F442195

General Info

Members Datasets Scaffolds Average Seq Length
430 203 431 340

Family's Representative Sequence

Representative Sequence 3300042002|Ga0439442_012855|Ga0439442_012855_100_1194
Length 364
Sequence LNKINSCNAAATQSFRNSFAKLCDKNDMKHIQFSNSSTDFYFAEGISHLKKISDPKATVLITDENVYNAHNKRFKGWNTIVLKPGEEFKVQATVDSVIERLIVMEADRKTTLVGIGGGVITDITGYVASVYMRGLRFGFVPTSLLALVDASIGGKNGIDVGVYKNMVGIIRQPSFILHDMIFLNTLPQREWENGFAEIIKHACIKDAAMFRQLEAGSFKTYQGKKKSICELVQRNAMIKAKVVQQDEFEKNERRLLNFGHTLGHALENQYELMHGQAVSIGMTYACHISEQLTGFKQTEKVVKVLEQYGLPTYTSFDKQKAFEVLKMDKKRERKEMNYVLLEKIGKGVVKSIPLTQLETIINEF

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
175 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
176 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
181 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
182 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
183 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
189 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.49
Nodule 0
Rhizoplane 0
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10002280 3300002459 Bacteria 3889
2 JGI25162J39368_1003122 3300002737 Bacteria 5248
3 rootH2_10120716 3300003320 Bacteria 1390
4 rootH1_10000019 3300003316 Bacteria 18606
5 rootH1_10000019 3300003323 Bacteria 34919
6 rootH1_10103763 3300003323 Bacteria 6165
7 Ga0065704_10016464 3300005289 Bacteria 2320
8 Ga0065712_10009163 3300005290 Bacteria 2125
9 Ga0065715_10176939 3300005293 Bacteria 1504
10 Ga0065707_10002368 3300005295 Bacteria 5418
11 Ga0070676_10097576 3300005328 Bacteria 1810
12 Ga0070683_100026191 3300005329 Bacteria 5247
13 Ga0070683_100168740 3300005329 Unclassified 2077
14 Ga0070683_100177148 3300005329 Bacteria 2024
15 Ga0070683_100287484 3300005329 Bacteria 1564
16 Ga0070690_100024767 3300005330 Unclassified 3693
17 Ga0070690_100115301 3300005330 Bacteria 1797
18 Ga0070670_100032391 3300005331 Bacteria 4502
19 Ga0070670_100043770 3300005331 Bacteria 3848
20 Ga0070670_100102417 3300005331 Bacteria 2466
21 Ga0070670_100218422 3300005331 Unclassified 1658
22 Ga0070670_100371191 3300005331 Bacteria 1259
23 Ga0068869_100013130 3300005334 Bacteria 5500
24 Ga0068869_100019092 3300005334 Bacteria 4678
25 Ga0068869_100043003 3300005334 Bacteria 3242
26 Ga0068869_100063556 3300005334 Bacteria 2712
27 Ga0068869_100083400 3300005334 Bacteria 2391
28 Ga0068869_100096534 3300005334 Unclassified 2231
29 Ga0068869_100111509 3300005334 Bacteria 2082
30 Ga0070666_10022987 3300005335 Bacteria 4053
31 Ga0070666_10031590 3300005335 Unclassified 3496
32 Ga0070680_100056802 3300005336 Unclassified 3199
33 Ga0070682_100021618 3300005337 Bacteria 3800
34 Ga0068868_100056555 3300005338 Bacteria 3098
35 Ga0070660_100093384 3300005339 Bacteria 2376
36 Ga0070689_100036992 3300005340 Bacteria 3734
37 Ga0070689_100049619 3300005340 Unclassified 3241
38 Ga0070689_100405417 3300005340 Bacteria 1153
39 Ga0070687_100002130 3300005343 Bacteria 7317
40 Ga0070661_100001280 3300005344 Bacteria 17667
41 Ga0070661_100060154 3300005344 Bacteria 2787
42 Ga0070668_100022888 3300005347 Bacteria 4724
43 Ga0070669_100007488 3300005353 Bacteria 7817
44 Ga0070675_100090694 3300005354 Bacteria 2560
45 Ga0070675_100297215 3300005354 Bacteria 1422
46 Ga0070671_100022319 3300005355 Bacteria 5168
47 Ga0070671_100422624 3300005355 Bacteria 1142
48 Ga0070674_100136938 3300005356 Bacteria 1833
49 Ga0070674_100139268 3300005356 Unclassified 1819
50 Ga0070673_100004908 3300005364 Bacteria 8518
51 Ga0070673_100076917 3300005364 Bacteria 2696
52 Ga0070673_100085883 3300005364 Bacteria 2563
53 Ga0070688_100007909 3300005365 Bacteria 5748
54 Ga0070688_100045439 3300005365 Bacteria 2714
55 Ga0070688_100219233 3300005365 Unclassified 1340
56 Ga0070667_100032258 3300005367 Unclassified 4369
57 Ga0070667_100145570 3300005367 Unclassified 2078
58 Ga0070667_100161517 3300005367 Bacteria 1974
59 Ga0070667_100339281 3300005367 Bacteria 1359
60 Ga0070678_100276448 3300005456 Unclassified 1418
61 Ga0070662_100009320 3300005457 Bacteria 6415
62 Ga0070662_100026478 3300005457 Bacteria 4017
63 Ga0070662_100072291 3300005457 Bacteria 2546
64 Ga0070662_100090072 3300005457 Bacteria 2302
65 Ga0070662_100106079 3300005457 Bacteria 2134
66 Ga0070662_100128068 3300005457 Bacteria 1954
67 Ga0070662_100259260 3300005457 Unclassified 1400
68 Ga0068867_100017634 3300005459 Bacteria 5070
69 Ga0068867_100098627 3300005459 Bacteria 2228
70 Ga0068867_100153614 3300005459 Bacteria 1810
71 Ga0068867_100207649 3300005459 Unclassified 1571
72 Ga0068867_100381254 3300005459 Bacteria 1184
73 Ga0070685_10006761 3300005466 Bacteria 5850
74 Ga0070685_10021820 3300005466 Bacteria 3483
75 Ga0070685_10025904 3300005466 Bacteria 3230
76 Ga0070685_10028824 3300005466 Bacteria 3080
77 Ga0070698_100002703 3300005471 Bacteria 19500
78 Ga0070698_100005366 3300005471 Bacteria 14020
79 Ga0070698_100197327 3300005471 Bacteria 1949
80 Ga0070684_100001309 3300005535 Bacteria 17831
81 Ga0070684_100043118 3300005535 Bacteria 3895
82 Ga0068853_100038720 3300005539 Unclassified 4062
83 Ga0068853_100040027 3300005539 Bacteria 3998
84 Ga0068853_100236401 3300005539 Bacteria 1673
85 Ga0070672_100097974 3300005543 Unclassified 2374
86 Ga0070686_100031567 3300005544 Bacteria 3240
87 Ga0068855_100013922 3300005563 Bacteria 9701
88 Ga0070664_100004704 3300005564 Bacteria 10949
89 Ga0070664_100017133 3300005564 Bacteria 5948
90 Ga0070664_100023769 3300005564 Bacteria 5062
91 Ga0070664_100083517 3300005564 Unclassified 2756
92 Ga0070664_100098996 3300005564 Bacteria 2534
93 Ga0068857_100000416 3300005577 Bacteria 30150
94 Ga0068857_100059771 3300005577 Unclassified 3387
95 Ga0068857_100064922 3300005577 Unclassified 3245
96 Ga0068857_100092720 3300005577 Bacteria 2704
97 Ga0068854_100042048 3300005578 Unclassified 3232
98 Ga0068854_100073025 3300005578 Bacteria 2513
99 Ga0068856_100016424 3300005614 Bacteria 7162
100 Ga0068856_100059468 3300005614 Bacteria 3775
101 Ga0070702_100019360 3300005615 Bacteria 3549
102 Ga0068852_100003650 3300005616 Bacteria 10781
103 Ga0068852_100009439 3300005616 Bacteria 7246
104 Ga0068852_100069026 3300005616 Bacteria 3096
105 Ga0068852_100122724 3300005616 Unclassified 2381
106 Ga0068859_100049551 3300005617 Bacteria 4218
107 Ga0068859_100467485 3300005617 Bacteria 1357
108 Ga0068864_100037366 3300005618 Bacteria 4144
109 Ga0068864_100039194 3300005618 Bacteria 4049
110 Ga0068866_10167916 3300005718 Bacteria 1286
111 Ga0068861_100000225 3300005719 Bacteria 30713
112 Ga0068861_100025980 3300005719 Bacteria 4252
113 Ga0068851_10116604 3300005834 Bacteria 1431
114 Ga0068870_10033745 3300005840 Bacteria 2614
115 Ga0068870_10078977 3300005840 Unclassified 1814
116 Ga0068870_10144716 3300005840 Bacteria 1394
117 Ga0068863_100015000 3300005841 Bacteria 7443
118 Ga0068863_100055849 3300005841 Bacteria 3739
119 Ga0068863_100100759 3300005841 Bacteria 2745
120 Ga0068863_100145067 3300005841 Unclassified 2270
121 Ga0068863_100164474 3300005841 Bacteria 2127
122 Ga0068858_100175803 3300005842 Bacteria 2020
123 Ga0068860_100249261 3300005843 Bacteria 1729
124 Ga0068860_100417849 3300005843 Unclassified 1329
125 Ga0068862_100002891 3300005844 Bacteria 15027
126 Ga0068862_100328419 3300005844 Unclassified 1414
127 Ga0081540_1004465 3300005983 Bacteria 10652
128 Ga0081539_10014950 3300005985 Bacteria 5692
129 Ga0075366_10028953 3300006195 Bacteria 3252
130 Ga0075366_10034768 3300006195 Bacteria 2970
131 Ga0075366_10102424 3300006195 Bacteria 1719
132 Ga0097621_100015592 3300006237 Bacteria 5724
133 Ga0097621_100046662 3300006237 Bacteria 3506
134 Ga0097621_100279357 3300006237 Unclassified 1470
135 Ga0097621_100337497 3300006237 Bacteria 1338
136 Ga0068871_100141529 3300006358 Bacteria 2046
137 Ga0068871_100290238 3300006358 Bacteria 1433
138 Ga0075428_100003382 3300006844 Bacteria 17450
139 Ga0075428_100020025 3300006844 Bacteria 7410
140 Ga0075430_100002868 3300006846 Bacteria 14421
141 Ga0075431_100025962 3300006847 Bacteria 6005
142 Ga0075431_100188022 3300006847 Bacteria 2117
143 Ga0075434_100063228 3300006871 Bacteria 3684
144 Ga0075429_100012062 3300006880 Bacteria 7489
145 Ga0075429_100171150 3300006880 Unclassified 1902
146 Ga0068865_100082827 3300006881 Bacteria 2307
147 Ga0097620_100049550 3300006931 Bacteria 4218
148 Ga0097620_100467485 3300006931 Bacteria 1357
149 Ga0105251_10080653 3300009011 Unclassified 1504
150 Ga0105240_10000074 3300009093 Bacteria 199611
151 Ga0105240_10022852 3300009093 Bacteria 8285
152 Ga0105240_10059572 3300009093 Unclassified 4764
153 Ga0105240_10361202 3300009093 Bacteria 1645
154 Ga0111539_10081953 3300009094 Bacteria 3794
155 Ga0105247_10001601 3300009101 Bacteria 16023
156 Ga0114129_10035186 3300009147 Bacteria 7076
157 Ga0114129_10243250 3300009147 Bacteria 2418
158 Ga0105243_10325487 3300009148 Bacteria 1402
159 Ga0105241_10000286 3300009174 Bacteria 37584
160 Ga0105241_10375074 3300009174 Unclassified 1241
161 Ga0105241_10405355 3300009174 Bacteria 1197
162 Ga0105242_10009678 3300009176 Bacteria 7388
163 Ga0105242_10032980 3300009176 Bacteria 4144
164 Ga0105242_10093741 3300009176 Bacteria 2532
165 Ga0105237_10000528 3300009545 Bacteria 53756
166 Ga0105237_10002860 3300009545 Bacteria 20998
167 Ga0105237_10010089 3300009545 Bacteria 10074
168 Ga0105238_10002521 3300009551 Bacteria 18308
169 Ga0105238_10112397 3300009551 Unclassified 2703
170 Ga0105249_10002924 3300009553 Bacteria 14735
171 Ga0105249_10008538 3300009553 Bacteria 8930
172 Ga0105249_10060722 3300009553 Bacteria 3468
173 Ga0105249_10101413 3300009553 Unclassified 2707
174 Ga0105249_10111727 3300009553 Bacteria 2584
175 Ga0105239_10001973 3300010375 Bacteria 26693
176 Ga0105239_10006841 3300010375 Bacteria 13158
177 Ga0105239_10065713 3300010375 Bacteria 3984
178 Ga0105239_10294321 3300010375 Unclassified 1828
179 Ga0105239_10475025 3300010375 Bacteria 1420
180 Ga0157373_10025809 3300013100 Bacteria 4247
181 Ga0157371_10127715 3300013102 Bacteria 1808
182 Ga0157369_10028273 3300013105 Bacteria 6207
183 Ga0157374_10022876 3300013296 Bacteria 5581
184 Ga0157374_10023699 3300013296 Bacteria 5494
185 Ga0157374_10064986 3300013296 Bacteria 3425
186 Ga0157374_10088015 3300013296 Bacteria 2957
187 Ga0157374_10330851 3300013296 Bacteria 1511
188 Ga0157378_10004836 3300013297 Bacteria 11808
189 Ga0157378_10047005 3300013297 Bacteria 3837
190 Ga0157378_10061625 3300013297 Bacteria 3349
191 Ga0157378_10073339 3300013297 Bacteria 3077
192 Ga0157378_10206719 3300013297 Bacteria 1859
193 Ga0157378_10213515 3300013297 Bacteria 1831
194 Ga0157378_10219726 3300013297 Bacteria 1806
195 Ga0157378_10601265 3300013297 Bacteria 1111
196 Ga0163162_10000101 3300013306 Bacteria 77114
197 Ga0163162_10003737 3300013306 Bacteria 14581
198 Ga0163162_10031378 3300013306 Bacteria 5270
199 Ga0163162_10040844 3300013306 Bacteria 4640
200 Ga0163162_10102265 3300013306 Bacteria 2959
201 Ga0157372_10002055 3300013307 Bacteria 21888
202 Ga0157372_10303762 3300013307 Bacteria 1856
203 Ga0157372_10437287 3300013307 Bacteria 1525
204 Ga0157375_10019110 3300013308 Bacteria 6224
205 Ga0157375_10027279 3300013308 Bacteria 5337
206 Ga0157375_10028926 3300013308 Bacteria 5204
207 Ga0157375_10033241 3300013308 Bacteria 4899
208 Ga0157375_10146775 3300013308 Bacteria 2490
209 Ga0163163_10037666 3300014325 Bacteria 4706
210 Ga0163163_10121704 3300014325 Bacteria 2644
211 Ga0157380_10177167 3300014326 Bacteria 1870
212 Ga0157380_10217263 3300014326 Bacteria 1708
213 Ga0157380_10376876 3300014326 Unclassified 1338
214 Ga0157377_10000289 3300014745 Bacteria 23989
215 Ga0157377_10010648 3300014745 Bacteria 4557
216 Ga0157379_10036784 3300014968 Unclassified 4365
217 Ga0157379_10171253 3300014968 Bacteria 1960
218 Ga0157376_10012815 3300014969 Bacteria 6236
219 Ga0157376_10020193 3300014969 Bacteria 5149
220 Ga0157376_10073686 3300014969 Bacteria 2908
221 Ga0163161_10046167 3300017792 Bacteria 3142
222 Ga0163161_10070860 3300017792 Bacteria 2549
223 Ga0163161_10120615 3300017792 Bacteria 1970
224 Ga0163161_10384695 3300017792 Bacteria 1122
225 Ga0209147_100162 3300025229 Bacteria 90540
226 Ga0209258_102263 3300025242 Bacteria 5173
227 Ga0209646_1001787 3300025246 Bacteria 5381
228 Ga0209148_1003442 3300025254 Bacteria 4380
229 Ga0207642_10124447 3300025899 Bacteria 1335
230 Ga0207680_10041217 3300025903 Bacteria 2692
231 Ga0207680_10051329 3300025903 Unclassified 2466
232 Ga0207647_10000418 3300025904 Bacteria 34995
233 Ga0207647_10050633 3300025904 Bacteria 2570
234 Ga0207645_10000545 3300025907 Bacteria 31363
235 Ga0207645_10028667 3300025907 Bacteria 3593
236 Ga0207645_10086279 3300025907 Bacteria 2016
237 Ga0207643_10003910 3300025908 Bacteria 8019
238 Ga0207643_10098264 3300025908 Unclassified 1714
239 Ga0207654_10000259 3300025911 Bacteria 32195
240 Ga0207654_10098477 3300025911 Bacteria 1797
241 Ga0207654_10182031 3300025911 Bacteria 1371
242 Ga0207654_10227246 3300025911 Unclassified 1241
243 Ga0207695_10003138 3300025913 Bacteria 23612
244 Ga0207695_10016687 3300025913 Bacteria 8581
245 Ga0207695_10041338 3300025913 Unclassified 4935
246 Ga0207695_10115062 3300025913 Bacteria 2664
247 Ga0207671_10003626 3300025914 Bacteria 15252
248 Ga0207671_10005086 3300025914 Bacteria 12275
249 Ga0207671_10027647 3300025914 Unclassified 4240
250 Ga0207662_10015432 3300025918 Bacteria 4298
251 Ga0207662_10082614 3300025918 Bacteria 1962
252 Ga0207657_10077406 3300025919 Bacteria 2803
253 Ga0207649_10021537 3300025920 Bacteria 3713
254 Ga0207681_10012071 3300025923 Bacteria 5322
255 Ga0207694_10010268 3300025924 Bacteria 7059
256 Ga0207694_10018590 3300025924 Bacteria 5253
257 Ga0207650_10023539 3300025925 Bacteria 4369
258 Ga0207650_10034109 3300025925 Bacteria 3689
259 Ga0207650_10058583 3300025925 Bacteria 2868
260 Ga0207650_10177464 3300025925 Bacteria 1696
261 Ga0207650_10262921 3300025925 Bacteria 1400
262 Ga0207659_10011462 3300025926 Bacteria 5602
263 Ga0207659_10164446 3300025926 Bacteria 1745
264 Ga0207659_10330895 3300025926 Bacteria 1259
265 Ga0207690_10039033 3300025932 Bacteria 3095
266 Ga0207690_10072382 3300025932 Bacteria 2380
267 Ga0207690_10106171 3300025932 Bacteria 2015
268 Ga0207706_10024359 3300025933 Bacteria 5426
269 Ga0207706_10046355 3300025933 Bacteria 3849
270 Ga0207706_10121225 3300025933 Bacteria 2299
271 Ga0207706_10178842 3300025933 Unclassified 1863
272 Ga0207686_10000918 3300025934 Bacteria 17659
273 Ga0207670_10064175 3300025936 Bacteria 2516
274 Ga0207670_10407095 3300025936 Bacteria 1089
275 Ga0207704_10136456 3300025938 Bacteria 1708
276 Ga0207691_10209607 3300025940 Bacteria 1693
277 Ga0207691_10354180 3300025940 Bacteria 1256
278 Ga0207689_10000466 3300025942 Bacteria 37961
279 Ga0207689_10016253 3300025942 Bacteria 6304
280 Ga0207689_10019891 3300025942 Bacteria 5655
281 Ga0207689_10026562 3300025942 Bacteria 4850
282 Ga0207689_10050059 3300025942 Bacteria 3445
283 Ga0207661_10016277 3300025944 Bacteria 5486
284 Ga0207661_10022254 3300025944 Bacteria 4769
285 Ga0207679_10000780 3300025945 Bacteria 20838
286 Ga0207679_10003549 3300025945 Bacteria 9658
287 Ga0207679_10058462 3300025945 Bacteria 2857
288 Ga0207679_10250699 3300025945 Unclassified 1505
289 Ga0207667_10000135 3300025949 Bacteria 111565
290 Ga0207667_10013971 3300025949 Bacteria 9172
291 Ga0207651_10020781 3300025960 Unclassified 3971
292 Ga0207651_10023337 3300025960 Unclassified 3803
293 Ga0207651_10069174 3300025960 Bacteria 2492
294 Ga0207651_10081235 3300025960 Bacteria 2336
295 Ga0207712_10002096 3300025961 Bacteria 13067
296 Ga0207712_10004577 3300025961 Bacteria 8725
297 Ga0207712_10122048 3300025961 Bacteria 1973
298 Ga0207640_10014080 3300025981 Bacteria 4597
299 Ga0207640_10088025 3300025981 Bacteria 2143
300 Ga0207640_10106306 3300025981 Bacteria 1979
301 Ga0207658_10054589 3300025986 Bacteria 2957
302 Ga0207658_10155113 3300025986 Bacteria 1870
303 Ga0207658_10241654 3300025986 Bacteria 1530
304 Ga0207677_10006136 3300026023 Bacteria 6565
305 Ga0207677_10027750 3300026023 Bacteria 3571
306 Ga0207677_10079524 3300026023 Bacteria 2345
307 Ga0207677_10256139 3300026023 Unclassified 1424
308 Ga0207703_10025251 3300026035 Unclassified 4673
309 Ga0207703_10367370 3300026035 Bacteria 1328
310 Ga0207639_10024067 3300026041 Unclassified 4403
311 Ga0207639_10029808 3300026041 Bacteria 3999
312 Ga0207678_10459821 3300026067 Bacteria 1107
313 Ga0207708_10086958 3300026075 Bacteria 2406
314 Ga0207641_10007016 3300026088 Bacteria 9416
315 Ga0207641_10066861 3300026088 Bacteria 3077
316 Ga0207641_10158863 3300026088 Bacteria 2053
317 Ga0207641_10165849 3300026088 Unclassified 2012
318 Ga0207641_10203008 3300026088 Bacteria 1829
319 Ga0207648_10009817 3300026089 Bacteria 9141
320 Ga0207648_10027147 3300026089 Bacteria 5084
321 Ga0207648_10197018 3300026089 Bacteria 1786
322 Ga0207676_10121151 3300026095 Bacteria 2206
323 Ga0207676_10167274 3300026095 Unclassified 1912
324 Ga0207676_10184732 3300026095 Bacteria 1829
325 Ga0207674_10002454 3300026116 Bacteria 23401
326 Ga0207674_10004100 3300026116 Bacteria 17648
327 Ga0207674_10006920 3300026116 Bacteria 13284
328 Ga0207674_10076232 3300026116 Unclassified 3361
329 Ga0207675_100000386 3300026118 Bacteria 42305
330 Ga0207675_100051202 3300026118 Bacteria 3852
331 Ga0207675_100153469 3300026118 Bacteria 2193
332 Ga0207675_100161109 3300026118 Bacteria 2140
333 Ga0207675_100193423 3300026118 Bacteria 1952
334 Ga0207675_100280255 3300026118 Bacteria 1620
335 Ga0207683_10005186 3300026121 Bacteria 11188
336 Ga0207683_10018009 3300026121 Bacteria 6024
337 Ga0207683_10050506 3300026121 Bacteria 3643
338 Ga0207683_10097992 3300026121 Unclassified 2615
339 Ga0207683_10112820 3300026121 Unclassified 2434
340 Ga0207698_10007891 3300026142 Bacteria 6702
341 Ga0207698_10016235 3300026142 Bacteria 5013
342 Ga0268266_10000049 3300028379 Bacteria 307763
343 Ga0268266_10552292 3300028379 Bacteria 1104
344 Ga0268265_10198068 3300028380 Bacteria 1740
345 Ga0268265_10284652 3300028380 Bacteria 1481
346 Ga0268264_10000313 3300028381 Bacteria 77820
347 Ga0268264_10001221 3300028381 Bacteria 24720
348 Ga0268264_10252295 3300028381 Bacteria 1639
349 Ga0268264_10447584 3300028381 Bacteria 1251
350 Ga0307415_100302476 3300032126 Bacteria 1326
351 Ga0373925_0282160 3300037068 Bacteria 1338
352 Ga0395905_0002545 3300037471 Bacteria 20113
353 Ga0439439_0011892 3300041406 Bacteria 2099
354 Ga0439442_012855 3300042002 Bacteria 1714
355 Ga0439449_0050272 3300042007 Bacteria 1542
356 Ga0439457_000560 3300042014 Bacteria 10851
357 Ga0439457_020093 3300042014 Bacteria 1483
358 Ga0439434_0000955 3300042435 Bacteria 8334
359 Ga0466972_0000013 3300044658 Bacteria 229345
360 Ga0466972_0027533 3300044658 Bacteria 2811
361 Ga0453683_0148577 3300044673 Bacteria 1480
362 Ga0466971_0015154 3300044719 Bacteria 3392
363 Ga0466959_0002572 3300045049 Bacteria 11650
364 Ga0495638_0047392 3300046460 Unclassified 2694
365 Ga0495630_0181254 3300046517 Unclassified 1606
366 Ga0495648_0050537 3300046524 Bacteria 2539
367 Ga0495670_0072664 3300046691 Bacteria 1743
368 Ga0495649_0015185 3300046694 Bacteria 4384
369 Ga0495672_0013272 3300047320 Bacteria 5690
370 Ga0495672_0063369 3300047320 Bacteria 2122
371 Ga0495687_000001 3300047443 Bacteria 1215582
372 Ga0501298_000128 3300049521 Bacteria 9130
373 Ga0501031_0003126 3300049568 Bacteria 10612
374 Ga0501032_0229931 3300049569 Unclassified 1206
375 Ga0501034_0009134 3300049571 Bacteria 10404
376 Ga0501034_0038955 3300049571 Bacteria 4814
377 Ga0501034_0080598 3300049571 Bacteria 3258
378 Ga0501036_0012338 3300049572 Bacteria 7075
379 Ga0501043_0008310 3300049579 Bacteria 8174
380 Ga0501047_0127111 3300049581 Bacteria 2429
381 Ga0501047_0133723 3300049581 Bacteria 2360
382 Ga0501067_0045718 3300049583 Bacteria 2430
383 Ga0501068_0107114 3300049584 Bacteria 1736
384 Ga0501069_0145527 3300049585 Bacteria 1360
385 Ga0501070_0064182 3300049586 Unclassified 3041
386 Ga0501070_0089721 3300049586 Bacteria 2544
387 Ga0501073_0012434 3300049589 Bacteria 6211
388 Ga0501073_0025676 3300049589 Bacteria 4222
389 Ga0501074_0029035 3300049590 Bacteria 4006
390 Ga0501198_003027 3300049649 Bacteria 2286
391 Ga0501201_001930 3300049651 Bacteria 1918
392 Ga0501202_000044 3300049652 Bacteria 12530
393 Ga0501217_011455 3300049661 Bacteria 1962
394 Ga0501217_012560 3300049661 Bacteria 1889
395 Ga0501222_000252 3300049662 Bacteria 9061
396 Ga0501223_000493 3300049663 Bacteria 9571
397 Ga0501235_000488 3300049669 Bacteria 7877
398 Ga0501243_004097 3300049675 Bacteria 2179
399 Ga0501257_014104 3300049686 Bacteria 1834
400 Ga0501259_000401 3300049688 Bacteria 6869
401 Ga0501221_000844 3300049704 Bacteria 4999
402 Ga0501225_0000367 3300049705 Bacteria 14177
403 Ga0501225_0000846 3300049705 Bacteria 9521
404 Ga0501080_0054029 3300049742 Unclassified 3741
405 Ga0501080_0181959 3300049742 Bacteria 1933
406 Ga0501080_0194731 3300049742 Bacteria 1862
407 Ga0501083_0029262 3300049744 Bacteria 3790
408 Ga0501232_000760 3300049757 Bacteria 2306
409 Ga0501282_005323 3300049778 Bacteria 1375
410 Ga0501035_0194932 3300049822 Bacteria 1740
411 Ga0501035_0329510 3300049822 Unclassified 1281
412 Ga0501044_0003348 3300049823 Bacteria 18071
413 Ga0501044_0016645 3300049823 Bacteria 7895
414 Ga0501044_0028532 3300049823 Bacteria 5891
415 Ga0501044_0042041 3300049823 Bacteria 4757
416 nmdc:mga0k408_4623_c1 3300050493 Bacteria 7296
417 nmdc:mga0k408_55448_c1 3300050493 Bacteria 2298
418 nmdc:mga0k408_9463_c2 3300050493 Bacteria 3996
419 nmdc:mga05p37_279282_c1 3300050507 Bacteria 1992
420 nmdc:mga09592_18360_c1 3300050508 Bacteria 5736
421 nmdc:mga0qj67_12143_c1 3300050509 Bacteria 6479
422 nmdc:mga06r32_15938_c1 3300050510 Bacteria 6837
423 nmdc:mga06r32_198476_c1 3300050510 Bacteria 1994
424 nmdc:mga0n895_475559_c1 3300050512 Bacteria 1260
425 nmdc:mga0n895_61805_c1 3300050512 Bacteria 3699
426 Ga0500578_0001147 3300053086 Bacteria 28253
427 Ga0500583_0041355 3300053092 Unclassified 2093
428 Ga0500568_0000306 3300053139 Bacteria 39150
429 Ga0500622_0002384 3300053156 Bacteria 13622
430 Ga0500636_0129697 3300053177 Bacteria 1406
431 Ga0501082_0044963 3300060353 Bacteria 3808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0080598 Ga0501034_0080598_11_964 303
2 3300049742 Ga0501080_0194731 Ga0501080_0194731_18_950 306
3 3300026067 Ga0207678_10459821 Ga0207678_104598212 307
4 3300049662 Ga0501222_000252 Ga0501222_000252_7002_7934 310
5 3300002737 JGI25162J39368_1003122 JGI25162J39368_10031223 313
6 3300025925 Ga0207650_10262921 Ga0207650_102629212 313
7 3300041406 Ga0439439_0011892 Ga0439439_0011892_1148_2089 313
8 3300042007 Ga0439449_0050272 Ga0439449_0050272_580_1521 313
9 3300025229 Ga0209147_100162 Ga0209147_10016298 317
10 3300025242 Ga0209258_102263 Ga0209258_1022633 317
11 3300025254 Ga0209148_1003442 Ga0209148_10034424 317
12 3300049581 Ga0501047_0133723 Ga0501047_0133723_23_1006 327
13 3300003323 rootH1_10103763 rootH1_101037637 328
14 3300025945 Ga0207679_10250699 Ga0207679_102506992 328
15 3300005336 Ga0070680_100056802 Ga0070680_1000568022 329
16 3300025926 Ga0207659_10011462 Ga0207659_100114625 329
17 3300049583 Ga0501067_0045718 Ga0501067_0045718_1342_2373 329
18 3300049585 Ga0501069_0145527 Ga0501069_0145527_137_1168 329
19 3300049586 Ga0501070_0064182 Ga0501070_0064182_275_1306 329
20 3300049589 Ga0501073_0012434 Ga0501073_0012434_851_1882 329
21 3300049742 Ga0501080_0181959 Ga0501080_0181959_448_1479 329
22 3300049744 Ga0501083_0029262 Ga0501083_0029262_2050_3081 329
23 3300049823 Ga0501044_0028532 Ga0501044_0028532_3141_4172 329
24 3300060353 Ga0501082_0044963 Ga0501082_0044963_2558_3589 329
25 3300013296 Ga0157374_10088015 Ga0157374_100880152 333
26 3300005329 Ga0070683_100177148 Ga0070683_1001771481 336
27 3300005331 Ga0070670_100218422 Ga0070670_1002184222 336
28 3300005539 Ga0068853_100236401 Ga0068853_1002364012 336
29 3300005616 Ga0068852_100009439 Ga0068852_1000094392 336
30 3300006237 Ga0097621_100337497 Ga0097621_1003374972 336
31 3300013307 Ga0157372_10437287 Ga0157372_104372872 336
32 3300025904 Ga0207647_10000418 Ga0207647_1000041820 336
33 3300025932 Ga0207690_10072382 Ga0207690_100723822 336
34 3300026023 Ga0207677_10256139 Ga0207677_102561392 336
35 3300026121 Ga0207683_10050506 Ga0207683_100505063 336
36 3300026142 Ga0207698_10007891 Ga0207698_100078916 336
37 3300032126 Ga0307415_100302476 Ga0307415_1003024762 336
38 3300037471 Ga0395905_0002545 Ga0395905_0002545_4210_5220 336
39 3300049661 Ga0501217_012560 Ga0501217_012560_437_1447 336
40 3300049686 Ga0501257_014104 Ga0501257_014104_592_1602 336
41 3300042014 Ga0439457_020093 Ga0439457_020093_53_1066 337
42 3300005356 Ga0070674_100139268 Ga0070674_1001392682 338
43 3300005459 Ga0068867_100207649 Ga0068867_1002076492 338
44 3300005543 Ga0070672_100097974 Ga0070672_1000979743 338
45 3300005840 Ga0068870_10078977 Ga0068870_100789772 338
46 3300006358 Ga0068871_100141529 Ga0068871_1001415293 338
47 3300013297 Ga0157378_10206719 Ga0157378_102067192 338
48 3300025960 Ga0207651_10023337 Ga0207651_100233373 338
49 3300026121 Ga0207683_10097992 Ga0207683_100979923 338
50 3300044673 Ga0453683_0148577 Ga0453683_0148577_116_1144 338
51 3300049742 Ga0501080_0054029 Ga0501080_0054029_570_1586 338
52 3300003320 rootH2_10120716 rootH2_101207161 339
53 3300003323 rootH1_10000019 rootH1_1000001916 339
54 3300005289 Ga0065704_10016464 Ga0065704_100164643 339
55 3300005290 Ga0065712_10009163 Ga0065712_100091632 339
56 3300005293 Ga0065715_10176939 Ga0065715_101769392 339
57 3300005295 Ga0065707_10002368 Ga0065707_100023682 339
58 3300005328 Ga0070676_10097576 Ga0070676_100975762 339
59 3300005329 Ga0070683_100026191 Ga0070683_1000261913 339
60 3300005329 Ga0070683_100287484 Ga0070683_1002874842 339
61 3300005330 Ga0070690_100024767 Ga0070690_1000247672 339
62 3300005330 Ga0070690_100115301 Ga0070690_1001153011 339
63 3300005331 Ga0070670_100032391 Ga0070670_1000323914 339
64 3300005331 Ga0070670_100043770 Ga0070670_1000437703 339
65 3300005331 Ga0070670_100371191 Ga0070670_1003711911 339
66 3300005334 Ga0068869_100013130 Ga0068869_1000131303 339
67 3300005334 Ga0068869_100019092 Ga0068869_1000190921 339
68 3300005334 Ga0068869_100043003 Ga0068869_1000430032 339
69 3300005334 Ga0068869_100063556 Ga0068869_1000635562 339
70 3300005334 Ga0068869_100083400 Ga0068869_1000834002 339
71 3300005334 Ga0068869_100096534 Ga0068869_1000965342 339
72 3300005334 Ga0068869_100111509 Ga0068869_1001115092 339
73 3300005335 Ga0070666_10022987 Ga0070666_100229872 339
74 3300005338 Ga0068868_100056555 Ga0068868_1000565553 339
75 3300005339 Ga0070660_100093384 Ga0070660_1000933842 339
76 3300005340 Ga0070689_100036992 Ga0070689_1000369923 339
77 3300005340 Ga0070689_100405417 Ga0070689_1004054171 339
78 3300005343 Ga0070687_100002130 Ga0070687_1000021303 339
79 3300005344 Ga0070661_100060154 Ga0070661_1000601542 339
80 3300005347 Ga0070668_100022888 Ga0070668_1000228882 339
81 3300005353 Ga0070669_100007488 Ga0070669_1000074884 339
82 3300005354 Ga0070675_100090694 Ga0070675_1000906942 339
83 3300005354 Ga0070675_100297215 Ga0070675_1002972152 339
84 3300005355 Ga0070671_100022319 Ga0070671_1000223194 339
85 3300005355 Ga0070671_100422624 Ga0070671_1004226241 339
86 3300005356 Ga0070674_100136938 Ga0070674_1001369381 339
87 3300005364 Ga0070673_100004908 Ga0070673_1000049085 339
88 3300005364 Ga0070673_100076917 Ga0070673_1000769172 339
89 3300005364 Ga0070673_100085883 Ga0070673_1000858832 339
90 3300005365 Ga0070688_100007909 Ga0070688_1000079094 339
91 3300005365 Ga0070688_100045439 Ga0070688_1000454392 339
92 3300005367 Ga0070667_100145570 Ga0070667_1001455702 339
93 3300005367 Ga0070667_100161517 Ga0070667_1001615172 339
94 3300005367 Ga0070667_100339281 Ga0070667_1003392811 339
95 3300005456 Ga0070678_100276448 Ga0070678_1002764482 339
96 3300005457 Ga0070662_100009320 Ga0070662_1000093205 339
97 3300005457 Ga0070662_100026478 Ga0070662_1000264784 339
98 3300005457 Ga0070662_100072291 Ga0070662_1000722911 339
99 3300005457 Ga0070662_100090072 Ga0070662_1000900722 339
100 3300005457 Ga0070662_100106079 Ga0070662_1001060792 339
101 3300005457 Ga0070662_100128068 Ga0070662_1001280682 339
102 3300005457 Ga0070662_100259260 Ga0070662_1002592601 339
103 3300005459 Ga0068867_100017634 Ga0068867_1000176346 339
104 3300005459 Ga0068867_100098627 Ga0068867_1000986272 339
105 3300005459 Ga0068867_100153614 Ga0068867_1001536142 339
106 3300005459 Ga0068867_100381254 Ga0068867_1003812541 339
107 3300005466 Ga0070685_10021820 Ga0070685_100218203 339
108 3300005466 Ga0070685_10025904 Ga0070685_100259042 339
109 3300005466 Ga0070685_10028824 Ga0070685_100288243 339
110 3300005471 Ga0070698_100002703 Ga0070698_1000027039 339
111 3300005471 Ga0070698_100197327 Ga0070698_1001973272 339
112 3300005535 Ga0070684_100043118 Ga0070684_1000431184 339
113 3300005539 Ga0068853_100040027 Ga0068853_1000400271 339
114 3300005544 Ga0070686_100031567 Ga0070686_1000315673 339
115 3300005563 Ga0068855_100013922 Ga0068855_1000139223 339
116 3300005564 Ga0070664_100017133 Ga0070664_1000171333 339
117 3300005564 Ga0070664_100023769 Ga0070664_1000237694 339
118 3300005564 Ga0070664_100083517 Ga0070664_1000835172 339
119 3300005564 Ga0070664_100098996 Ga0070664_1000989962 339
120 3300005577 Ga0068857_100000416 Ga0068857_10000041623 339
121 3300005577 Ga0068857_100059771 Ga0068857_1000597713 339
122 3300005577 Ga0068857_100092720 Ga0068857_1000927203 339
123 3300005578 Ga0068854_100042048 Ga0068854_1000420483 339
124 3300005578 Ga0068854_100073025 Ga0068854_1000730252 339
125 3300005614 Ga0068856_100016424 Ga0068856_1000164244 339
126 3300005614 Ga0068856_100059468 Ga0068856_1000594683 339
127 3300005615 Ga0070702_100019360 Ga0070702_1000193602 339
128 3300005616 Ga0068852_100003650 Ga0068852_1000036507 339
129 3300005616 Ga0068852_100069026 Ga0068852_1000690262 339
130 3300005616 Ga0068852_100122724 Ga0068852_1001227242 339
131 3300005617 Ga0068859_100049551 Ga0068859_1000495513 339
132 3300005617 Ga0068859_100467485 Ga0068859_1004674852 339
133 3300005618 Ga0068864_100037366 Ga0068864_1000373665 339
134 3300005618 Ga0068864_100039194 Ga0068864_1000391944 339
135 3300005718 Ga0068866_10167916 Ga0068866_101679161 339
136 3300005719 Ga0068861_100000225 Ga0068861_10000022510 339
137 3300005719 Ga0068861_100025980 Ga0068861_1000259803 339
138 3300005840 Ga0068870_10033745 Ga0068870_100337452 339
139 3300005840 Ga0068870_10144716 Ga0068870_101447162 339
140 3300005841 Ga0068863_100015000 Ga0068863_1000150003 339
141 3300005841 Ga0068863_100100759 Ga0068863_1001007593 339
142 3300005841 Ga0068863_100145067 Ga0068863_1001450672 339
143 3300005841 Ga0068863_100164474 Ga0068863_1001644742 339
144 3300005842 Ga0068858_100175803 Ga0068858_1001758032 339
145 3300005843 Ga0068860_100249261 Ga0068860_1002492612 339
146 3300005843 Ga0068860_100417849 Ga0068860_1004178491 339
147 3300005844 Ga0068862_100002891 Ga0068862_1000028916 339
148 3300005844 Ga0068862_100328419 Ga0068862_1003284192 339
149 3300005983 Ga0081540_1004465 Ga0081540_10044653 339
150 3300005985 Ga0081539_10014950 Ga0081539_100149506 339
151 3300006195 Ga0075366_10028953 Ga0075366_100289533 339
152 3300006195 Ga0075366_10034768 Ga0075366_100347683 339
153 3300006195 Ga0075366_10102424 Ga0075366_101024242 339
154 3300006237 Ga0097621_100015592 Ga0097621_1000155922 339
155 3300006237 Ga0097621_100046662 Ga0097621_1000466624 339
156 3300006237 Ga0097621_100279357 Ga0097621_1002793571 339
157 3300006358 Ga0068871_100290238 Ga0068871_1002902382 339
158 3300006844 Ga0075428_100003382 Ga0075428_1000033823 339
159 3300006844 Ga0075428_100020025 Ga0075428_1000200256 339
160 3300006846 Ga0075430_100002868 Ga0075430_10000286810 339
161 3300006847 Ga0075431_100025962 Ga0075431_1000259625 339
162 3300006847 Ga0075431_100188022 Ga0075431_1001880222 339
163 3300006871 Ga0075434_100063228 Ga0075434_1000632283 339
164 3300006880 Ga0075429_100012062 Ga0075429_1000120623 339
165 3300006880 Ga0075429_100171150 Ga0075429_1001711502 339
166 3300006881 Ga0068865_100082827 Ga0068865_1000828272 339
167 3300006931 Ga0097620_100049550 Ga0097620_1000495503 339
168 3300006931 Ga0097620_100467485 Ga0097620_1004674852 339
169 3300009093 Ga0105240_10000074 Ga0105240_1000007494 339
170 3300009093 Ga0105240_10022852 Ga0105240_100228527 339
171 3300009093 Ga0105240_10059572 Ga0105240_100595723 339
172 3300009093 Ga0105240_10361202 Ga0105240_103612022 339
173 3300009094 Ga0111539_10081953 Ga0111539_100819532 339
174 3300009101 Ga0105247_10001601 Ga0105247_100016019 339
175 3300009147 Ga0114129_10035186 Ga0114129_100351866 339
176 3300009147 Ga0114129_10243250 Ga0114129_102432502 339
177 3300009148 Ga0105243_10325487 Ga0105243_103254872 339
178 3300009174 Ga0105241_10000286 Ga0105241_1000028620 339
179 3300009174 Ga0105241_10375074 Ga0105241_103750741 339
180 3300009174 Ga0105241_10405355 Ga0105241_104053551 339
181 3300009176 Ga0105242_10009678 Ga0105242_100096786 339
182 3300009176 Ga0105242_10032980 Ga0105242_100329804 339
183 3300009176 Ga0105242_10093741 Ga0105242_100937412 339
184 3300009545 Ga0105237_10000528 Ga0105237_100005283 339
185 3300009545 Ga0105237_10002860 Ga0105237_1000286017 339
186 3300009545 Ga0105237_10010089 Ga0105237_100100898 339
187 3300009551 Ga0105238_10002521 Ga0105238_100025212 339
188 3300009551 Ga0105238_10112397 Ga0105238_101123972 339
189 3300009553 Ga0105249_10008538 Ga0105249_100085387 339
190 3300009553 Ga0105249_10060722 Ga0105249_100607223 339
191 3300009553 Ga0105249_10101413 Ga0105249_101014132 339
192 3300009553 Ga0105249_10111727 Ga0105249_101117272 339
193 3300010375 Ga0105239_10001973 Ga0105239_100019738 339
194 3300010375 Ga0105239_10006841 Ga0105239_1000684112 339
195 3300010375 Ga0105239_10065713 Ga0105239_100657132 339
196 3300010375 Ga0105239_10294321 Ga0105239_102943212 339
197 3300010375 Ga0105239_10475025 Ga0105239_104750252 339
198 3300013102 Ga0157371_10127715 Ga0157371_101277152 339
199 3300013105 Ga0157369_10028273 Ga0157369_100282733 339
200 3300013296 Ga0157374_10022876 Ga0157374_100228766 339
201 3300013296 Ga0157374_10023699 Ga0157374_100236995 339
202 3300013296 Ga0157374_10064986 Ga0157374_100649863 339
203 3300013296 Ga0157374_10330851 Ga0157374_103308511 339
204 3300013297 Ga0157378_10004836 Ga0157378_100048362 339
205 3300013297 Ga0157378_10047005 Ga0157378_100470052 339
206 3300013297 Ga0157378_10061625 Ga0157378_100616252 339
207 3300013297 Ga0157378_10213515 Ga0157378_102135152 339
208 3300013297 Ga0157378_10219726 Ga0157378_102197262 339
209 3300013297 Ga0157378_10601265 Ga0157378_106012651 339
210 3300013306 Ga0163162_10000101 Ga0163162_1000010153 339
211 3300013306 Ga0163162_10003737 Ga0163162_100037375 339
212 3300013306 Ga0163162_10031378 Ga0163162_100313782 339
213 3300013306 Ga0163162_10040844 Ga0163162_100408442 339
214 3300013306 Ga0163162_10102265 Ga0163162_101022652 339
215 3300013307 Ga0157372_10002055 Ga0157372_1000205516 339
216 3300013307 Ga0157372_10303762 Ga0157372_103037622 339
217 3300013308 Ga0157375_10019110 Ga0157375_100191104 339
218 3300013308 Ga0157375_10027279 Ga0157375_100272795 339
219 3300013308 Ga0157375_10028926 Ga0157375_100289264 339
220 3300013308 Ga0157375_10033241 Ga0157375_100332415 339
221 3300013308 Ga0157375_10146775 Ga0157375_101467752 339
222 3300014325 Ga0163163_10037666 Ga0163163_100376662 339
223 3300014325 Ga0163163_10121704 Ga0163163_101217041 339
224 3300014326 Ga0157380_10177167 Ga0157380_101771672 339
225 3300014326 Ga0157380_10217263 Ga0157380_102172632 339
226 3300014326 Ga0157380_10376876 Ga0157380_103768762 339
227 3300014745 Ga0157377_10000289 Ga0157377_100002898 339
228 3300014745 Ga0157377_10010648 Ga0157377_100106484 339
229 3300014968 Ga0157379_10036784 Ga0157379_100367842 339
230 3300014968 Ga0157379_10171253 Ga0157379_101712532 339
231 3300014969 Ga0157376_10012815 Ga0157376_100128152 339
232 3300014969 Ga0157376_10020193 Ga0157376_100201932 339
233 3300014969 Ga0157376_10073686 Ga0157376_100736862 339
234 3300017792 Ga0163161_10046167 Ga0163161_100461671 339
235 3300017792 Ga0163161_10070860 Ga0163161_100708604 339
236 3300017792 Ga0163161_10120615 Ga0163161_101206152 339
237 3300017792 Ga0163161_10384695 Ga0163161_103846952 339
238 3300025246 Ga0209646_1001787 Ga0209646_10017873 339
239 3300025899 Ga0207642_10124447 Ga0207642_101244472 339
240 3300025903 Ga0207680_10041217 Ga0207680_100412172 339
241 3300025903 Ga0207680_10051329 Ga0207680_100513292 339
242 3300025904 Ga0207647_10050633 Ga0207647_100506332 339
243 3300025907 Ga0207645_10000545 Ga0207645_100005459 339
244 3300025907 Ga0207645_10028667 Ga0207645_100286673 339
245 3300025907 Ga0207645_10086279 Ga0207645_100862792 339
246 3300025908 Ga0207643_10003910 Ga0207643_100039106 339
247 3300025908 Ga0207643_10098264 Ga0207643_100982642 339
248 3300025911 Ga0207654_10000259 Ga0207654_1000025916 339
249 3300025911 Ga0207654_10098477 Ga0207654_100984772 339
250 3300025911 Ga0207654_10182031 Ga0207654_101820312 339
251 3300025911 Ga0207654_10227246 Ga0207654_102272461 339
252 3300025913 Ga0207695_10003138 Ga0207695_1000313819 339
253 3300025913 Ga0207695_10016687 Ga0207695_100166873 339
254 3300025913 Ga0207695_10041338 Ga0207695_100413383 339
255 3300025913 Ga0207695_10115062 Ga0207695_101150622 339
256 3300025914 Ga0207671_10003626 Ga0207671_100036265 339
257 3300025914 Ga0207671_10005086 Ga0207671_100050869 339
258 3300025914 Ga0207671_10027647 Ga0207671_100276473 339
259 3300025918 Ga0207662_10015432 Ga0207662_100154322 339
260 3300025918 Ga0207662_10082614 Ga0207662_100826142 339
261 3300025919 Ga0207657_10077406 Ga0207657_100774063 339
262 3300025923 Ga0207681_10012071 Ga0207681_100120713 339
263 3300025924 Ga0207694_10010268 Ga0207694_100102685 339
264 3300025924 Ga0207694_10018590 Ga0207694_100185903 339
265 3300025925 Ga0207650_10023539 Ga0207650_100235392 339
266 3300025925 Ga0207650_10034109 Ga0207650_100341092 339
267 3300025926 Ga0207659_10330895 Ga0207659_103308951 339
268 3300025932 Ga0207690_10106171 Ga0207690_101061712 339
269 3300025933 Ga0207706_10024359 Ga0207706_100243593 339
270 3300025933 Ga0207706_10046355 Ga0207706_100463554 339
271 3300025933 Ga0207706_10121225 Ga0207706_101212252 339
272 3300025933 Ga0207706_10178842 Ga0207706_101788422 339
273 3300025934 Ga0207686_10000918 Ga0207686_100009188 339
274 3300025936 Ga0207670_10064175 Ga0207670_100641752 339
275 3300025936 Ga0207670_10407095 Ga0207670_104070951 339
276 3300025938 Ga0207704_10136456 Ga0207704_101364562 339
277 3300025940 Ga0207691_10209607 Ga0207691_102096071 339
278 3300025940 Ga0207691_10354180 Ga0207691_103541802 339
279 3300025942 Ga0207689_10000466 Ga0207689_1000046623 339
280 3300025942 Ga0207689_10016253 Ga0207689_100162534 339
281 3300025942 Ga0207689_10019891 Ga0207689_100198913 339
282 3300025942 Ga0207689_10026562 Ga0207689_100265623 339
283 3300025942 Ga0207689_10050059 Ga0207689_100500592 339
284 3300025944 Ga0207661_10022254 Ga0207661_100222542 339
285 3300025945 Ga0207679_10003549 Ga0207679_100035496 339
286 3300025945 Ga0207679_10058462 Ga0207679_100584622 339
287 3300025949 Ga0207667_10000135 Ga0207667_1000013531 339
288 3300025949 Ga0207667_10013971 Ga0207667_100139712 339
289 3300025960 Ga0207651_10020781 Ga0207651_100207812 339
290 3300025960 Ga0207651_10069174 Ga0207651_100691742 339
291 3300025960 Ga0207651_10081235 Ga0207651_100812352 339
292 3300025961 Ga0207712_10004577 Ga0207712_100045774 339
293 3300025961 Ga0207712_10122048 Ga0207712_101220481 339
294 3300025981 Ga0207640_10014080 Ga0207640_100140804 339
295 3300025981 Ga0207640_10088025 Ga0207640_100880252 339
296 3300025981 Ga0207640_10106306 Ga0207640_101063062 339
297 3300025986 Ga0207658_10054589 Ga0207658_100545892 339
298 3300025986 Ga0207658_10155113 Ga0207658_101551132 339
299 3300025986 Ga0207658_10241654 Ga0207658_102416541 339
300 3300026023 Ga0207677_10027750 Ga0207677_100277502 339
301 3300026023 Ga0207677_10079524 Ga0207677_100795242 339
302 3300026035 Ga0207703_10367370 Ga0207703_103673702 339
303 3300026041 Ga0207639_10029808 Ga0207639_100298081 339
304 3300026075 Ga0207708_10086958 Ga0207708_100869582 339
305 3300026088 Ga0207641_10007016 Ga0207641_100070166 339
306 3300026088 Ga0207641_10066861 Ga0207641_100668612 339
307 3300026088 Ga0207641_10165849 Ga0207641_101658491 339
308 3300026088 Ga0207641_10203008 Ga0207641_102030082 339
309 3300026089 Ga0207648_10009817 Ga0207648_100098172 339
310 3300026089 Ga0207648_10027147 Ga0207648_100271471 339
311 3300026089 Ga0207648_10197018 Ga0207648_101970182 339
312 3300026095 Ga0207676_10121151 Ga0207676_101211512 339
313 3300026095 Ga0207676_10167274 Ga0207676_101672742 339
314 3300026095 Ga0207676_10184732 Ga0207676_101847322 339
315 3300026116 Ga0207674_10002454 Ga0207674_1000245420 339
316 3300026116 Ga0207674_10004100 Ga0207674_1000410016 339
317 3300026116 Ga0207674_10006920 Ga0207674_1000692011 339
318 3300026118 Ga0207675_100000386 Ga0207675_10000038621 339
319 3300026118 Ga0207675_100051202 Ga0207675_1000512023 339
320 3300026118 Ga0207675_100153469 Ga0207675_1001534692 339
321 3300026118 Ga0207675_100161109 Ga0207675_1001611092 339
322 3300026118 Ga0207675_100193423 Ga0207675_1001934232 339
323 3300026121 Ga0207683_10005186 Ga0207683_100051864 339
324 3300026121 Ga0207683_10018009 Ga0207683_100180092 339
325 3300026121 Ga0207683_10112820 Ga0207683_101128202 339
326 3300026142 Ga0207698_10016235 Ga0207698_100162354 339
327 3300028379 Ga0268266_10000049 Ga0268266_1000004938 339
328 3300028379 Ga0268266_10552292 Ga0268266_105522921 339
329 3300028380 Ga0268265_10198068 Ga0268265_101980682 339
330 3300028380 Ga0268265_10284652 Ga0268265_102846522 339
331 3300028381 Ga0268264_10000313 Ga0268264_100003138 339
332 3300028381 Ga0268264_10001221 Ga0268264_1000122117 339
333 3300028381 Ga0268264_10252295 Ga0268264_102522952 339
334 3300028381 Ga0268264_10447584 Ga0268264_104475841 339
335 3300037068 Ga0373925_0282160 Ga0373925_0282160_246_1265 339
336 3300042014 Ga0439457_000560 Ga0439457_000560_6410_7429 339
337 3300044658 Ga0466972_0000013 Ga0466972_0000013_81597_82619 339
338 3300044658 Ga0466972_0027533 Ga0466972_0027533_1042_2073 339
339 3300044719 Ga0466971_0015154 Ga0466971_0015154_1439_2470 339
340 3300045049 Ga0466959_0002572 Ga0466959_0002572_3838_4869 339
341 3300046460 Ga0495638_0047392 Ga0495638_0047392_1606_2637 339
342 3300046517 Ga0495630_0181254 Ga0495630_0181254_143_1162 339
343 3300046524 Ga0495648_0050537 Ga0495648_0050537_1226_2257 339
344 3300046691 Ga0495670_0072664 Ga0495670_0072664_413_1432 339
345 3300046694 Ga0495649_0015185 Ga0495649_0015185_1597_2628 339
346 3300047320 Ga0495672_0013272 Ga0495672_0013272_4419_5441 339
347 3300047320 Ga0495672_0063369 Ga0495672_0063369_868_1899 339
348 3300047443 Ga0495687_000001 Ga0495687_000001_388483_389514 339
349 3300049521 Ga0501298_000128 Ga0501298_000128_1445_2464 339
350 3300049568 Ga0501031_0003126 Ga0501031_0003126_9134_10153 339
351 3300049569 Ga0501032_0229931 Ga0501032_0229931_165_1184 339
352 3300049571 Ga0501034_0009134 Ga0501034_0009134_6123_7142 339
353 3300049571 Ga0501034_0038955 Ga0501034_0038955_234_1253 339
354 3300049572 Ga0501036_0012338 Ga0501036_0012338_3442_4461 339
355 3300049579 Ga0501043_0008310 Ga0501043_0008310_4310_5329 339
356 3300049581 Ga0501047_0127111 Ga0501047_0127111_858_1877 339
357 3300049584 Ga0501068_0107114 Ga0501068_0107114_413_1432 339
358 3300049586 Ga0501070_0089721 Ga0501070_0089721_1334_2353 339
359 3300049589 Ga0501073_0025676 Ga0501073_0025676_629_1648 339
360 3300049590 Ga0501074_0029035 Ga0501074_0029035_2485_3504 339
361 3300049649 Ga0501198_003027 Ga0501198_003027_634_1653 339
362 3300049651 Ga0501201_001930 Ga0501201_001930_122_1141 339
363 3300049652 Ga0501202_000044 Ga0501202_000044_11134_12153 339
364 3300049661 Ga0501217_011455 Ga0501217_011455_122_1141 339
365 3300049663 Ga0501223_000493 Ga0501223_000493_2366_3385 339
366 3300049669 Ga0501235_000488 Ga0501235_000488_6307_7326 339
367 3300049675 Ga0501243_004097 Ga0501243_004097_202_1221 339
368 3300049688 Ga0501259_000401 Ga0501259_000401_2040_3059 339
369 3300049704 Ga0501221_000844 Ga0501221_000844_150_1169 339
370 3300049705 Ga0501225_0000367 Ga0501225_0000367_8170_9192 339
371 3300049705 Ga0501225_0000846 Ga0501225_0000846_4126_5145 339
372 3300049757 Ga0501232_000760 Ga0501232_000760_96_1115 339
373 3300049778 Ga0501282_005323 Ga0501282_005323_182_1201 339
374 3300049822 Ga0501035_0194932 Ga0501035_0194932_203_1222 339
375 3300049822 Ga0501035_0329510 Ga0501035_0329510_96_1115 339
376 3300049823 Ga0501044_0003348 Ga0501044_0003348_4319_5338 339
377 3300049823 Ga0501044_0016645 Ga0501044_0016645_6527_7546 339
378 3300049823 Ga0501044_0042041 Ga0501044_0042041_3603_4652 339
379 3300050493 nmdc:mga0k408_4623_c1 nmdc:mga0k408_4623_c1_4226_5248 339
380 3300050493 nmdc:mga0k408_55448_c1 nmdc:mga0k408_55448_c1_212_1231 339
381 3300050493 nmdc:mga0k408_9463_c2 nmdc:mga0k408_9463_c2_336_1358 339
382 3300050507 nmdc:mga05p37_279282_c1 nmdc:mga05p37_279282_c1_195_1214 339
383 3300050508 nmdc:mga09592_18360_c1 nmdc:mga09592_18360_c1_1001_2020 339
384 3300050509 nmdc:mga0qj67_12143_c1 nmdc:mga0qj67_12143_c1_3978_4997 339
385 3300050510 nmdc:mga06r32_15938_c1 nmdc:mga06r32_15938_c1_1658_2677 339
386 3300050510 nmdc:mga06r32_198476_c1 nmdc:mga06r32_198476_c1_539_1558 339
387 3300050512 nmdc:mga0n895_475559_c1 nmdc:mga0n895_475559_c1_218_1237 339
388 3300050512 nmdc:mga0n895_61805_c1 nmdc:mga0n895_61805_c1_2104_3123 339
389 3300053086 Ga0500578_0001147 Ga0500578_0001147_24151_25170 339
390 3300053092 Ga0500583_0041355 Ga0500583_0041355_281_1312 339
391 3300053139 Ga0500568_0000306 Ga0500568_0000306_27460_28479 339
392 3300053156 Ga0500622_0002384 Ga0500622_0002384_10526_11557 339
393 3300053177 Ga0500636_0129697 Ga0500636_0129697_158_1177 339
394 3300042002 Ga0439442_012855 Ga0439442_012855_100_1194 341
395 3300042435 Ga0439434_0000955 Ga0439434_0000955_1168_2262 341
396 3300005329 Ga0070683_100168740 Ga0070683_1001687402 342
397 3300005335 Ga0070666_10031590 Ga0070666_100315902 342
398 3300005340 Ga0070689_100049619 Ga0070689_1000496191 342
399 3300005365 Ga0070688_100219233 Ga0070688_1002192332 342
400 3300005367 Ga0070667_100032258 Ga0070667_1000322582 342
401 3300005466 Ga0070685_10006761 Ga0070685_100067616 342
402 3300009011 Ga0105251_10080653 Ga0105251_100806532 342
403 3300026035 Ga0207703_10025251 Ga0207703_100252513 342
404 3300005337 Ga0070682_100021618 Ga0070682_1000216183 343
405 3300005344 Ga0070661_100001280 Ga0070661_1000012802 343
406 3300005471 Ga0070698_100005366 Ga0070698_1000053666 343
407 3300005535 Ga0070684_100001309 Ga0070684_10000130916 343
408 3300005539 Ga0068853_100038720 Ga0068853_1000387205 343
409 3300005564 Ga0070664_100004704 Ga0070664_1000047042 343
410 3300005577 Ga0068857_100064922 Ga0068857_1000649224 343
411 3300013100 Ga0157373_10025809 Ga0157373_100258092 343
412 3300025920 Ga0207649_10021537 Ga0207649_100215372 343
413 3300025926 Ga0207659_10164446 Ga0207659_101644462 343
414 3300025932 Ga0207690_10039033 Ga0207690_100390332 343
415 3300025944 Ga0207661_10016277 Ga0207661_100162773 343
416 3300025945 Ga0207679_10000780 Ga0207679_1000078018 343
417 3300026041 Ga0207639_10024067 Ga0207639_100240672 343
418 3300026116 Ga0207674_10076232 Ga0207674_100762323 343
419 3300026118 Ga0207675_100280255 Ga0207675_1002802553 343
420 3300005834 Ga0068851_10116604 Ga0068851_101166041 346
421 3300005841 Ga0068863_100055849 Ga0068863_1000558492 346
422 3300013297 Ga0157378_10073339 Ga0157378_100733392 346
423 3300025925 Ga0207650_10177464 Ga0207650_101774642 346
424 3300026023 Ga0207677_10006136 Ga0207677_100061363 346
425 3300026088 Ga0207641_10158863 Ga0207641_101588632 346
426 3300002459 JGI24751J29686_10002280 JGI24751J29686_100022802 351
427 3300005331 Ga0070670_100102417 Ga0070670_1001024172 351
428 3300009553 Ga0105249_10002924 Ga0105249_100029242 351
429 3300025925 Ga0207650_10058583 Ga0207650_100585832 351
430 3300025961 Ga0207712_10002096 Ga0207712_100020968 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01761

DHQ_synthase

3-dehydroquinate synthase

79

193

0.98

PF24621

194

331

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zok-assembly2.cif.gz_C structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad 0.9194 15 351
1dqs-assembly1.cif.gz_A crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, nad+ and zn2+ 0.9062 16 347
6lla-assembly1.cif.gz_A crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and nad 0.8854 15 350
4p53-assembly1.cif.gz_A-2 vala (2-epi-5-epi-valiolone synthase) from streptomyces hygroscopicus subsp. jinggangensis 5008 with nad+ and zn2+ bound 0.8839 18 350
1nvb-assembly2.cif.gz_B crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate 0.8836 6 348
ID Description Score Start End Superfamily
3clhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9352 45 171 3.40.50.1970
1xahB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9097 15 170 3.40.50.1970
af_A0A1D6IPW7_249_439_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9045 173 351 1.20.1090.10
3qbdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8856 15 170 3.40.50.1970
1xahB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.883 15 170 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A3D2XH27-F1-model_v4 3-dehydroquinate synthase 0.9814 15 140 GO:0003856
AF-A0A2W5F8Z3-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.967 15 350 GO:0000166
GO:0003856
GO:0005737
GO:0008652
GO:0009073
GO:0009423
GO:0046872
AF-A0A7T9K3Y6-F1-model_v4 deleted 0.9625 122 351
AF-A0A7X9Q5L3-F1-model_v4 3-dehydroquinate synthase 0.9592 15 134 GO:0003856
AF-A0A350YPU0-F1-model_v4 3-dehydroquinate synthase 0.9582 15 202 GO:0003856

Feature Viewer

pLDDT pTM Quality
91.79 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map