F442141

General Info

Members Datasets Scaffolds Average Seq Length
430 258 860 113

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10694152|Ga0157372_106941522
Length 115
Sequence VHAFDVLGDPIRRRLLDLLSEAGTTARPAGDLTEIVMREFAISQPAVSKHLKVLRDNGFATVEIAGNRRLYAVRTEPLTEIDAWLEKYRRFWSNRLDALDTEVVRGRRGRREERT

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
246 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
250 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
251 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
252 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
253 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
254 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
255 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
256 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
257 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
258 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0.23
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.07
Nodule 0
Rhizoplane 6.05
Rhizosphere 78.6
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10694152 3300013307 Bacteria 1184
2 JGI24740J21852_10049451 3300001979 Bacteria 1214
3 JGI24740J21852_10054470 3300001979 Bacteria 1129
4 JGI24739J22299_10030395 3300001989 Bacteria 1873
5 JGI24739J22299_10161015 3300001989 Bacteria 662
6 JGI24737J22298_10006218 3300001990 Bacteria 4089
7 JGI24735J21928_10120200 3300002067 Bacteria 756
8 JGI24738J21930_10115615 3300002075 Bacteria 580
9 Ga0055540_1000024 3300003792 Bacteria 199164
10 Ga0070658_11518261 3300005327 Bacteria 581
11 Ga0070683_100354638 3300005329 Bacteria 1397
12 Ga0070683_100905896 3300005329 Bacteria 846
13 Ga0070670_100072057 3300005331 Bacteria 2967
14 Ga0070682_100237928 3300005337 Bacteria 1306
15 Ga0070682_100760957 3300005337 Bacteria 783
16 Ga0068868_100532808 3300005338 Bacteria 1033
17 Ga0070668_100026057 3300005347 Bacteria 4434
18 Ga0070668_100079225 3300005347 Bacteria 2572
19 Ga0070668_100288156 3300005347 Bacteria 1373
20 Ga0070668_101296307 3300005347 Bacteria 662
21 Ga0070675_101995685 3300005354 Bacteria 535
22 Ga0070671_100003738 3300005355 Bacteria 11950
23 Ga0070659_100437237 3300005366 Bacteria 1108
24 Ga0070659_100445361 3300005366 Bacteria 1098
25 Ga0070667_100046372 3300005367 Bacteria 3656
26 Ga0070667_100062757 3300005367 Bacteria 3147
27 Ga0070667_100103269 3300005367 Bacteria 2464
28 Ga0070667_100265599 3300005367 Bacteria 1538
29 Ga0070667_100291763 3300005367 Bacteria 1467
30 Ga0070667_100409234 3300005367 Bacteria 1235
31 Ga0070667_100679673 3300005367 Bacteria 951
32 Ga0070667_100817436 3300005367 Bacteria 866
33 Ga0070714_101884343 3300005435 Bacteria 584
34 Ga0070710_10670212 3300005437 Bacteria 729
35 Ga0070694_100842394 3300005444 Bacteria 754
36 Ga0070708_100946248 3300005445 Bacteria 808
37 Ga0070663_100702003 3300005455 Bacteria 860
38 Ga0070678_100353813 3300005456 Bacteria 1263
39 Ga0070678_100519531 3300005456 Bacteria 1053
40 Ga0070678_101602099 3300005456 Bacteria 611
41 Ga0070698_101301765 3300005471 Bacteria 677
42 Ga0070684_100287462 3300005535 Bacteria 1507
43 Ga0070697_101187282 3300005536 Bacteria 680
44 Ga0068853_101388448 3300005539 Bacteria 679
45 Ga0068853_101947157 3300005539 Bacteria 570
46 Ga0070665_100170860 3300005548 Bacteria 2175
47 Ga0070665_100240298 3300005548 Bacteria 1812
48 Ga0070665_100250825 3300005548 Bacteria 1771
49 Ga0068857_100056329 3300005577 Bacteria 3488
50 Ga0068856_100251646 3300005614 Bacteria 1782
51 Ga0068859_100038591 3300005617 Bacteria 4791
52 Ga0068859_100839376 3300005617 Bacteria 1005
53 Ga0068859_101250163 3300005617 Bacteria 818
54 Ga0068864_100490329 3300005618 Bacteria 1181
55 Ga0068864_102371127 3300005618 Bacteria 537
56 Ga0068863_100001259 3300005841 Bacteria 25248
57 Ga0068863_100049281 3300005841 Bacteria 3994
58 Ga0068863_100357688 3300005841 Bacteria 1423
59 Ga0068863_101481580 3300005841 Bacteria 687
60 Ga0068858_101492435 3300005842 Bacteria 667
61 Ga0068860_101808441 3300005843 Bacteria 633
62 Ga0068862_100067593 3300005844 Bacteria 3081
63 Ga0068862_100181570 3300005844 Bacteria 1889
64 Ga0068862_100481405 3300005844 Bacteria 1175
65 Ga0081455_10005808 3300005937 Bacteria 13437
66 Ga0081455_10034871 3300005937 Bacteria 4505
67 Ga0081538_10072319 3300005981 Bacteria 1891
68 Ga0081540_1086276 3300005983 Bacteria 1395
69 Ga0081539_10004438 3300005985 Bacteria 15487
70 Ga0081539_10051722 3300005985 Bacteria 2313
71 Ga0075365_10015622 3300006038 Bacteria 4596
72 Ga0075365_11067051 3300006038 Bacteria 569
73 Ga0075363_100098429 3300006048 Bacteria 1616
74 Ga0075363_100287892 3300006048 Bacteria 952
75 Ga0075364_10200057 3300006051 Bacteria 1354
76 Ga0075364_10353148 3300006051 Bacteria 1002
77 Ga0075364_10391634 3300006051 Bacteria 948
78 Ga0075364_10947688 3300006051 Bacteria 586
79 Ga0070712_100071889 3300006175 Bacteria 2476
80 Ga0075362_10299234 3300006177 Bacteria 798
81 Ga0075367_10436254 3300006178 Bacteria 830
82 Ga0075369_10058153 3300006186 Bacteria 1683
83 Ga0075369_10363552 3300006186 Bacteria 680
84 Ga0075369_10463926 3300006186 Bacteria 600
85 Ga0075370_10054254 3300006353 Bacteria 2276
86 Ga0075370_10078889 3300006353 Bacteria 1891
87 Ga0075370_10533790 3300006353 Bacteria 709
88 Ga0075370_10676179 3300006353 Bacteria 627
89 Ga0068871_101745454 3300006358 Bacteria 591
90 Ga0075428_100046640 3300006844 Bacteria 4759
91 Ga0075428_100091830 3300006844 Bacteria 3310
92 Ga0075428_101493610 3300006844 Bacteria 708
93 Ga0075431_100036621 3300006847 Bacteria 5053
94 Ga0075431_100091939 3300006847 Bacteria 3131
95 Ga0075431_100323787 3300006847 Bacteria 1554
96 Ga0075431_100600816 3300006847 Bacteria 1084
97 Ga0075431_100979826 3300006847 Bacteria 813
98 Ga0075434_101191646 3300006871 Bacteria 774
99 Ga0075429_101146130 3300006880 Bacteria 679
100 Ga0097620_100038590 3300006931 Bacteria 4791
101 Ga0097620_100839604 3300006931 Bacteria 1005
102 Ga0097620_101249836 3300006931 Bacteria 818
103 Ga0099795_10010854 3300007788 Bacteria 2699
104 Ga0099795_10136878 3300007788 Bacteria 993
105 Ga0105250_10049320 3300009092 Bacteria 1688
106 Ga0105245_10739634 3300009098 Bacteria 1019
107 Ga0105245_10956995 3300009098 Bacteria 899
108 Ga0105247_10940434 3300009101 Bacteria 670
109 Ga0114129_10041366 3300009147 Bacteria 6495
110 Ga0114129_10203486 3300009147 Bacteria 2680
111 Ga0114129_10969395 3300009147 Unclassified 1073
112 Ga0114129_11179784 3300009147 Bacteria 955
113 Ga0105243_10360443 3300009148 Bacteria 1338
114 Ga0105243_11530041 3300009148 Bacteria 692
115 Ga0105242_12322098 3300009176 Bacteria 583
116 Ga0105248_10054974 3300009177 Bacteria 4465
117 Ga0105248_13172309 3300009177 Bacteria 523
118 Ga0105248_13388370 3300009177 Bacteria 506
119 Ga0105238_12115120 3300009551 Bacteria 597
120 Ga0105249_11894560 3300009553 Bacteria 669
121 Ga0105249_11991713 3300009553 Bacteria 653
122 Ga0099796_10096881 3300010159 Bacteria 1104
123 Ga0105239_10070274 3300010375 Bacteria 3845
124 Ga0105239_10841115 3300010375 Bacteria 1052
125 Ga0105239_11928297 3300010375 Bacteria 685
126 Ga0105246_10097613 3300011119 Bacteria 2132
127 Ga0157369_10481171 3300013105 Bacteria 1285
128 Ga0157369_10772821 3300013105 Bacteria 988
129 Ga0157374_10443385 3300013296 Bacteria 1299
130 Ga0157374_11325990 3300013296 Bacteria 742
131 Ga0157378_11955632 3300013297 Bacteria 636
132 Ga0163162_10486884 3300013306 Bacteria 1365
133 Ga0163162_12154431 3300013306 Bacteria 640
134 Ga0163162_12581909 3300013306 Bacteria 584
135 Ga0157372_10188047 3300013307 Bacteria 2391
136 Ga0157372_10502632 3300013307 Bacteria 1414
137 Ga0157372_11499032 3300013307 Bacteria 777
138 Ga0157375_11127517 3300013308 Bacteria 919
139 Ga0157375_11481317 3300013308 Bacteria 801
140 Ga0157375_11928461 3300013308 Bacteria 701
141 Ga0163163_10007386 3300014325 Bacteria 9699
142 Ga0163163_10831032 3300014325 Bacteria 987
143 Ga0157379_10329945 3300014968 Bacteria 1394
144 Ga0163161_11206733 3300017792 Bacteria 654
145 Ga0206353_11332616 3300020082 Bacteria 907
146 Ga0213875_10000959 3300021388 Bacteria 20600
147 Ga0213875_10010131 3300021388 Bacteria 4738
148 Ga0209051_1000021 3300025303 Bacteria 507633
149 Ga0207688_10374030 3300025901 Bacteria 881
150 Ga0207647_10016521 3300025904 Bacteria 5035
151 Ga0207647_10102786 3300025904 Bacteria 1695
152 Ga0207643_10360208 3300025908 Bacteria 914
153 Ga0207684_10806346 3300025910 Bacteria 793
154 Ga0207657_11255857 3300025919 Bacteria 561
155 Ga0207650_10410384 3300025925 Bacteria 1122
156 Ga0207659_11486829 3300025926 Bacteria 580
157 Ga0207687_10588875 3300025927 Bacteria 936
158 Ga0207664_10580784 3300025929 Bacteria 1006
159 Ga0207644_10029395 3300025931 Bacteria 3812
160 Ga0207690_10737205 3300025932 Bacteria 812
161 Ga0207690_11845822 3300025932 Bacteria 505
162 Ga0207711_10083664 3300025941 Bacteria 2791
163 Ga0207661_10329457 3300025944 Bacteria 1374
164 Ga0207712_10031851 3300025961 Bacteria 3555
165 Ga0207668_10002798 3300025972 Bacteria 10198
166 Ga0207668_10188651 3300025972 Bacteria 1632
167 Ga0207668_10496970 3300025972 Bacteria 1049
168 Ga0207668_10573086 3300025972 Bacteria 980
169 Ga0207668_10757102 3300025972 Bacteria 857
170 Ga0207668_11605666 3300025972 Bacteria 587
171 Ga0207658_10010614 3300025986 Bacteria 6260
172 Ga0207658_10030986 3300025986 Bacteria 3794
173 Ga0207658_10124625 3300025986 Bacteria 2060
174 Ga0207658_10374643 3300025986 Bacteria 1245
175 Ga0207658_10875187 3300025986 Bacteria 817
176 Ga0207677_10548594 3300026023 Bacteria 1007
177 Ga0207677_11138912 3300026023 Bacteria 712
178 Ga0207639_11810175 3300026041 Bacteria 571
179 Ga0207678_10389070 3300026067 Bacteria 1206
180 Ga0207702_10650614 3300026078 Bacteria 1036
181 Ga0207641_10015378 3300026088 Bacteria 6270
182 Ga0207641_10029760 3300026088 Bacteria 4517
183 Ga0207641_10979294 3300026088 Bacteria 842
184 Ga0207641_11048444 3300026088 Bacteria 813
185 Ga0207641_11440112 3300026088 Bacteria 690
186 Ga0207676_10587701 3300026095 Bacteria 1068
187 Ga0207674_10073656 3300026116 Bacteria 3428
188 Ga0207683_10405465 3300026121 Bacteria 1254
189 Ga0207698_11132425 3300026142 Bacteria 796
190 Ga0207698_12205922 3300026142 Bacteria 563
191 Ga0268266_10237659 3300028379 Bacteria 1680
192 Ga0268266_10298778 3300028379 Bacteria 1501
193 Ga0268266_10343827 3300028379 Bacteria 1401
194 Ga0268266_10676575 3300028379 Bacteria 994
195 Ga0268265_10047749 3300028380 Bacteria 3210
196 Ga0268265_10907486 3300028380 Bacteria 865
197 Ga0268265_12105679 3300028380 Bacteria 571
198 Ga0268264_10367457 3300028381 Bacteria 1374
199 Ga0268264_11364399 3300028381 Bacteria 719
200 Ga0268264_11397217 3300028381 Bacteria 711
201 Ga0307517_10227150 3300028786 Bacteria 1126
202 Ga0307512_10094589 3300030522 Bacteria 2061
203 Ga0307513_10044911 3300031456 Bacteria 4835
204 Ga0307513_10337893 3300031456 Bacteria 1258
205 Ga0307408_100624636 3300031548 Bacteria 960
206 Ga0307408_102226549 3300031548 Bacteria 530
207 Ga0307508_10156722 3300031616 Bacteria 1881
208 Ga0307508_10303259 3300031616 Bacteria 1190
209 Ga0307514_10526185 3300031649 Bacteria 553
210 Ga0307514_10545227 3300031649 Bacteria 537
211 Ga0307516_10345640 3300031730 Bacteria 1154
212 Ga0307516_10422448 3300031730 Bacteria 991
213 Ga0307405_10883526 3300031731 Bacteria 755
214 Ga0307405_11959700 3300031731 Bacteria 523
215 Ga0307413_10000592 3300031824 Bacteria 12160
216 Ga0307413_10154342 3300031824 Bacteria 1604
217 Ga0307413_10792198 3300031824 Bacteria 796
218 Ga0307413_11997378 3300031824 Bacteria 523
219 Ga0307410_10068267 3300031852 Bacteria 2455
220 Ga0307410_10415338 3300031852 Bacteria 1090
221 Ga0307410_11719476 3300031852 Bacteria 556
222 Ga0307406_10008907 3300031901 Bacteria 5610
223 Ga0307406_10230620 3300031901 Bacteria 1382
224 Ga0307406_10296228 3300031901 Bacteria 1241
225 Ga0307406_12091306 3300031901 Bacteria 507
226 Ga0307407_10169043 3300031903 Bacteria 1438
227 Ga0307407_11081401 3300031903 Bacteria 623
228 Ga0307407_11577663 3300031903 Bacteria 520
229 Ga0307409_100043355 3300031995 Bacteria 3377
230 Ga0307409_100150522 3300031995 Bacteria 2019
231 Ga0307409_100164662 3300031995 Bacteria 1944
232 Ga0307409_100347371 3300031995 Bacteria 1398
233 Ga0307416_100167935 3300032002 Bacteria 2038
234 Ga0307416_100192943 3300032002 Bacteria 1923
235 Ga0307416_100306671 3300032002 Bacteria 1581
236 Ga0307416_100599860 3300032002 Bacteria 1181
237 Ga0307414_11544197 3300032004 Bacteria 618
238 Ga0307414_12116096 3300032004 Bacteria 525
239 Ga0307411_10643455 3300032005 Bacteria 917
240 Ga0307415_100121349 3300032126 Bacteria 1960
241 Ga0307415_100139844 3300032126 Bacteria 1847
242 Ga0307415_101642561 3300032126 Bacteria 618
243 Ga0307415_102398738 3300032126 Bacteria 518
244 Ga0307507_10065643 3300033179 Bacteria 3335
245 Ga0307507_10171106 3300033179 Bacteria 1578
246 Ga0373958_0194327 3300034819 Bacteria 529
247 Ga0373934_0114986 3300035086 Bacteria 1093
248 Ga0373923_0113401 3300035111 Bacteria 1206
249 Ga0373954_0637452 3300035118 Bacteria 528
250 Ga0373956_0051892 3300035119 Bacteria 1844
251 Ga0373957_0193872 3300035120 Bacteria 845
252 Ga0373946_0460912 3300035171 Bacteria 648
253 Ga0373955_0249172 3300035172 Bacteria 1065
254 Ga0373935_0046180 3300035692 Bacteria 2750
255 Ga0373935_0413412 3300035692 Bacteria 970
256 Ga0373935_0669209 3300035692 Bacteria 762
257 Ga0373927_0273563 3300035695 Bacteria 1111
258 Ga0373933_0094455 3300035724 Bacteria 1849
259 Ga0373947_0607573 3300035725 Bacteria 745
260 Ga0373937_0009275 3300036401 Bacteria 8543
261 Ga0373925_0002467 3300037068 Bacteria 14789
262 Ga0395905_1713823 3300037471 Bacteria 534
263 Ga0436364_0153720 3300037853 Bacteria 21422
264 Ga0436364_1014034 3300037853 Bacteria 63349
265 Ga0439466_0112839 3300041411 Bacteria 842
266 Ga0439465_0003074 3300041413 Bacteria 5459
267 Ga0451835_0881442 3300041492 Bacteria 567
268 Ga0451837_1463125 3300041494 Bacteria 640
269 Ga0451841_0674309 3300041498 Bacteria 528
270 Ga0451853_1123620 3300041512 Bacteria 5101
271 Ga0451853_3895908 3300041512 Bacteria 2308
272 Ga0439442_118938 3300042002 Bacteria 578
273 Ga0439445_0008137 3300042004 Bacteria 2450
274 Ga0439448_0028921 3300042005 Bacteria 1752
275 Ga0439434_0049055 3300042435 Bacteria 1307
276 Ga0466972_0013967 3300044658 Bacteria 4028
277 Ga0466972_0028465 3300044658 Bacteria 2756
278 Ga0466972_0120419 3300044658 Bacteria 1238
279 Ga0466972_0289367 3300044658 Bacteria 766
280 Ga0466972_0310161 3300044658 Bacteria 737
281 Ga0466965_0948031 3300044683 Bacteria 504
282 Ga0466970_0027969 3300044765 Bacteria 2961
283 Ga0466970_0063889 3300044765 Bacteria 1974
284 Ga0466957_0019569 3300044842 Bacteria 3983
285 Ga0466960_0183246 3300044901 Bacteria 1136
286 Ga0466960_0207502 3300044901 Bacteria 1073
287 Ga0466959_0055165 3300045049 Bacteria 2902
288 Ga0466958_0318001 3300045836 Bacteria 1000
289 Ga0466967_0051052 3300045976 Bacteria 3623
290 Ga0466967_0142964 3300045976 Bacteria 2230
291 Ga0466967_0156642 3300045976 Bacteria 2134
292 Ga0495627_218367 3300046453 Bacteria 524
293 Ga0495592_0159488 3300046454 Bacteria 1553
294 Ga0495603_0013235 3300046455 Bacteria 4988
295 Ga0495629_0014331 3300046459 Bacteria 5705
296 Ga0495629_0158026 3300046459 Bacteria 1575
297 Ga0495629_0408071 3300046459 Bacteria 923
298 Ga0495629_0603410 3300046459 Bacteria 734
299 Ga0495641_0070369 3300046461 Bacteria 1572
300 Ga0495651_0002613 3300046462 Bacteria 13936
301 Ga0495653_0006041 3300046463 Bacteria 9914
302 Ga0495650_0015425 3300046471 Bacteria 3920
303 Ga0495582_0682347 3300046473 Bacteria 594
304 Ga0495639_0097107 3300046475 Bacteria 1388
305 Ga0495662_0039401 3300046476 Bacteria 2283
306 Ga0495664_0373764 3300046477 Bacteria 857
307 Ga0495585_0033737 3300046492 Bacteria 2896
308 Ga0495594_0089189 3300046499 Bacteria 1727
309 Ga0495608_0002320 3300046511 Bacteria 13733
310 Ga0495618_0421854 3300046514 Bacteria 813
311 Ga0495628_0686147 3300046516 Bacteria 724
312 Ga0495630_0911932 3300046517 Bacteria 669
313 Ga0495632_0224999 3300046519 Bacteria 848
314 Ga0495666_0157333 3300046526 Bacteria 1055
315 Ga0495652_0022737 3300046529 Bacteria 5564
316 Ga0495665_0097117 3300046531 Bacteria 1547
317 Ga0495640_0021110 3300046533 Bacteria 4786
318 Ga0495587_0080142 3300046536 Bacteria 1892
319 Ga0495645_0065396 3300046543 Bacteria 2630
320 Ga0495622_0429923 3300046557 Bacteria 567
321 Ga0495633_0468995 3300046558 Bacteria 568
322 Ga0495667_0000254 3300046559 Bacteria 34663
323 Ga0495668_0490371 3300046616 Bacteria 677
324 Ga0495634_0818995 3300046642 Bacteria 530
325 Ga0495625_0122303 3300046660 Bacteria 1770
326 Ga0495635_0051540 3300046663 Bacteria 2835
327 Ga0495657_0010848 3300046675 Bacteria 6840
328 Ga0495599_0042317 3300046678 Bacteria 2858
329 Ga0495623_0016744 3300046679 Bacteria 4736
330 Ga0495646_0034482 3300046680 Bacteria 3143
331 Ga0495646_0260170 3300046680 Bacteria 927
332 Ga0495658_0209767 3300046683 Bacteria 1217
333 Ga0495658_0770004 3300046683 Bacteria 616
334 Ga0495613_0745858 3300046689 Bacteria 642
335 Ga0495624_0096453 3300046690 Bacteria 1822
336 Ga0495624_0747216 3300046690 Bacteria 579
337 Ga0495649_0116514 3300046694 Bacteria 1414
338 Ga0495600_0003236 3300046809 Bacteria 9528
339 Ga0495581_0028180 3300047315 Bacteria 3256
340 Ga0495604_0024802 3300047317 Bacteria 4784
341 Ga0495674_0379189 3300047319 Bacteria 1144
342 Ga0495672_0079457 3300047320 Bacteria 1832
343 Ga0495672_0136456 3300047320 Bacteria 1286
344 Ga0495672_0140542 3300047320 Bacteria 1261
345 Ga0495672_0231840 3300047320 Bacteria 906
346 Ga0495676_0069370 3300047321 Bacteria 2720
347 Ga0495680_0011899 3300047322 Bacteria 7678
348 Ga0495680_0344451 3300047322 Bacteria 1039
349 Ga0495675_0086110 3300047444 Bacteria 1975
350 Ga0495684_0031693 3300047471 Bacteria 4060
351 Ga0495593_0004461 3300047673 Bacteria 8315
352 Ga0495602_0054604 3300048088 Bacteria 3525
353 Ga0496100_0492550 3300048903 Bacteria 944
354 Ga0496101_0522542 3300048904 Bacteria 938
355 Ga0496101_0597960 3300048904 Bacteria 872
356 Ga0496102_0007365 3300048905 Bacteria 9402
357 Ga0496103_0013002 3300048906 Bacteria 4936
358 Ga0496103_0130322 3300048906 Bacteria 1606
359 Ga0496104_0683910 3300048907 Bacteria 934
360 Ga0496106_0345110 3300048909 Bacteria 1196
361 Ga0496106_1338153 3300048909 Bacteria 555
362 Ga0496107_0649601 3300048910 Bacteria 778
363 Ga0496108_0260797 3300048911 Bacteria 1508
364 Ga0496108_0309751 3300048911 Bacteria 1376
365 Ga0496108_0499212 3300048911 Bacteria 1063
366 Ga0496109_0047289 3300048912 Bacteria 3912
367 Ga0496109_1615912 3300048912 Bacteria 582
368 Ga0496109_1796036 3300048912 Bacteria 546
369 Ga0496110_0261470 3300048913 Bacteria 1575
370 Ga0496110_0483611 3300048913 Bacteria 1128
371 Ga0496111_0595427 3300048914 Bacteria 810
372 Ga0496111_0702909 3300048914 Bacteria 735
373 Ga0496112_0038609 3300048915 Bacteria 4663
374 Ga0496112_0650224 3300048915 Bacteria 984
375 Ga0496112_0705005 3300048915 Bacteria 937
376 Ga0496113_0030740 3300048916 Bacteria 3890
377 Ga0496113_0802684 3300048916 Bacteria 748
378 Ga0496113_1236866 3300048916 Bacteria 582
379 Ga0501031_1101221 3300049568 Bacteria 507
380 Ga0501034_0595206 3300049571 Bacteria 1012
381 Ga0501036_0584733 3300049572 Bacteria 927
382 Ga0501071_0135627 3300049587 Bacteria 1831
383 Ga0501072_0351422 3300049588 Bacteria 1170
384 Ga0501044_0326177 3300049823 Bacteria 1459
385 Ga0501044_0592405 3300049823 Bacteria 1002
386 nmdc:mga03683_349891_c1 3300050489 Bacteria 699
387 nmdc:mga03683_60691_c1 3300050489 Bacteria 1597
388 nmdc:mga03n38_104461_c1 3300050490 Bacteria 1371
389 nmdc:mga03n38_354725_c1 3300050490 Bacteria 799
390 nmdc:mga00v17_159237_c1 3300050491 Bacteria 1452
391 nmdc:mga00v17_41607_c1 3300050491 Bacteria 2760
392 nmdc:mga00v17_95352_c1 3300050491 Bacteria 1873
393 nmdc:mga0yw44_19044_c1 3300050492 Bacteria 3776
394 nmdc:mga06z11_881154_c1 3300050494 Bacteria 545
395 nmdc:mga07m45_141862_c1 3300050496 Bacteria 1391
396 nmdc:mga07m45_455134_c1 3300050496 Bacteria 742
397 nmdc:mga07m45_665387_c1 3300050496 Bacteria 600
398 nmdc:mga05p37_101248_c1 3300050507 Bacteria 3548
399 nmdc:mga05p37_383355_c1 3300050507 Bacteria 1646
400 nmdc:mga05p37_831784_c1 3300050507 Bacteria 1005
401 nmdc:mga09592_474716_c1 3300050508 Bacteria 1078
402 nmdc:mga09592_540507_c1 3300050508 Bacteria 1001
403 nmdc:mga09592_76298_c1 3300050508 Bacteria 2850
404 nmdc:mga0qj67_82234_c1 3300050509 Bacteria 2582
405 nmdc:mga06r32_4248_c1 3300050510 Bacteria 12829
406 nmdc:mga06r32_583980_c1 3300050510 Bacteria 1089
407 nmdc:mga06r32_92150_c1 3300050510 Bacteria 2962
408 nmdc:mga0sz30_376505_c1 3300050516 Bacteria 635
409 nmdc:mga0sz30_62853_c1 3300050516 Bacteria 1589
410 nmdc:mga0sz30_7230_c2 3300050516 Bacteria 3229
411 nmdc:mga0sz30_78304_c1 3300050516 Bacteria 1428
412 Ga0495601_0651293 3300053077 Bacteria 674
413 Ga0495612_0498335 3300053078 Bacteria 559
414 Ga0500610_0069382 3300053079 Bacteria 1838
415 Ga0495595_0542141 3300053084 Bacteria 594
416 Ga0495619_0482276 3300053085 Bacteria 853
417 Ga0500583_0105018 3300053092 Bacteria 1387
418 Ga0500562_013974 3300053108 Bacteria 2054
419 Ga0500577_0150588 3300053142 Bacteria 987
420 Ga0590075_086572 3300059424 Bacteria 813
421 2738667633 2738541264 Bacteria 5935393
422 2739146703 2738541356 Bacteria 5935017
423 2753270494 2751185782 Bacteria 11227053
424 2795786873 2795385470 Bacteria 8317180
425 2816422698 2816332119 Bacteria 8120218
426 2816508530 2816332139 Bacteria 9138787
427 2861522709 2861520306 Bacteria 8348283
428 2915362186 2915358134 Bacteria 6050864
429 2929223576 2929219909 Bacteria 6984360
430 8001785965 8001781756 Bacteria 9586736
431 Ga0157372_10694152
432 JGI24740J21852_10049451
433 JGI24740J21852_10054470
434 JGI24739J22299_10030395
435 JGI24739J22299_10161015
436 JGI24737J22298_10006218
437 JGI24735J21928_10120200
438 JGI24738J21930_10115615
439 Ga0055540_1000024
440 Ga0070658_11518261
441 Ga0070683_100354638
442 Ga0070683_100905896
443 Ga0070670_100072057
444 Ga0070682_100237928
445 Ga0070682_100760957
446 Ga0068868_100532808
447 Ga0070668_100026057
448 Ga0070668_100079225
449 Ga0070668_100288156
450 Ga0070668_101296307
451 Ga0070675_101995685
452 Ga0070671_100003738
453 Ga0070659_100437237
454 Ga0070659_100445361
455 Ga0070667_100046372
456 Ga0070667_100062757
457 Ga0070667_100103269
458 Ga0070667_100265599
459 Ga0070667_100291763
460 Ga0070667_100409234
461 Ga0070667_100679673
462 Ga0070667_100817436
463 Ga0070714_101884343
464 Ga0070710_10670212
465 Ga0070694_100842394
466 Ga0070708_100946248
467 Ga0070663_100702003
468 Ga0070678_100353813
469 Ga0070678_100519531
470 Ga0070678_101602099
471 Ga0070698_101301765
472 Ga0070684_100287462
473 Ga0070697_101187282
474 Ga0068853_101388448
475 Ga0068853_101947157
476 Ga0070665_100170860
477 Ga0070665_100240298
478 Ga0070665_100250825
479 Ga0068857_100056329
480 Ga0068856_100251646
481 Ga0068859_100038591
482 Ga0068859_100839376
483 Ga0068859_101250163
484 Ga0068864_100490329
485 Ga0068864_102371127
486 Ga0068863_100001259
487 Ga0068863_100049281
488 Ga0068863_100357688
489 Ga0068863_101481580
490 Ga0068858_101492435
491 Ga0068860_101808441
492 Ga0068862_100067593
493 Ga0068862_100181570
494 Ga0068862_100481405
495 Ga0081455_10005808
496 Ga0081455_10034871
497 Ga0081538_10072319
498 Ga0081540_1086276
499 Ga0081539_10004438
500 Ga0081539_10051722
501 Ga0075365_10015622
502 Ga0075365_11067051
503 Ga0075363_100098429
504 Ga0075363_100287892
505 Ga0075364_10200057
506 Ga0075364_10353148
507 Ga0075364_10391634
508 Ga0075364_10947688
509 Ga0070712_100071889
510 Ga0075362_10299234
511 Ga0075367_10436254
512 Ga0075369_10058153
513 Ga0075369_10363552
514 Ga0075369_10463926
515 Ga0075370_10054254
516 Ga0075370_10078889
517 Ga0075370_10533790
518 Ga0075370_10676179
519 Ga0068871_101745454
520 Ga0075428_100046640
521 Ga0075428_100091830
522 Ga0075428_101493610
523 Ga0075431_100036621
524 Ga0075431_100091939
525 Ga0075431_100323787
526 Ga0075431_100600816
527 Ga0075431_100979826
528 Ga0075434_101191646
529 Ga0075429_101146130
530 Ga0097620_100038590
531 Ga0097620_100839604
532 Ga0097620_101249836
533 Ga0099795_10010854
534 Ga0099795_10136878
535 Ga0105250_10049320
536 Ga0105245_10739634
537 Ga0105245_10956995
538 Ga0105247_10940434
539 Ga0114129_10041366
540 Ga0114129_10203486
541 Ga0114129_10969395
542 Ga0114129_11179784
543 Ga0105243_10360443
544 Ga0105243_11530041
545 Ga0105242_12322098
546 Ga0105248_10054974
547 Ga0105248_13172309
548 Ga0105248_13388370
549 Ga0105238_12115120
550 Ga0105249_11894560
551 Ga0105249_11991713
552 Ga0099796_10096881
553 Ga0105239_10070274
554 Ga0105239_10841115
555 Ga0105239_11928297
556 Ga0105246_10097613
557 Ga0157369_10481171
558 Ga0157369_10772821
559 Ga0157374_10443385
560 Ga0157374_11325990
561 Ga0157378_11955632
562 Ga0163162_10486884
563 Ga0163162_12154431
564 Ga0163162_12581909
565 Ga0157372_10188047
566 Ga0157372_10502632
567 Ga0157372_11499032
568 Ga0157375_11127517
569 Ga0157375_11481317
570 Ga0157375_11928461
571 Ga0163163_10007386
572 Ga0163163_10831032
573 Ga0157379_10329945
574 Ga0163161_11206733
575 Ga0206353_11332616
576 Ga0213875_10000959
577 Ga0213875_10010131
578 Ga0209051_1000021
579 Ga0207688_10374030
580 Ga0207647_10016521
581 Ga0207647_10102786
582 Ga0207643_10360208
583 Ga0207684_10806346
584 Ga0207657_11255857
585 Ga0207650_10410384
586 Ga0207659_11486829
587 Ga0207687_10588875
588 Ga0207664_10580784
589 Ga0207644_10029395
590 Ga0207690_10737205
591 Ga0207690_11845822
592 Ga0207711_10083664
593 Ga0207661_10329457
594 Ga0207712_10031851
595 Ga0207668_10002798
596 Ga0207668_10188651
597 Ga0207668_10496970
598 Ga0207668_10573086
599 Ga0207668_10757102
600 Ga0207668_11605666
601 Ga0207658_10010614
602 Ga0207658_10030986
603 Ga0207658_10124625
604 Ga0207658_10374643
605 Ga0207658_10875187
606 Ga0207677_10548594
607 Ga0207677_11138912
608 Ga0207639_11810175
609 Ga0207678_10389070
610 Ga0207702_10650614
611 Ga0207641_10015378
612 Ga0207641_10029760
613 Ga0207641_10979294
614 Ga0207641_11048444
615 Ga0207641_11440112
616 Ga0207676_10587701
617 Ga0207674_10073656
618 Ga0207683_10405465
619 Ga0207698_11132425
620 Ga0207698_12205922
621 Ga0268266_10237659
622 Ga0268266_10298778
623 Ga0268266_10343827
624 Ga0268266_10676575
625 Ga0268265_10047749
626 Ga0268265_10907486
627 Ga0268265_12105679
628 Ga0268264_10367457
629 Ga0268264_11364399
630 Ga0268264_11397217
631 Ga0307517_10227150
632 Ga0307512_10094589
633 Ga0307513_10044911
634 Ga0307513_10337893
635 Ga0307408_100624636
636 Ga0307408_102226549
637 Ga0307508_10156722
638 Ga0307508_10303259
639 Ga0307514_10526185
640 Ga0307514_10545227
641 Ga0307516_10345640
642 Ga0307516_10422448
643 Ga0307405_10883526
644 Ga0307405_11959700
645 Ga0307413_10000592
646 Ga0307413_10154342
647 Ga0307413_10792198
648 Ga0307413_11997378
649 Ga0307410_10068267
650 Ga0307410_10415338
651 Ga0307410_11719476
652 Ga0307406_10008907
653 Ga0307406_10230620
654 Ga0307406_10296228
655 Ga0307406_12091306
656 Ga0307407_10169043
657 Ga0307407_11081401
658 Ga0307407_11577663
659 Ga0307409_100043355
660 Ga0307409_100150522
661 Ga0307409_100164662
662 Ga0307409_100347371
663 Ga0307416_100167935
664 Ga0307416_100192943
665 Ga0307416_100306671
666 Ga0307416_100599860
667 Ga0307414_11544197
668 Ga0307414_12116096
669 Ga0307411_10643455
670 Ga0307415_100121349
671 Ga0307415_100139844
672 Ga0307415_101642561
673 Ga0307415_102398738
674 Ga0307507_10065643
675 Ga0307507_10171106
676 Ga0373958_0194327
677 Ga0373934_0114986
678 Ga0373923_0113401
679 Ga0373954_0637452
680 Ga0373956_0051892
681 Ga0373957_0193872
682 Ga0373946_0460912
683 Ga0373955_0249172
684 Ga0373935_0046180
685 Ga0373935_0413412
686 Ga0373935_0669209
687 Ga0373927_0273563
688 Ga0373933_0094455
689 Ga0373947_0607573
690 Ga0373937_0009275
691 Ga0373925_0002467
692 Ga0395905_1713823
693 Ga0436364_0153720
694 Ga0436364_1014034
695 Ga0439466_0112839
696 Ga0439465_0003074
697 Ga0451835_0881442
698 Ga0451837_1463125
699 Ga0451841_0674309
700 Ga0451853_1123620
701 Ga0451853_3895908
702 Ga0439442_118938
703 Ga0439445_0008137
704 Ga0439448_0028921
705 Ga0439434_0049055
706 Ga0466972_0013967
707 Ga0466972_0028465
708 Ga0466972_0120419
709 Ga0466972_0289367
710 Ga0466972_0310161
711 Ga0466965_0948031
712 Ga0466970_0027969
713 Ga0466970_0063889
714 Ga0466957_0019569
715 Ga0466960_0183246
716 Ga0466960_0207502
717 Ga0466959_0055165
718 Ga0466958_0318001
719 Ga0466967_0051052
720 Ga0466967_0142964
721 Ga0466967_0156642
722 Ga0495627_218367
723 Ga0495592_0159488
724 Ga0495603_0013235
725 Ga0495629_0014331
726 Ga0495629_0158026
727 Ga0495629_0408071
728 Ga0495629_0603410
729 Ga0495641_0070369
730 Ga0495651_0002613
731 Ga0495653_0006041
732 Ga0495650_0015425
733 Ga0495582_0682347
734 Ga0495639_0097107
735 Ga0495662_0039401
736 Ga0495664_0373764
737 Ga0495585_0033737
738 Ga0495594_0089189
739 Ga0495608_0002320
740 Ga0495618_0421854
741 Ga0495628_0686147
742 Ga0495630_0911932
743 Ga0495632_0224999
744 Ga0495666_0157333
745 Ga0495652_0022737
746 Ga0495665_0097117
747 Ga0495640_0021110
748 Ga0495587_0080142
749 Ga0495645_0065396
750 Ga0495622_0429923
751 Ga0495633_0468995
752 Ga0495667_0000254
753 Ga0495668_0490371
754 Ga0495634_0818995
755 Ga0495625_0122303
756 Ga0495635_0051540
757 Ga0495657_0010848
758 Ga0495599_0042317
759 Ga0495623_0016744
760 Ga0495646_0034482
761 Ga0495646_0260170
762 Ga0495658_0209767
763 Ga0495658_0770004
764 Ga0495613_0745858
765 Ga0495624_0096453
766 Ga0495624_0747216
767 Ga0495649_0116514
768 Ga0495600_0003236
769 Ga0495581_0028180
770 Ga0495604_0024802
771 Ga0495674_0379189
772 Ga0495672_0079457
773 Ga0495672_0136456
774 Ga0495672_0140542
775 Ga0495672_0231840
776 Ga0495676_0069370
777 Ga0495680_0011899
778 Ga0495680_0344451
779 Ga0495675_0086110
780 Ga0495684_0031693
781 Ga0495593_0004461
782 Ga0495602_0054604
783 Ga0496100_0492550
784 Ga0496101_0522542
785 Ga0496101_0597960
786 Ga0496102_0007365
787 Ga0496103_0013002
788 Ga0496103_0130322
789 Ga0496104_0683910
790 Ga0496106_0345110
791 Ga0496106_1338153
792 Ga0496107_0649601
793 Ga0496108_0260797
794 Ga0496108_0309751
795 Ga0496108_0499212
796 Ga0496109_0047289
797 Ga0496109_1615912
798 Ga0496109_1796036
799 Ga0496110_0261470
800 Ga0496110_0483611
801 Ga0496111_0595427
802 Ga0496111_0702909
803 Ga0496112_0038609
804 Ga0496112_0650224
805 Ga0496112_0705005
806 Ga0496113_0030740
807 Ga0496113_0802684
808 Ga0496113_1236866
809 Ga0501031_1101221
810 Ga0501034_0595206
811 Ga0501036_0584733
812 Ga0501071_0135627
813 Ga0501072_0351422
814 Ga0501044_0326177
815 Ga0501044_0592405
816 nmdc:mga03683_349891_c1
817 nmdc:mga03683_60691_c1
818 nmdc:mga03n38_104461_c1
819 nmdc:mga03n38_354725_c1
820 nmdc:mga00v17_159237_c1
821 nmdc:mga00v17_41607_c1
822 nmdc:mga00v17_95352_c1
823 nmdc:mga0yw44_19044_c1
824 nmdc:mga06z11_881154_c1
825 nmdc:mga07m45_141862_c1
826 nmdc:mga07m45_455134_c1
827 nmdc:mga07m45_665387_c1
828 nmdc:mga05p37_101248_c1
829 nmdc:mga05p37_383355_c1
830 nmdc:mga05p37_831784_c1
831 nmdc:mga09592_474716_c1
832 nmdc:mga09592_540507_c1
833 nmdc:mga09592_76298_c1
834 nmdc:mga0qj67_82234_c1
835 nmdc:mga06r32_4248_c1
836 nmdc:mga06r32_583980_c1
837 nmdc:mga06r32_92150_c1
838 nmdc:mga0sz30_376505_c1
839 nmdc:mga0sz30_62853_c1
840 nmdc:mga0sz30_7230_c2
841 nmdc:mga0sz30_78304_c1
842 Ga0495601_0651293
843 Ga0495612_0498335
844 Ga0500610_0069382
845 Ga0495595_0542141
846 Ga0495619_0482276
847 Ga0500583_0105018
848 Ga0500562_013974
849 Ga0500577_0150588
850 Ga0590075_086572
851 2738667633
852 2739146703
853 2753270494
854 2795786873
855 2816422698
856 2816508530
857 2861522709
858 2915362186
859 2929223576
860 8001785965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

7

63

0.92

PF01022

HTH_5

Bacterial regulatory protein, arsR family

9

62

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9553 3 70
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9469 3 70
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9142 9 71
1p6r-assembly1.cif.gz_A solution structure of the dna binding domain of the repressor blai. 0.9056 9 71
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8741 11 71
ID Description Score Start End Superfamily
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9215 9 70 1.10.10.10
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9142 9 71 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9075 14 70 1.10.10.10
1p6rA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9056 9 71 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8996 4 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A327ZKR9-F1-model_v4 ArsR family transcriptional regulator 0.9734 1 89 GO:0003700
AF-A0A1Q3JBA4-F1-model_v4 HTH arsR-type domain-containing protein 0.973 3 89 GO:0003700
AF-A0A7K0D091-F1-model_v4 HTH arsR-type domain-containing protein 0.973 3 84 GO:0003700
AF-A0A016QPP2-F1-model_v4 Uncharacterized protein 0.9659 8 70
AF-K8XTQ7-F1-model_v4 ArsR family transcriptional regulator 0.9652 1 78 GO:0003700

Map