ga0070683_100139076 3300005329 Bacteria 2300
5 Ga0070690_100097314 3300005330 Bacteria 1946
6 Ga0068869_100105090 3300005334 Bacteria 2141
7 Ga0070680_100001224 3300005336 Bacteria 18477
8 Ga0070680_100012193 3300005336 Bacteria 6677
9 Ga0070680_100456997 3300005336 Bacteria 1091
10 Ga0070682_100565715 3300005337 Bacteria 892
11 Ga0068868_100154470 3300005338 Bacteria 1892
12 Ga0070660_100048680 3300005339 Bacteria 3255
13 Ga0070691_10007087 3300005341 Bacteria 5140
14 Ga0070691_10012923 3300005341 Bacteria 3823
15 Ga0070691_10014864 3300005341 Bacteria 3574
16 Ga0070661_100007874 3300005344 Bacteria 7357
17 Ga0070661_100235214 3300005344 Bacteria 1409
18 Ga0070692_10004159 3300005345 Bacteria 5995
19 Ga0070669_100213141 3300005353 Bacteria 1525
20 Ga0070659_100069057 3300005366 Bacteria 2804
21 Ga0070659_100171675 3300005366 Bacteria 1776
22 Ga0070659_100225683 3300005366 Bacteria 1547
23 Ga0070703_10001503 3300005406 Bacteria 6983
24 Ga0070709_10104990 3300005434 Bacteria 1889
25 Ga0070709_10179096 3300005434 Bacteria 1487
26 Ga0070714_100128915 3300005435 Bacteria 2259
27 Ga0070713_100019457 3300005436 Bacteria 5185
28 Ga0070710_10209962 3300005437 Bacteria 1234
29 Ga0070710_10369429 3300005437 Unclassified 954
30 Ga0070705_100000049 3300005440 Bacteria 61456
31 Ga0070700_100003879 3300005441 Bacteria 7765
32 Ga0070700_100014960 3300005441 Bacteria 4389
33 Ga0070700_100169450 3300005441 Bacteria 1511
34 Ga0070694_100018166 3300005444 Bacteria 4460
35 Ga0070694_100024267 3300005444 Bacteria 3913
36 Ga0070708_100001156 3300005445 Bacteria 20300
37 Ga0070708_100001590 3300005445 Bacteria 17399
38 Ga0070708_100017116 3300005445 Bacteria 6037
39 Ga0070708_100042566 3300005445 Bacteria 3987
40 Ga0070708_100122335 3300005445 Bacteria 2402
41 Ga0070663_100007554 3300005455 Bacteria 6625
42 Ga0070662_100056437 3300005457 Bacteria 2851
43 Ga0070662_100291709 3300005457 Bacteria 1323
44 Ga0070681_10007217 3300005458 Bacteria 10839
45 Ga0070706_100011319 3300005467 Bacteria 8290
46 Ga0070706_100031945 3300005467 Bacteria 4854
47 Ga0070706_100065523 3300005467 Bacteria 3360
48 Ga0070706_100073520 3300005467 Bacteria 3164
49 Ga0070706_100893205 3300005467 Bacteria 821
50 Ga0070707_100003435 3300005468 Bacteria 14975
51 Ga0070707_100046246 3300005468 Bacteria 4165
52 Ga0070707_100073958 3300005468 Bacteria 3285
53 Ga0070707_100458624 3300005468 Bacteria 1235
54 Ga0070698_100004357 3300005471 Bacteria 15558
55 Ga0070698_100012623 3300005471 Bacteria 8944
56 Ga0070698_100029580 3300005471 Bacteria 5688
57 Ga0070699_100000208 3300005518 Bacteria 57911
58 Ga0070699_100004254 3300005518 Bacteria 12660
59 Ga0070699_100010186 3300005518 Bacteria 8132
60 Ga0070699_100541237 3300005518 Bacteria 1059
61 Ga0070679_100060801 3300005530 Bacteria 3765
62 Ga0070679_100400213 3300005530 Bacteria 1319
63 Ga0070684_100001025 3300005535 Bacteria 19928
64 Ga0070684_100014358 3300005535 Bacteria 6412
65 Ga0070684_100108910 3300005535 Bacteria 2482
66 Ga0070697_100008994 3300005536 Bacteria 7804
67 Ga0070697_100021005 3300005536 Bacteria 5168
68 Ga0070697_100058973 3300005536 Bacteria 3124
69 Ga0070697_100112005 3300005536 Bacteria 2275
70 Ga0070697_100397733 3300005536 Bacteria 1195
71 Ga0068853_100062239 3300005539 Bacteria 3228
72 Ga0070695_100000921 3300005545 Bacteria 15836
73 Ga0070695_100002413 3300005545 Bacteria 10737
74 Ga0070696_100000380 3300005546 Bacteria 27162
75 Ga0070665_100040213 3300005548 Bacteria 4700
76 Ga0070704_100000726 3300005549 Bacteria 16115
77 Ga0068855_100027868 3300005563 Bacteria 6757
78 Ga0070664_100012433 3300005564 Bacteria 6918
79 Ga0070664_100038317 3300005564 Bacteria 4034
80 Ga0068857_100000247 3300005577 Bacteria 36125
81 Ga0068857_100025844 3300005577 Bacteria 5171
82 Ga0068857_100179052 3300005577 Bacteria 1929
83 Ga0068857_100483978 3300005577 Bacteria 1160
84 Ga0068856_100000392 3300005614 Bacteria 47868
85 Ga0068856_100014284 3300005614 Bacteria 7679
86 Ga0068856_100076437 3300005614 Bacteria 3318
87 Ga0068856_100613259 3300005614 Bacteria 1109
88 Ga0068852_100220749 3300005616 Bacteria 1802
89 Ga0068859_100004962 3300005617 Bacteria 13515
90 Ga0068864_100055899 3300005618 Bacteria 3409
91 Ga0068861_100124071 3300005719 Bacteria 2087
92 Ga0068861_100127337 3300005719 Bacteria 2062
93 Ga0068870_10100020 3300005840 Bacteria 1637
94 Ga0068858_100157807 3300005842 Bacteria 2135
95 Ga0068858_100305220 3300005842 Bacteria 1519
96 Ga0068860_100001868 3300005843 Bacteria 22381
97 Ga0068860_100444825 3300005843 Bacteria 1288
98 Ga0068862_100001305 3300005844 Bacteria 23208
99 Ga0081455_10000116 3300005937 Bacteria 91321
100 Ga0081455_10002613 3300005937 Bacteria 21347
101 Ga0081455_10003249 3300005937 Bacteria 18825
102 Ga0081455_10189525 3300005937 Bacteria 1550
103 Ga0081538_10020486 3300005981 Bacteria 4862
104 Ga0081539_10001321 3300005985 Bacteria 43278
105 Ga0081539_10030625 3300005985 Bacteria 3335
106 Ga0070717_10006308 3300006028 Bacteria 8710
107 Ga0075365_10004553 3300006038 Bacteria 7365
108 Ga0075365_10016065 3300006038 Bacteria 4542
109 Ga0075365_10141228 3300006038 Bacteria 1672
110 Ga0075368_10011209 3300006042 Bacteria 3257
111 Ga0075368_10017931 3300006042 Bacteria 2655
112 Ga0075363_100006608 3300006048 Bacteria 5284
113 Ga0075363_100007871 3300006048 Bacteria 4932
114 Ga0075363_100103035 3300006048 Bacteria 1581
115 Ga0075364_10000914 3300006051 Bacteria 15591
116 Ga0070712_100449202 3300006175 Bacteria 1073
117 Ga0075362_10006100 3300006177 Bacteria 4465
118 Ga0075362_10165349 3300006177 Bacteria 1067
119 Ga0075367_10000177 3300006178 Bacteria 20664
120 Ga0075367_10036673 3300006178 Bacteria 2845
121 Ga0075367_10089993 3300006178 Bacteria 1866
122 Ga0075367_10096862 3300006178 Bacteria 1799
123 Ga0075369_10042285 3300006186 Bacteria 1953
124 Ga0075369_10050963 3300006186 Bacteria 1791
125 Ga0075366_10018352 3300006195 Bacteria 4038
126 Ga0075366_10086048 3300006195 Bacteria 1881
127 Ga0075366_10120155 3300006195 Bacteria 1583
128 Ga0075428_100000390 3300006844 Bacteria 43360
129 Ga0075428_100143023 3300006844 Bacteria 2600
130 Ga0075428_100357906 3300006844 Bacteria 1566
131 Ga0075428_100380829 3300006844 Bacteria 1512
132 Ga0075430_100002184 3300006846 Bacteria 16204
133 Ga0075430_100018097 3300006846 Bacteria 5996
134 Ga0075430_100085028 3300006846 Bacteria 2649
135 Ga0075431_100000003 3300006847 Bacteria 112884
136 Ga0075431_100002097 3300006847 Bacteria 19055
137 Ga0075431_100002153 3300006847 Bacteria 18838
138 Ga0075431_100016517 3300006847 Bacteria 7492
139 Ga0075433_10162705 3300006852 Bacteria 1986
140 Ga0075434_100011790 3300006871 Bacteria 8259
141 Ga0075429_100001974 3300006880 Bacteria 17065
142 Ga0075436_100287137 3300006914 Bacteria 1177
143 Ga0097620_100004962 3300006931 Bacteria 13515
144 Ga0097620_100216319 3300006931 Bacteria 2003
145 Ga0075435_100020145 3300007076 Bacteria 5104
146 Ga0099794_10198329 3300007265 Bacteria 1027
147 Ga0099795_10031218 3300007788 Bacteria 1833
148 Ga0105240_10071776 3300009093 Bacteria 4281
149 Ga0105240_10108697 3300009093 Bacteria 3359
150 Ga0111539_10004664 3300009094 Bacteria 17916
151 Ga0111539_10006444 3300009094 Bacteria 15127
152 Ga0111539_10043217 3300009094 Bacteria 5403
153 Ga0111539_10665077 3300009094 Bacteria 1213
154 Ga0114129_10000104 3300009147 Bacteria 83195
155 Ga0114129_10007502 3300009147 Bacteria 15534
156 Ga0114129_10099199 3300009147 Bacteria 4031
157 Ga0114129_10152118 3300009147 Bacteria 3166
158 Ga0105248_10275023 3300009177 Bacteria 1896
159 Ga0105237_10024871 3300009545 Bacteria 6126
160 Ga0105237_10048541 3300009545 Bacteria 4267
161 Ga0105237_10142763 3300009545 Bacteria 2389
162 Ga0105238_10163011 3300009551 Bacteria 2205
163 Ga0105238_10273798 3300009551 Bacteria 1669
164 Ga0105249_10002579 3300009553 Bacteria 15685
165 Ga0105246_10068207 3300011119 Bacteria 2494
166 Ga0157370_10020835 3300013104 Bacteria 6542
167 Ga0157370_10146595 3300013104 Bacteria 2198
168 Ga0157369_10001540 3300013105 Bacteria 28240
169 Ga0157369_10024199 3300013105 Bacteria 6759
170 Ga0157369_10112291 3300013105 Unclassified 2895
171 Ga0157378_10155194 3300013297 Bacteria 2136
172 Ga0163162_10470573 3300013306 Bacteria 1388
173 Ga0157372_10100266 3300013307 Bacteria 3305
174 Ga0157372_10464414 3300013307 Bacteria 1475
175 Ga0157375_10125664 3300013308 Bacteria 2679
176 Ga0157379_10101271 3300014968 Bacteria 2585
177 Ga0157379_10249202 3300014968 Bacteria 1612
178 Ga0157376_11031461 3300014969 Bacteria 846
179 Ga0213874_10006304 3300021377 Bacteria 2806
180 Ga0213876_10016382 3300021384 Bacteria 3918
181 Ga0213871_10002282 3300021441 Bacteria 3500
182 Ga0207426_1021371 3300025302 Bacteria 2238
183 Ga0207653_10001724 3300025885 Bacteria 6986
184 Ga0207692_10247004 3300025898 Bacteria 1068
185 Ga0207647_10079081 3300025904 Bacteria 1974
186 Ga0207699_10075555 3300025906 Bacteria 2073
187 Ga0207643_10167337 3300025908 Bacteria 1325
188 Ga0207705_10158348 3300025909 Bacteria 1700
189 Ga0207705_10199017 3300025909 Bacteria 1518
190 Ga0207684_10007938 3300025910 Bacteria 9483
191 Ga0207684_10017993 3300025910 Bacteria 6057
192 Ga0207684_10018998 3300025910 Bacteria 5880
193 Ga0207684_10137463 3300025910 Bacteria 2099
194 Ga0207707_10023115 3300025912 Bacteria 5440
195 Ga0207707_10067958 3300025912 Bacteria 3105
196 Ga0207695_10111420 3300025913 Bacteria 2716
197 Ga0207671_10017855 3300025914 Bacteria 5458
198 Ga0207671_10118927 3300025914 Bacteria 2018
199 Ga0207660_10023603 3300025917 Bacteria 4156
200 Ga0207660_10026810 3300025917 Bacteria 3927
201 Ga0207657_10120493 3300025919 Bacteria 2159
202 Ga0207657_10162800 3300025919 Bacteria 1811
203 Ga0207649_10113915 3300025920 Bacteria 1812
204 Ga0207652_10005702 3300025921 Bacteria 10108
205 Ga0207652_10035233 3300025921 Bacteria 4223
206 Ga0207652_10327504 3300025921 Bacteria 1383
207 Ga0207646_10000962 3300025922 Bacteria 37134
208 Ga0207646_10009368 3300025922 Bacteria 9678
209 Ga0207646_10274214 3300025922 Bacteria 1525
210 Ga0207694_10123436 3300025924 Bacteria 2069
211 Ga0207694_10232977 3300025924 Bacteria 1504
212 Ga0207694_10514400 3300025924 Bacteria 1003
213 Ga0207659_10044710 3300025926 Bacteria 3117
214 Ga0207700_10001444 3300025928 Bacteria 13490
215 Ga0207664_10321457 3300025929 Bacteria 1365
216 Ga0207706_10064687 3300025933 Bacteria 3220
217 Ga0207709_10079164 3300025935 Bacteria 2112
218 Ga0207665_10169719 3300025939 Bacteria 1575
219 Ga0207691_10138113 3300025940 Bacteria 2149
220 Ga0207689_10091274 3300025942 Bacteria 2503
221 Ga0207661_10000102 3300025944 Bacteria 54330
222 Ga0207679_10021980 3300025945 Bacteria 4337
223 Ga0207667_10054735 3300025949 Bacteria 4196
224 Ga0207667_10841946 3300025949 Unclassified 912
225 Ga0207668_10157219 3300025972 Bacteria 1767
226 Ga0207677_10092220 3300026023 Bacteria 2205
227 Ga0207677_10357406 3300026023 Bacteria 1226
228 Ga0207703_10078040 3300026035 Bacteria 2751
229 Ga0207678_10007748 3300026067 Bacteria 9488
230 Ga0207678_10096949 3300026067 Bacteria 2520
231 Ga0207708_10000469 3300026075 Bacteria 31148
232 Ga0207708_10160118 3300026075 Bacteria 1777
233 Ga0207702_10002513 3300026078 Bacteria 17301
234 Ga0207676_10011388 3300026095 Bacteria 6357
235 Ga0207674_10000194 3300026116 Bacteria 75212
236 Ga0207674_10003556 3300026116 Bacteria 19017
237 Ga0207674_10181615 3300026116 Bacteria 2055
238 Ga0207675_100048940 3300026118 Bacteria 3946
239 Ga0207675_100077331 3300026118 Bacteria 3117
240 Ga0207675_100199185 3300026118 Bacteria 1923
241 Ga0207683_10031302 3300026121 Bacteria 4617
242 Ga0209813_10013668 3300027866 Bacteria 2172
243 Ga0209813_10015088 3300027866 Bacteria 2088
244 Ga0207428_10006148 3300027907 Bacteria 11089
245 Ga0207428_10006513 3300027907 Bacteria 10774
246 Ga0207428_10268998 3300027907 Bacteria 1267
247 Ga0268266_10007093 3300028379 Bacteria 10176
248 Ga0268265_10002635 3300028380 Bacteria 13323
249 Ga0268265_10233226 3300028380 Bacteria 1619
250 Ga0268264_10001571 3300028381 Bacteria 21185
251 Ga0268264_10051804 3300028381 Bacteria 3421
252 Ga0316575_10012111 3300031665 Bacteria 3202
253 Ga0307405_10209087 3300031731 Bacteria 1423
254 Ga0307416_100266010 3300032002 Bacteria 1680
255 Ga0373949_0033439 3300035090 Bacteria 1235
256 Ga0373955_0066713 3300035172 Bacteria 2001
257 Ga0373961_0005725 3300035241 Bacteria 2984
258 Ga0373962_0022023 3300035242 Bacteria 1686
259 Ga0373931_0002677 3300035691 Bacteria 7924
260 Ga0373931_0032406 3300035691 Bacteria 2704
261 Ga0373931_0148567 3300035691 Bacteria 1364
262 Ga0373931_0261987 3300035691 Bacteria 1055
263 Ga0373927_0104399 3300035695 Bacteria 1845
264 Ga0373933_0003174 3300035724 Bacteria 9179
265 Ga0373947_0331704 3300035725 Bacteria 1019
266 Ga0373937_0088742 3300036401 Bacteria 2863
267 Ga0373937_0089348 3300036401 Bacteria 2853
268 Ga0373925_0030090 3300037068 Bacteria 3984
269 Ga0373925_0122361 3300037068 Bacteria 2021
270 Ga0373925_0335120 3300037068 Bacteria 1226
271 Ga0395899_0002592 3300037312 Bacteria 14578
272 Ga0395899_0055145 3300037312 Bacteria 2940
273 Ga0395899_0262684 3300037312 Bacteria 1180
274 Ga0395900_0011790 3300037418 Bacteria 8939
275 Ga0395900_0013691 3300037418 Bacteria 8281
276 Ga0395900_0020265 3300037418 Bacteria 6786
277 Ga0395900_0162877 3300037418 Bacteria 2274
278 Ga0395900_0397000 3300037418 Bacteria 1344
279 Ga0395901_0000745 3300038443 Bacteria 36791
280 Ga0395901_0022080 3300038443 Bacteria 6521
281 Ga0395901_0143984 3300038443 Bacteria 2505
282 Ga0436365_0231247 3300039437 Bacteria 1086
283 Ga0436360_0487108 3300039438 Bacteria 2050
284 Ga0436360_0538251 3300039438 Bacteria 15887
285 Ga0436363_0389578 3300039450 Bacteria 3518
286 Ga0436362_0046425 3300039453 Bacteria 1285
287 Ga0439441_038508 3300042001 Bacteria 951
288 Ga0466966_0154122 3300044684 Bacteria 1400
289 Ga0466964_0084601 3300044706 Bacteria 1368
290 Ga0466957_0344735 3300044842 Bacteria 1009
291 Ga0466958_0061997 3300045836 Unclassified 2279
292 Ga0495584_0117091 3300046491 Bacteria 1349
293 Ga0495667_0069754 3300046559 Bacteria 2294
294 Ga0495668_0098933 3300046616 Bacteria 1596
295 Ga0495635_0012461 3300046663 Bacteria 5957
296 Ga0495674_0048255 3300047319 Bacteria 3769
297 Ga0495684_0173657 3300047471 Bacteria 1601
298 Ga0496102_0139179 3300048905 Bacteria 2275
299 Ga0496103_0358161 3300048906 Bacteria 938
300 Ga0496104_0002241 3300048907 Bacteria 16685
301 Ga0496104_0266255 3300048907 Bacteria 1626
302 Ga0496105_0117145 3300048908 Bacteria 2197
303 Ga0496105_0201196 3300048908 Bacteria 1626
304 Ga0496106_0006849 3300048909 Bacteria 8435
305 Ga0496106_0097779 3300048909 Bacteria 2273
306 Ga0496107_0005417 3300048910 Bacteria 8736
307 Ga0496107_0290452 3300048910 Bacteria 1217
308 Ga0496109_0072108 3300048912 Bacteria 3172
309 Ga0496109_0140846 3300048912 Bacteria 2255
310 Ga0496110_0070154 3300048913 Bacteria 3104
311 Ga0496110_0074121 3300048913 Bacteria 3022
312 Ga0496110_0206548 3300048913 Bacteria 1785
313 Ga0496111_0075132 3300048914 Bacteria 2462
314 Ga0496111_0207165 3300048914 Bacteria 1457
315 Ga0496112_0038703 3300048915 Bacteria 4658
316 Ga0496112_0049836 3300048915 Bacteria 4105
317 Ga0496113_0046435 3300048916 Bacteria 3224
318 Ga0496113_0091485 3300048916 Bacteria 2345
319 Ga0496114_0200419 3300048917 Bacteria 1748
320 Ga0496115_0030308 3300048918 Bacteria 4255
321 Ga0496115_0031883 3300048918 Bacteria 4155
322 Ga0496126_0076898 3300048929 Bacteria 2960
323 Ga0501031_0011239 3300049568 Bacteria 5834
324 Ga0501031_0051234 3300049568 Bacteria 2688
325 Ga0501032_0245226 3300049569 Bacteria 1163
326 Ga0501033_0218922 3300049570 Bacteria 1356
327 Ga0501034_0003233 3300049571 Bacteria 18655
328 Ga0501034_0012628 3300049571 Bacteria 8716
329 Ga0501034_0028678 3300049571 Bacteria 5663
330 Ga0501034_0030020 3300049571 Bacteria 5526
331 Ga0501034_0117103 3300049571 Bacteria 2652
332 Ga0501034_0211714 3300049571 Bacteria 1893
333 Ga0501034_0380081 3300049571 Bacteria 1337
334 Ga0501034_0383366 3300049571 Bacteria 1330
335 Ga0501036_0189505 3300049572 Bacteria 1731
336 Ga0501036_0215625 3300049572 Bacteria 1612
337 Ga0501036_0419111 3300049572 Bacteria 1116
338 Ga0501037_0027329 3300049573 Bacteria 4216
339 Ga0501038_0032446 3300049574 Bacteria 4608
340 Ga0501038_0091490 3300049574 Bacteria 2549
341 Ga0501038_0093298 3300049574 Unclassified 2519
342 Ga0501038_0391276 3300049574 Bacteria 1077
343 Ga0501039_0065242 3300049575 Bacteria 2824
344 Ga0501039_0066958 3300049575 Bacteria 2789
345 Ga0501040_0039690 3300049576 Bacteria 3202
346 Ga0501042_0104806 3300049578 Bacteria 2035
347 Ga0501043_0233815 3300049579 Bacteria 1419
348 Ga0501046_0064344 3300049580 Bacteria 2863
349 Ga0501046_0096543 3300049580 Bacteria 2270
350 Ga0501046_0203780 3300049580 Bacteria 1471
351 Ga0501047_0049903 3300049581 Bacteria 4040
352 Ga0501047_0183992 3300049581 Bacteria 1955
353 Ga0501047_0248217 3300049581 Unclassified 1629
354 Ga0501067_0129369 3300049583 Bacteria 1405
355 Ga0501068_0007726 3300049584 Bacteria 5951
356 Ga0501071_0285764 3300049587 Bacteria 1249
357 Ga0501072_0038403 3300049588 Bacteria 3758
358 Ga0501073_0237620 3300049589 Bacteria 1258
359 Ga0501073_0319656 3300049589 Bacteria 1071
360 Ga0501074_0163400 3300049590 Unclassified 1590
361 Ga0501075_0011758 3300049591 Bacteria 6206
362 Ga0501077_0052462 3300049593 Bacteria 2590
363 Ga0501077_0230676 3300049593 Bacteria 1177
364 Ga0501080_0238932 3300049742 Bacteria 1658
365 Ga0501080_0299492 3300049742 Bacteria 1459
366 Ga0501080_0330868 3300049742 Bacteria 1378
367 Ga0501081_0015805 3300049743 Bacteria 4982
368 Ga0501035_0036191 3300049822 Bacteria 4474
369 Ga0501035_0264262 3300049822 Bacteria 1458
370 Ga0501035_0340082 3300049822 Bacteria 1258
371 Ga0501044_0026672 3300049823 Bacteria 6115
372 Ga0501044_0045031 3300049823 Bacteria 4575
373 Ga0501045_0034175 3300049824 Bacteria 3690
374 nmdc:mga03683_178576_c1 3300050489 Bacteria 968
375 nmdc:mga03683_20819_c1 3300050489 Bacteria 2521
376 nmdc:mga03683_4525_c1 3300050489 Bacteria 4624
377 nmdc:mga03683_5839_c1 3300050489 Bacteria 4182
378 nmdc:mga03683_7240_c1 3300050489 Bacteria 3843
379 nmdc:mga03683_87054_c1 3300050489 Bacteria 1357
380 nmdc:mga03n38_1640_c1 3300050490 Bacteria 6549
381 nmdc:mga03n38_26226_c1 3300050490 Bacteria 2404
382 nmdc:mga03n38_4048_c1 3300050490 Bacteria 4799
383 nmdc:mga00v17_26717_c1 3300050491 Bacteria 3366
384 nmdc:mga0yw44_12219_c1 3300050492 Bacteria 4467
385 nmdc:mga0yw44_14313_c1 3300050492 Bacteria 4210
386 nmdc:mga0yw44_175297_c1 3300050492 Bacteria 1409
387 nmdc:mga0yw44_44766_c1 3300050492 Bacteria 2649
388 nmdc:mga0yw44_73735_c1 3300050492 Bacteria 2124
389 nmdc:mga0k408_101878_c1 3300050493 Bacteria 1693
390 nmdc:mga0k408_43978_c1 3300050493 Bacteria 838
391 nmdc:mga06z11_117875_c1 3300050494 Bacteria 1478
392 nmdc:mga06z11_12232_c1 3300050494 Bacteria 3728
393 nmdc:mga06z11_20261_c1 3300050494 Bacteria 3072
394 nmdc:mga06z11_2481_c1 3300050494 Bacteria 7056
395 nmdc:mga06z11_84319_c1 3300050494 Bacteria 1712
396 nmdc:mga04h51_15858_c1 3300050495 Bacteria 2178
397 nmdc:mga04h51_23769_c1 3300050495 Bacteria 1870
398 nmdc:mga07m45_35455_c1 3300050496 Bacteria 2774
399 nmdc:mga07m45_82825_c1 3300050496 Bacteria 1832
400 nmdc:mga05p37_176187_c1 3300050507 Bacteria 2605
401 nmdc:mga05p37_215_c1 3300050507 Bacteria 57982
402 nmdc:mga05p37_748120_c1 3300050507 Bacteria 1078
403 nmdc:mga05p37_803490_c1 3300050507 Bacteria 1029
404 nmdc:mga05p37_87614_c1 3300050507 Bacteria 3837
405 nmdc:mga09592_376935_c1 3300050508 Bacteria 1227
406 nmdc:mga09592_4864_c1 3300050508 Bacteria 10880
407 nmdc:mga0qj67_17163_c1 3300050509 Bacteria 5501
408 nmdc:mga0qj67_8082_c1 3300050509 Bacteria 7787
409 nmdc:mga06r32_247712_c1 3300050510 Bacteria 1769
410 nmdc:mga06r32_44750_c1 3300050510 Bacteria 4216
411 nmdc:mga06r32_637_c1 3300050510 Bacteria 30492
412 nmdc:mga06r32_8251_c1 3300050510 Bacteria 9379
413 nmdc:mga06r32_8972_c1 3300050510 Bacteria 9009
414 nmdc:mga08y16_176_c1 3300050511 Bacteria 56313
415 nmdc:mga08y16_250568_c1 3300050511 Bacteria 1830
416 nmdc:mga08y16_30981_c1 3300050511 Bacteria 5625
417 nmdc:mga08y16_8541_c1 3300050511 Bacteria 10728
418 nmdc:mga0n895_39100_c1 3300050512 Bacteria 4600
419 nmdc:mga0rr50_14990_c1 3300050513 Bacteria 5105
420 nmdc:mga0sz30_33_c1 3300050516 Bacteria 53622
421 nmdc:mga0sz30_38983_c1 3300050516 Bacteria 1992
422 Ga0495619_0092861 3300053085 Bacteria 2045
423 Ga0500644_0136920 3300053088 Bacteria 970
424 Ga0500651_0193182 3300053093 Bacteria 1204
425 Ga0500641_0071869 3300053096 Bacteria 1457
426 Ga0500568_0033879 3300053139 Bacteria 2092
427 Ga0500616_0015357 3300053153 Bacteria 4381
428 Ga0501082_0054457 3300060353 Bacteria 3448
429 Ga0501082_0070341 3300060353 Bacteria 3013
430 Ga0530510_0054500 3300061734 Bacteria 2889
431 Ga0466969_0010228
432 Ga0070658_10005337
433 Ga0070683_100001328
434 Ga0070683_100139076
435 Ga0070690_100097314
436 Ga0068869_100105090
437 Ga0070680_100001224
438 Ga0070680_100012193
439 Ga0070680_100456997
440 Ga0070682_100565715
441 Ga0068868_100154470
442 Ga0070660_100048680
443 Ga0070691_10007087
444 Ga0070691_10012923
445 Ga0070691_10014864
446 Ga0070661_100007874
447 Ga0070661_100235214
448 Ga0070692_10004159
449 Ga0070669_100213141
450 Ga0070659_100069057
451 Ga0070659_100171675
452 Ga0070659_100225683
453 Ga0070703_10001503
454 Ga0070709_10104990
455 Ga0070709_10179096
456 Ga0070714_100128915
457 Ga0070713_100019457
458 Ga0070710_10209962
459 Ga0070710_10369429
460 Ga0070705_100000049
461 Ga0070700_100003879
462 Ga0070700_100014960
463 Ga0070700_100169450
464 Ga0070694_100018166
465 Ga0070694_100024267
466 Ga0070708_100001156
467 Ga0070708_100001590
468 Ga0070708_100017116
469 Ga0070708_100042566
470 Ga0070708_100122335
471 Ga0070663_100007554
472 Ga0070662_100056437
473 Ga0070662_100291709
474 Ga0070681_10007217
475 Ga0070706_100011319
476 Ga0070706_100031945
477 Ga0070706_100065523
478 Ga0070706_100073520
479 Ga0070706_100893205
480 Ga0070707_100003435
481 Ga0070707_100046246
482 Ga0070707_100073958
483 Ga0070707_100458624
484 Ga0070698_100004357
485 Ga0070698_100012623
486 Ga0070698_100029580
487 Ga0070699_100000208
488 Ga0070699_100004254
489 Ga0070699_100010186
490 Ga0070699_100541237
491 Ga0070679_100060801
492 Ga0070679_100400213
493 Ga0070684_100001025
494 Ga0070684_100014358
495 Ga0070684_100108910
496 Ga0070697_100008994
497 Ga0070697_100021005
498 Ga0070697_100058973
499 Ga0070697_100112005
500 Ga0070697_100397733
501 Ga0068853_100062239
502 Ga0070695_100000921
503 Ga0070695_100002413
504 Ga0070696_100000380
505 Ga0070665_100040213
506 Ga0070704_100000726
507 Ga0068855_100027868
508 Ga0070664_100012433
509 Ga0070664_100038317
510 Ga0068857_100000247
511 Ga0068857_100025844
512 Ga0068857_100179052
513 Ga0068857_100483978
514 Ga0068856_100000392
515 Ga0068856_100014284
516 Ga0068856_100076437
517 Ga0068856_100613259
518 Ga0068852_100220749
519 Ga0068859_100004962
520 Ga0068864_100055899
521 Ga0068861_100124071
522 Ga0068861_100127337
523 Ga0068870_10100020
524 Ga0068858_100157807
525 Ga0068858_100305220
526 Ga0068860_100001868
527 Ga0068860_100444825
528 Ga0068862_100001305
529 Ga0081455_10000116
530 Ga0081455_10002613
531 Ga0081455_10003249
532 Ga0081455_10189525
533 Ga0081538_10020486
534 Ga0081539_10001321
535 Ga0081539_10030625
536 Ga0070717_10006308
537 Ga0075365_10004553
538 Ga0075365_10016065
539 Ga0075365_10141228
540 Ga0075368_10011209
541 Ga0075368_10017931
542 Ga0075363_100006608
543 Ga0075363_100007871
544 Ga0075363_100103035
545 Ga0075364_10000914
546 Ga0070712_100449202
547 Ga0075362_10006100
548 Ga0075362_10165349
549 Ga0075367_10000177
550 Ga0075367_10036673
551 Ga0075367_10089993
552 Ga0075367_10096862
553 Ga0075369_10042285
554 Ga0075369_10050963
555 Ga0075366_10018352
556 Ga0075366_10086048
557 Ga0075366_10120155
558 Ga0075428_100000390
559 Ga0075428_100143023
560 Ga0075428_100357906
561 Ga0075428_100380829
562 Ga0075430_100002184
563 Ga0075430_100018097
564 Ga0075430_100085028
565 Ga0075431_100000003
566 Ga0075431_100002097
567 Ga0075431_100002153
568 Ga0075431_100016517
569 Ga0075433_10162705
570 Ga0075434_100011790
571 Ga0075429_100001974
572 Ga0075436_100287137
573 Ga0097620_100004962
574 Ga0097620_100216319
575 Ga0075435_100020145
576 Ga0099794_10198329
577 Ga0099795_10031218
578 Ga0105240_10071776
579 Ga0105240_10108697
580 Ga0111539_10004664
581 Ga0111539_10006444
582 Ga0111539_10043217
583 Ga0111539_10665077
584 Ga0114129_10000104
585 Ga0114129_10007502
586 Ga0114129_10099199
587 Ga0114129_10152118
588 Ga0105248_10275023
589 Ga0105237_10024871
590 Ga0105237_10048541
591 Ga0105237_10142763
592 Ga0105238_10163011
593 Ga0105238_10273798
594 Ga0105249_10002579
595 Ga0105246_10068207
596 Ga0157370_10020835
597 Ga0157370_10146595
598 Ga0157369_10001540
599 Ga0157369_10024199
600 Ga0157369_10112291
601 Ga0157378_10155194
602 Ga0163162_10470573
603 Ga0157372_10100266
604 Ga0157372_10464414
605 Ga0157375_10125664
606 Ga0157379_10101271
607 Ga0157379_10249202
608 Ga0157376_11031461
609 Ga0213874_10006304
610 Ga0213876_10016382
611 Ga0213871_10002282
612 Ga0207426_1021371
613 Ga0207653_10001724
614 Ga0207692_10247004
615 Ga0207647_10079081
616 Ga0207699_10075555
617 Ga0207643_10167337
618 Ga0207705_10158348
619 Ga0207705_10199017
620 Ga0207684_10007938
621 Ga0207684_10017993
622 Ga0207684_10018998
623 Ga0207684_10137463
624 Ga0207707_10023115
625 Ga0207707_10067958
626 Ga0207695_10111420
627 Ga0207671_10017855
628 Ga0207671_10118927
629 Ga0207660_10023603
630 Ga0207660_10026810
631 Ga0207657_10120493
632 Ga0207657_10162800
633 Ga0207649_10113915
634 Ga0207652_10005702
635 Ga0207652_10035233
636 Ga0207652_10327504
637 Ga0207646_10000962
638 Ga0207646_10009368
639 Ga0207646_10274214
640 Ga0207694_10123436
641 Ga0207694_10232977
642 Ga0207694_10514400
643 Ga0207659_10044710
644 Ga0207700_10001444
645 Ga0207664_10321457
646 Ga0207706_10064687
647 Ga0207709_10079164
648 Ga0207665_10169719
649 Ga0207691_10138113
650 Ga0207689_10091274
651 Ga0207661_10000102
652 Ga0207679_10021980
653 Ga0207667_10054735
654 Ga0207667_10841946
655 Ga0207668_10157219
656 Ga0207677_10092220
657 Ga0207677_10357406
658 Ga0207703_10078040
659 Ga0207678_10007748
660 Ga0207678_10096949
661 Ga0207708_10000469
662 Ga0207708_10160118
663 Ga0207702_10002513
664 Ga0207676_10011388
665 Ga0207674_10000194
666 Ga0207674_10003556
667 Ga0207674_10181615
668 Ga0207675_100048940
669 Ga0207675_100077331
670 Ga0207675_100199185
671 Ga0207683_10031302
672 Ga0209813_10013668
673 Ga0209813_10015088
674 Ga0207428_10006148
675 Ga0207428_10006513
676 Ga0207428_10268998
677 Ga0268266_10007093
678 Ga0268265_10002635
679 Ga0268265_10233226
680 Ga0268264_10001571
681 Ga0268264_10051804
682 Ga0316575_10012111
683 Ga0307405_10209087
684 Ga0307416_100266010
685 Ga0373949_0033439
686 Ga0373955_0066713
687 Ga0373961_0005725
688 Ga0373962_0022023
689 Ga0373931_0002677
690 Ga0373931_0032406
691 Ga0373931_0148567
692 Ga0373931_0261987
693 Ga0373927_0104399
694 Ga0373933_0003174
695 Ga0373947_0331704
696 Ga0373937_0088742
697 Ga0373937_0089348
698 Ga0373925_0030090
699 Ga0373925_0122361
700 Ga0373925_0335120
701 Ga0395899_0002592
702 Ga0395899_0055145
703 Ga0395899_0262684
704 Ga0395900_0011790
705 Ga0395900_0013691
706 Ga0395900_0020265
707 Ga0395900_0162877
708 Ga0395900_0397000
709 Ga0395901_0000745
710 Ga0395901_0022080
711 Ga0395901_0143984
712 Ga0436365_0231247
713 Ga0436360_0487108
714 Ga0436360_0538251
715 Ga0436363_0389578
716 Ga0436362_0046425
717 Ga0439441_038508
718 Ga0466966_0154122
719 Ga0466964_0084601
720 Ga0466957_0344735
721 Ga0466958_0061997
722 Ga0495584_0117091
723 Ga0495667_0069754
724 Ga0495668_0098933
725 Ga0495635_0012461
726 Ga0495674_0048255
727 Ga0495684_0173657
728 Ga0496102_0139179
729 Ga0496103_0358161
730 Ga0496104_0002241
731 Ga0496104_0266255
732 Ga0496105_0117145
733 Ga0496105_0201196
734 Ga0496106_0006849
735 Ga0496106_0097779
736 Ga0496107_0005417
737 Ga0496107_0290452
738 Ga0496109_0072108
739 Ga0496109_0140846
740 Ga0496110_0070154
741 Ga0496110_0074121
742 Ga0496110_0206548
743 Ga0496111_0075132
744 Ga0496111_0207165
745 Ga0496112_0038703
746 Ga0496112_0049836
747 Ga0496113_0046435
748 Ga0496113_0091485
749 Ga0496114_0200419
750 Ga0496115_0030308
751 Ga0496115_0031883
752 Ga0496126_0076898
753 Ga0501031_0011239
754 Ga0501031_0051234
755 Ga0501032_0245226
756 Ga0501033_0218922
757 Ga0501034_0003233
758 Ga0501034_0012628
759 Ga0501034_0028678
760 Ga0501034_0030020
761 Ga0501034_0117103
762 Ga0501034_0211714
763 Ga0501034_0380081
764 Ga0501034_0383366
765 Ga0501036_0189505
766 Ga0501036_0215625
767 Ga0501036_0419111
768 Ga0501037_0027329
769 Ga0501038_0032446
770 Ga0501038_0091490
771 Ga0501038_0093298
772 Ga0501038_0391276
773 Ga0501039_0065242
774 Ga0501039_0066958
775 Ga0501040_0039690
776 Ga0501042_0104806
777 Ga0501043_0233815
778 Ga0501046_0064344
779 Ga0501046_0096543
780 Ga0501046_0203780
781 Ga0501047_0049903
782 Ga0501047_0183992
783 Ga0501047_0248217
784 Ga0501067_0129369
785 Ga0501068_0007726
786 Ga0501071_0285764
787 Ga0501072_0038403
788 Ga0501073_0237620
789 Ga0501073_0319656
790 Ga0501074_0163400
791 Ga0501075_0011758
792 Ga0501077_0052462
793 Ga0501077_0230676
794 Ga0501080_0238932
795 Ga0501080_0299492
796 Ga0501080_0330868
797 Ga0501081_0015805
798 Ga0501035_0036191
799 Ga0501035_0264262
800 Ga0501035_0340082
801 Ga0501044_0026672
802 Ga0501044_0045031
803 Ga0501045_0034175
804 nmdc:mga03683_178576_c1
805 nmdc:mga03683_20819_c1
806 nmdc:mga03683_4525_c1
807 nmdc:mga03683_5839_c1
808 nmdc:mga03683_7240_c1
809 nmdc:mga03683_87054_c1
810 nmdc:mga03n38_1640_c1
811 nmdc:mga03n38_26226_c1
812 nmdc:mga03n38_4048_c1
813 nmdc:mga00v17_26717_c1
814 nmdc:mga0yw44_12219_c1
815 nmdc:mga0yw44_14313_c1
816 nmdc:mga0yw44_175297_c1
817 nmdc:mga0yw44_44766_c1
818 nmdc:mga0yw44_73735_c1
819 nmdc:mga0k408_101878_c1
820 nmdc:mga0k408_43978_c1
821 nmdc:mga06z11_117875_c1
822 nmdc:mga06z11_12232_c1
823 nmdc:mga06z11_20261_c1
824 nmdc:mga06z11_2481_c1
825 nmdc:mga06z11_84319_c1
826 nmdc:mga04h51_15858_c1
827 nmdc:mga04h51_23769_c1
828 nmdc:mga07m45_35455_c1
829 nmdc:mga07m45_82825_c1
830 nmdc:mga05p37_176187_c1
831 nmdc:mga05p37_215_c1
832 nmdc:mga05p37_748120_c1
833 nmdc:mga05p37_803490_c1
834 nmdc:mga05p37_87614_c1
835 nmdc:mga09592_376935_c1
836 nmdc:mga09592_4864_c1
837 nmdc:mga0qj67_17163_c1
838 nmdc:mga0qj67_8082_c1
839 nmdc:mga06r32_247712_c1
840 nmdc:mga06r32_44750_c1
841 nmdc:mga06r32_637_c1
842 nmdc:mga06r32_8251_c1
843 nmdc:mga06r32_8972_c1
844 nmdc:mga08y16_176_c1
845 nmdc:mga08y16_250568_c1
846 nmdc:mga08y16_30981_c1
847 nmdc:mga08y16_8541_c1
848 nmdc:mga0n895_39100_c1
849 nmdc:mga0rr50_14990_c1
850 nmdc:mga0sz30_33_c1
851 nmdc:mga0sz30_38983_c1
852 Ga0495619_0092861
853 Ga0500644_0136920
854 Ga0500651_0193182
855 Ga0500641_0071869
856 Ga0500568_0033879
857 Ga0500616_0015357
858 Ga0501082_0054457
859 Ga0501082_0070341
860 Ga0530510_0054500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

26

179

0.96

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

227

252

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9475 13 258
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9431 13 248
6mit-assembly2.cif.gz_E lptbfgc from enterobacter cloacae 0.9397 13 260
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9391 9 250
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.937 13 262
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9756 11 260 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.968 11 260 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 11 245 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9409 13 243 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9373 11 244 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9XS80-F1-model_v4 ATP-binding cassette domain-containing protein 0.9836 10 262 GO:0005524
GO:0005886
GO:0016887
AF-A0A7J9XS80-F1-model_v4 ATP-binding cassette domain-containing protein 0.976 10 262 GO:0005524
GO:0005886
GO:0016887
AF-A0A7W3T3T6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9743 14 261 GO:0005524
GO:0005886
GO:0016887
AF-A0A538AXM2-F1-model_v4 ABC transporter ATP-binding protein 0.9686 10 260 GO:0005524
GO:0005886
GO:0016887
AF-A0A7Z9Y9M0-F1-model_v4 ABC transporter ATP-binding protein 0.9682 52 262 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map