F442014

General Info

Members Datasets Scaffolds Average Seq Length
429 260 858 148

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0471094|Ga0501074_0471094_141_671
Length 176
Sequence MPHATKIFMRGILPLPAAAGPVLCSAQDKQEVGSMQRIFLAAASVGLVALAVPAAGHHAFSAEFDANAPVKLQGPITKVEWVNPHAWIHIEVKKPDGTSETWAIEGGTPNTLMRRGISRDTVKIGTVIRVDGYQSKDGSMRANGRDITLPDGRTLFMGSSGTGAPRDGRDPTEPPR

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
154 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
155 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
184 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
185 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
188 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
189 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 5.59
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 15.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0471094 3300049590 Bacteria 890
2 Ga0006759J45824_1031423 3300003163 Bacteria 624
3 Ga0007410J51695_1034685 3300003574 Bacteria 633
4 Ga0007409J51694_1024222 3300003575 Bacteria 606
5 Ga0007416J51690_1044693 3300003577 Bacteria 953
6 Ga0007429J51699_1067464 3300003579 Bacteria 677
7 Ga0070676_11268252 3300005328 Bacteria 562
8 Ga0070690_100017317 3300005330 Bacteria 4331
9 Ga0070690_100483279 3300005330 Bacteria 924
10 Ga0070670_100545005 3300005331 Unclassified 1035
11 Ga0070670_100735029 3300005331 Bacteria 889
12 Ga0068869_100148078 3300005334 Unclassified 1819
13 Ga0070666_10211824 3300005335 Bacteria 1365
14 Ga0070666_10301137 3300005335 Bacteria 1142
15 Ga0070666_10676204 3300005335 Bacteria 756
16 Ga0070666_11206561 3300005335 Bacteria 564
17 Ga0068868_100075874 3300005338 Bacteria 2687
18 Ga0068868_100163125 3300005338 Bacteria 1842
19 Ga0068868_100225619 3300005338 Bacteria 1570
20 Ga0070687_100218970 3300005343 Bacteria 1164
21 Ga0070687_100546209 3300005343 Bacteria 787
22 Ga0070687_100647584 3300005343 Bacteria 732
23 Ga0070661_100139650 3300005344 Bacteria 1825
24 Ga0070675_100274305 3300005354 Bacteria 1481
25 Ga0070674_100293425 3300005356 Bacteria 1293
26 Ga0070674_100734465 3300005356 Bacteria 847
27 Ga0070673_100075027 3300005364 Bacteria 2726
28 Ga0070673_100178640 3300005364 Bacteria 1816
29 Ga0070673_102092183 3300005364 Unclassified 538
30 Ga0070688_100194846 3300005365 Unclassified 1414
31 Ga0070688_101586443 3300005365 Unclassified 534
32 Ga0070667_100106750 3300005367 Unclassified 2424
33 Ga0070714_100048056 3300005435 Bacteria 3628
34 Ga0070713_100122690 3300005436 Bacteria 2281
35 Ga0070711_100178792 3300005439 Bacteria 1623
36 Ga0070700_100112972 3300005441 Bacteria 1809
37 Ga0070708_101594067 3300005445 Bacteria 608
38 Ga0070663_101359378 3300005455 Bacteria 628
39 Ga0070662_100094529 3300005457 Bacteria 2251
40 Ga0068867_100018847 3300005459 Bacteria 4909
41 Ga0070685_10638654 3300005466 Bacteria 770
42 Ga0070706_101480013 3300005467 Bacteria 621
43 Ga0070707_100115110 3300005468 Bacteria 2610
44 Ga0070699_100003031 3300005518 Bacteria 14907
45 Ga0070699_100098713 3300005518 Bacteria 2559
46 Ga0070699_100929795 3300005518 Bacteria 797
47 Ga0070684_100191783 3300005535 Bacteria 1860
48 Ga0070684_102182749 3300005535 Unclassified 522
49 Ga0070697_100037660 3300005536 Bacteria 3907
50 Ga0070697_100401923 3300005536 Bacteria 1189
51 Ga0068853_100310816 3300005539 Bacteria 1459
52 Ga0068853_100929860 3300005539 Bacteria 836
53 Ga0068853_100957819 3300005539 Unclassified 823
54 Ga0070672_101383706 3300005543 Unclassified 629
55 Ga0070686_100002422 3300005544 Bacteria 10274
56 Ga0070686_100113102 3300005544 Bacteria 1853
57 Ga0070695_100433872 3300005545 Bacteria 1003
58 Ga0070695_100590300 3300005545 Bacteria 871
59 Ga0070693_100138744 3300005547 Bacteria 1528
60 Ga0070665_100022888 3300005548 Bacteria 6291
61 Ga0070665_100105265 3300005548 Bacteria 2823
62 Ga0070665_100389267 3300005548 Unclassified 1402
63 Ga0070665_102476145 3300005548 Unclassified 521
64 Ga0070704_100238802 3300005549 Bacteria 1486
65 Ga0070704_100287556 3300005549 Bacteria 1365
66 Ga0070704_101039180 3300005549 Bacteria 742
67 Ga0070664_100067577 3300005564 Bacteria 3055
68 Ga0070664_100228644 3300005564 Bacteria 1667
69 Ga0068857_101442881 3300005577 Unclassified 670
70 Ga0068854_100015576 3300005578 Bacteria 5040
71 Ga0068856_100142570 3300005614 Unclassified 2403
72 Ga0068852_100374731 3300005616 Bacteria 1395
73 Ga0068852_100731386 3300005616 Bacteria 1001
74 Ga0068852_100876383 3300005616 Bacteria 914
75 Ga0068852_102111432 3300005616 Bacteria 585
76 Ga0068859_100762019 3300005617 Bacteria 1056
77 Ga0068864_100010165 3300005618 Bacteria 7769
78 Ga0068864_100056866 3300005618 Bacteria 3380
79 Ga0068866_10020095 3300005718 Bacteria 3054
80 Ga0068866_10241893 3300005718 Bacteria 1100
81 Ga0068870_10191566 3300005840 Bacteria 1234
82 Ga0068870_10839478 3300005840 Bacteria 645
83 Ga0068863_100111492 3300005841 Bacteria 2605
84 Ga0068863_100171096 3300005841 Bacteria 2084
85 Ga0068858_100013605 3300005842 Bacteria 7679
86 Ga0068858_100558288 3300005842 Bacteria 1109
87 Ga0068858_101191660 3300005842 Unclassified 749
88 Ga0068860_100105015 3300005843 Bacteria 2697
89 Ga0068860_100191642 3300005843 Bacteria 1978
90 Ga0068860_100844793 3300005843 Bacteria 930
91 Ga0068862_100824022 3300005844 Bacteria 908
92 Ga0068862_101653495 3300005844 Bacteria 648
93 Ga0070716_100080476 3300006173 Bacteria 1943
94 Ga0097621_100006722 3300006237 Bacteria 8176
95 Ga0097621_100294092 3300006237 Bacteria 1433
96 Ga0097621_101882459 3300006237 Unclassified 571
97 Ga0068871_100026412 3300006358 Bacteria 4531
98 Ga0068871_100303636 3300006358 Bacteria 1401
99 Ga0068871_100325506 3300006358 Bacteria 1354
100 Ga0075428_100521637 3300006844 Bacteria 1271
101 Ga0075430_100968387 3300006846 Bacteria 701
102 Ga0075430_100982008 3300006846 Bacteria 696
103 Ga0075431_100236416 3300006847 Bacteria 1860
104 Ga0075431_100240719 3300006847 Bacteria 1841
105 Ga0075433_10191195 3300006852 Bacteria 1821
106 Ga0075434_100000023 3300006871 Bacteria 68942
107 Ga0075434_100007078 3300006871 Bacteria 10357
108 Ga0075434_100073319 3300006871 Bacteria 3416
109 Ga0075434_100113851 3300006871 Bacteria 2717
110 Ga0075434_100528661 3300006871 Bacteria 1200
111 Ga0068865_100075454 3300006881 Bacteria 2404
112 Ga0068865_100410445 3300006881 Bacteria 1111
113 Ga0068865_100487122 3300006881 Bacteria 1026
114 Ga0075436_100003807 3300006914 Bacteria 10351
115 Ga0075436_100010734 3300006914 Bacteria 6283
116 Ga0075436_100110044 3300006914 Bacteria 1922
117 Ga0075436_100311568 3300006914 Bacteria 1130
118 Ga0075436_100650770 3300006914 Unclassified 778
119 Ga0097620_100762033 3300006931 Bacteria 1056
120 Ga0075435_100000037 3300007076 Bacteria 68955
121 Ga0075435_100003997 3300007076 Bacteria 10075
122 Ga0075435_100039708 3300007076 Bacteria 3756
123 Ga0075435_100210962 3300007076 Bacteria 1648
124 Ga0075435_100525630 3300007076 Unclassified 1024
125 Ga0105240_10274855 3300009093 Unclassified 1938
126 Ga0105240_10321713 3300009093 Bacteria 1763
127 Ga0111539_10028404 3300009094 Bacteria 6825
128 Ga0111539_11087576 3300009094 Bacteria 929
129 Ga0105245_10029958 3300009098 Bacteria 4812
130 Ga0105245_10129679 3300009098 Bacteria 2364
131 Ga0105245_10565722 3300009098 Bacteria 1160
132 Ga0105245_11116556 3300009098 Bacteria 835
133 Ga0105247_10006215 3300009101 Bacteria 7408
134 Ga0105247_10280432 3300009101 Bacteria 1149
135 Ga0105247_10320709 3300009101 Bacteria 1081
136 Ga0105247_11086709 3300009101 Unclassified 630
137 Ga0114129_10032241 3300009147 Bacteria 7405
138 Ga0114129_10283660 3300009147 Bacteria 2212
139 Ga0114129_10619712 3300009147 Bacteria 1400
140 Ga0114129_11106243 3300009147 Bacteria 992
141 Ga0114129_11652577 3300009147 Bacteria 783
142 Ga0105243_13039418 3300009148 Bacteria 509
143 Ga0105241_10120690 3300009174 Bacteria 2110
144 Ga0105242_10007234 3300009176 Bacteria 8557
145 Ga0105242_10035914 3300009176 Bacteria 3974
146 Ga0105248_10005711 3300009177 Bacteria 13663
147 Ga0105248_10045431 3300009177 Bacteria 4926
148 Ga0105248_10210647 3300009177 Bacteria 2190
149 Ga0105248_10344581 3300009177 Bacteria 1677
150 Ga0105248_11280340 3300009177 Unclassified 829
151 Ga0105237_11402467 3300009545 Bacteria 705
152 Ga0105238_10310219 3300009551 Bacteria 1562
153 Ga0105238_10435323 3300009551 Unclassified 1307
154 Ga0105249_11322787 3300009553 Bacteria 792
155 Ga0105249_11444472 3300009553 Bacteria 760
156 Ga0105246_11272967 3300011119 Bacteria 680
157 Ga0157370_10120180 3300013104 Unclassified 2453
158 Ga0157369_10074365 3300013105 Bacteria 3644
159 Ga0157374_10031070 3300013296 Bacteria 4850
160 Ga0157374_11517967 3300013296 Unclassified 693
161 Ga0157378_10366644 3300013297 Bacteria 1411
162 Ga0157378_10920427 3300013297 Bacteria 906
163 Ga0157378_11538078 3300013297 Bacteria 710
164 Ga0157375_10518367 3300013308 Bacteria 1355
165 Ga0157375_12045222 3300013308 Bacteria 681
166 Ga0163163_10021362 3300014325 Bacteria 6107
167 Ga0163163_10239907 3300014325 Bacteria 1862
168 Ga0157380_10010762 3300014326 Bacteria 6590
169 Ga0157380_10181768 3300014326 Bacteria 1848
170 Ga0157377_11038771 3300014745 Unclassified 623
171 Ga0157379_10042060 3300014968 Bacteria 4078
172 Ga0157379_10436440 3300014968 Bacteria 1207
173 Ga0157379_10531154 3300014968 Bacteria 1093
174 Ga0157376_10291386 3300014969 Bacteria 1541
175 Ga0157376_10390003 3300014969 Bacteria 1344
176 Ga0163161_10492478 3300017792 Bacteria 997
177 Ga0213876_10273877 3300021384 Unclassified 897
178 Ga0207666_1036745 3300025271 Bacteria 761
179 Ga0207697_10139588 3300025315 Bacteria 1051
180 Ga0207656_10063124 3300025321 Bacteria 1630
181 Ga0207656_10537889 3300025321 Bacteria 595
182 Ga0207642_10149702 3300025899 Bacteria 1241
183 Ga0207710_10077572 3300025900 Unclassified 1535
184 Ga0207710_10084785 3300025900 Bacteria 1475
185 Ga0207680_10123780 3300025903 Bacteria 1695
186 Ga0207680_10254069 3300025903 Unclassified 1215
187 Ga0207680_10526802 3300025903 Bacteria 843
188 Ga0207685_10173501 3300025905 Unclassified 994
189 Ga0207645_10135999 3300025907 Bacteria 1600
190 Ga0207684_10360282 3300025910 Unclassified 1251
191 Ga0207684_11275235 3300025910 Unclassified 606
192 Ga0207654_10179103 3300025911 Bacteria 1382
193 Ga0207695_10184660 3300025913 Bacteria 2005
194 Ga0207695_10519788 3300025913 Bacteria 1072
195 Ga0207671_10881647 3300025914 Bacteria 708
196 Ga0207663_10739349 3300025916 Bacteria 781
197 Ga0207660_10060914 3300025917 Bacteria 2715
198 Ga0207662_10204911 3300025918 Bacteria 1278
199 Ga0207657_10897263 3300025919 Unclassified 683
200 Ga0207649_10488007 3300025920 Unclassified 935
201 Ga0207646_10182661 3300025922 Bacteria 1894
202 Ga0207694_10505955 3300025924 Bacteria 1012
203 Ga0207694_10523771 3300025924 Bacteria 993
204 Ga0207650_10347680 3300025925 Bacteria 1219
205 Ga0207650_10396659 3300025925 Bacteria 1141
206 Ga0207659_10177660 3300025926 Bacteria 1684
207 Ga0207687_10021291 3300025927 Bacteria 4307
208 Ga0207687_10088896 3300025927 Bacteria 2248
209 Ga0207687_10362997 3300025927 Bacteria 1183
210 Ga0207687_11047116 3300025927 Bacteria 700
211 Ga0207664_10117128 3300025929 Bacteria 2224
212 Ga0207644_10449412 3300025931 Bacteria 1059
213 Ga0207686_10794154 3300025934 Bacteria 758
214 Ga0207686_11284254 3300025934 Bacteria 601
215 Ga0207669_10798685 3300025937 Bacteria 782
216 Ga0207669_11618613 3300025937 Unclassified 553
217 Ga0207704_10338104 3300025938 Bacteria 1168
218 Ga0207704_10387977 3300025938 Bacteria 1098
219 Ga0207704_10675655 3300025938 Bacteria 853
220 Ga0207691_10027045 3300025940 Bacteria 5383
221 Ga0207711_10012100 3300025941 Bacteria 7173
222 Ga0207711_10378685 3300025941 Bacteria 1313
223 Ga0207711_10913064 3300025941 Unclassified 816
224 Ga0207711_11779325 3300025941 Unclassified 559
225 Ga0207689_10424010 3300025942 Bacteria 1110
226 Ga0207661_10193520 3300025944 Bacteria 1784
227 Ga0207679_10098456 3300025945 Bacteria 2280
228 Ga0207679_10386708 3300025945 Bacteria 1228
229 Ga0207651_10205111 3300025960 Bacteria 1583
230 Ga0207651_10501326 3300025960 Bacteria 1049
231 Ga0207651_10581969 3300025960 Bacteria 977
232 Ga0207651_10707466 3300025960 Bacteria 888
233 Ga0207651_11304098 3300025960 Unclassified 653
234 Ga0207668_11093069 3300025972 Bacteria 715
235 Ga0207658_10588725 3300025986 Bacteria 998
236 Ga0207658_10778126 3300025986 Bacteria 868
237 Ga0207658_10896031 3300025986 Bacteria 808
238 Ga0207677_10071279 3300026023 Unclassified 2452
239 Ga0207677_10387076 3300026023 Unclassified 1182
240 Ga0207703_10033257 3300026035 Bacteria 4086
241 Ga0207703_10646096 3300026035 Bacteria 1003
242 Ga0207639_10646646 3300026041 Unclassified 978
243 Ga0207708_10305317 3300026075 Bacteria 1295
244 Ga0207702_10170472 3300026078 Unclassified 1995
245 Ga0207641_10059266 3300026088 Bacteria 3260
246 Ga0207641_10249146 3300026088 Bacteria 1658
247 Ga0207648_10016700 3300026089 Bacteria 6698
248 Ga0207676_10068348 3300026095 Bacteria 2841
249 Ga0207674_10237171 3300026116 Bacteria 1771
250 Ga0207674_10527645 3300026116 Bacteria 1140
251 Ga0207675_100126832 3300026118 Bacteria 2417
252 Ga0207675_100808314 3300026118 Bacteria 951
253 Ga0207683_10088038 3300026121 Bacteria 2762
254 Ga0207683_10102831 3300026121 Bacteria 2552
255 Ga0207698_10423906 3300026142 Bacteria 1277
256 Ga0207698_12362901 3300026142 Bacteria 543
257 Ga0207428_10268221 3300027907 Bacteria 1270
258 Ga0268266_10003260 3300028379 Bacteria 16360
259 Ga0268266_10085017 3300028379 Bacteria 2764
260 Ga0268266_10153093 3300028379 Unclassified 2080
261 Ga0268266_10947952 3300028379 Unclassified 833
262 Ga0268264_10054932 3300028381 Bacteria 3327
263 Ga0268264_10347447 3300028381 Bacteria 1411
264 Ga0268264_10793522 3300028381 Bacteria 946
265 Ga0307517_10245307 3300028786 Unclassified 1058
266 Ga0307408_100728463 3300031548 Bacteria 894
267 Ga0307405_10729891 3300031731 Bacteria 823
268 Ga0307413_10861538 3300031824 Bacteria 766
269 Ga0307410_10007757 3300031852 Bacteria 5899
270 Ga0307406_11281766 3300031901 Unclassified 639
271 Ga0307407_10481449 3300031903 Bacteria 906
272 Ga0307412_10077482 3300031911 Bacteria 2287
273 Ga0307409_100166252 3300031995 Bacteria 1936
274 Ga0307409_100588367 3300031995 Bacteria 1098
275 Ga0307416_100292642 3300032002 Bacteria 1613
276 Ga0307416_100446392 3300032002 Bacteria 1345
277 Ga0307416_101263596 3300032002 Unclassified 844
278 Ga0307414_10490867 3300032004 Bacteria 1085
279 Ga0307411_10077646 3300032005 Bacteria 2274
280 Ga0373930_0005826 3300034816 Bacteria 2061
281 Ga0373950_0002124 3300034818 Bacteria 2696
282 Ga0373958_0001930 3300034819 Bacteria 2849
283 Ga0373959_0001792 3300034820 Bacteria 3428
284 Ga0373938_0001373 3300034957 Bacteria 3901
285 Ga0373928_0000596 3300035084 Bacteria 7095
286 Ga0373929_0000466 3300035085 Bacteria 7732
287 Ga0373934_0207558 3300035086 Bacteria 807
288 Ga0373940_0000972 3300035088 Bacteria 4886
289 Ga0373944_0009842 3300035089 Bacteria 2599
290 Ga0373949_0001564 3300035090 Bacteria 6456
291 Ga0373951_0001058 3300035091 Bacteria 7393
292 Ga0373952_0000508 3300035092 Bacteria 6793
293 Ga0373932_0006596 3300035112 Bacteria 2747
294 Ga0373939_0001605 3300035114 Bacteria 5459
295 Ga0373941_0005492 3300035115 Bacteria 2988
296 Ga0373945_0364139 3300035116 Bacteria 629
297 Ga0373960_0058420 3300035121 Bacteria 1163
298 Ga0373943_0658895 3300035170 Bacteria 619
299 Ga0373946_0089332 3300035171 Bacteria 1363
300 Ga0373946_0145135 3300035171 Bacteria 1103
301 Ga0373955_0208073 3300035172 Bacteria 1166
302 Ga0373955_0513927 3300035172 Bacteria 732
303 Ga0373942_0000395 3300035207 Bacteria 12124
304 Ga0373961_0005836 3300035241 Bacteria 2958
305 Ga0373931_0027258 3300035691 Bacteria 2915
306 Ga0373933_0589050 3300035724 Bacteria 730
307 Ga0373933_0893322 3300035724 Bacteria 585
308 Ga0373947_0038804 3300035725 Bacteria 2832
309 Ga0373937_0142476 3300036401 Bacteria 2243
310 Ga0373937_0618665 3300036401 Bacteria 1028
311 Ga0373937_1597832 3300036401 Bacteria 599
312 Ga0395900_1301460 3300037418 Bacteria 641
313 Ga0436365_0531443 3300039437 Unclassified 1449
314 Ga0436365_1294967 3300039437 Bacteria 500
315 Ga0436362_0486824 3300039453 Unclassified 1495
316 Ga0439439_0076699 3300041406 Bacteria 900
317 Ga0439453_0037085 3300041408 Bacteria 944
318 Ga0451800_0406972 3300041459 Unclassified 677
319 Ga0451807_1993033 3300041486 Bacteria 688
320 Ga0450912_003471 3300042116 Bacteria 1124
321 Ga0450923_098295 3300042125 Bacteria 673
322 Ga0450888_045845 3300042126 Bacteria 617
323 Ga0439435_0010281 3300042436 Bacteria 2216
324 Ga0439460_0235436 3300042461 Unclassified 630
325 Ga0466964_0562169 3300044706 Unclassified 621
326 Ga0451576_0007030 3300045051 Bacteria 13603
327 Ga0466967_1121454 3300045976 Bacteria 784
328 Ga0495629_0583477 3300046459 Bacteria 749
329 Ga0495580_0185337 3300046472 Bacteria 1437
330 Ga0495582_0767842 3300046473 Bacteria 558
331 Ga0495608_0172856 3300046511 Bacteria 1370
332 Ga0495630_0821674 3300046517 Bacteria 709
333 Ga0495631_0236666 3300046518 Bacteria 779
334 Ga0495644_0427010 3300046523 Bacteria 526
335 Ga0495666_0104979 3300046526 Unclassified 1330
336 Ga0495640_0182442 3300046533 Bacteria 1337
337 Ga0495640_0305817 3300046533 Bacteria 987
338 Ga0495645_0009199 3300046543 Bacteria 6904
339 Ga0495634_0296391 3300046642 Bacteria 979
340 Ga0495634_0669755 3300046642 Bacteria 598
341 Ga0495635_0237624 3300046663 Bacteria 1230
342 Ga0495647_0082425 3300046681 Bacteria 1306
343 Ga0495647_0094096 3300046681 Bacteria 1233
344 Ga0495647_0457579 3300046681 Bacteria 591
345 Ga0495658_0023388 3300046683 Bacteria 3280
346 Ga0495658_0541839 3300046683 Bacteria 745
347 Ga0495671_0590776 3300046692 Bacteria 528
348 Ga0495649_0479034 3300046694 Bacteria 620
349 Ga0495600_0037668 3300046809 Bacteria 3145
350 Ga0495674_0137726 3300047319 Bacteria 2053
351 Ga0495684_0268434 3300047471 Bacteria 1235
352 Ga0496100_0109997 3300048903 Bacteria 1913
353 Ga0496100_0445609 3300048903 Bacteria 992
354 Ga0496100_0881055 3300048903 Bacteria 703
355 Ga0496102_0197108 3300048905 Bacteria 1898
356 Ga0496104_0038873 3300048907 Bacteria 4454
357 Ga0496105_0577490 3300048908 Bacteria 875
358 Ga0496106_0386227 3300048909 Bacteria 1125
359 Ga0496106_1110699 3300048909 Unclassified 619
360 Ga0496107_0054724 3300048910 Bacteria 2881
361 Ga0496107_0534676 3300048910 Unclassified 869
362 Ga0496107_0686762 3300048910 Bacteria 753
363 Ga0496108_0594439 3300048911 Unclassified 964
364 Ga0496109_0525030 3300048912 Unclassified 1117
365 Ga0496109_1315320 3300048912 Unclassified 659
366 Ga0496109_1696936 3300048912 Unclassified 565
367 Ga0496112_0019186 3300048915 Bacteria 6448
368 Ga0496112_0113311 3300048915 Bacteria 2683
369 Ga0496112_0166963 3300048915 Bacteria 2167
370 Ga0496114_0101151 3300048917 Bacteria 2460
371 Ga0496114_0534110 3300048917 Bacteria 1037
372 Ga0496114_0537674 3300048917 Bacteria 1033
373 Ga0496115_0072262 3300048918 Bacteria 2799
374 Ga0501033_1211327 3300049570 Bacteria 500
375 Ga0501034_0019374 3300049571 Bacteria 6959
376 Ga0501036_0228702 3300049572 Bacteria 1561
377 Ga0501036_0594447 3300049572 Bacteria 918
378 Ga0501037_0263884 3300049573 Bacteria 1203
379 Ga0501038_0764271 3300049574 Bacteria 720
380 Ga0501040_0243920 3300049576 Bacteria 1281
381 Ga0501042_0218620 3300049578 Bacteria 1374
382 Ga0501046_1007310 3300049580 Bacteria 578
383 Ga0501047_0259457 3300049581 Bacteria 1586
384 Ga0501048_0188129 3300049582 Bacteria 1463
385 Ga0501069_0365900 3300049585 Bacteria 851
386 Ga0501072_1323058 3300049588 Bacteria 558
387 Ga0501073_0015844 3300049589 Bacteria 5462
388 Ga0501076_0204404 3300049592 Bacteria 1613
389 Ga0501077_0450710 3300049593 Bacteria 824
390 Ga0501079_1201048 3300049741 Bacteria 597
391 Ga0501080_0570352 3300049742 Bacteria 1007
392 Ga0501081_0733592 3300049743 Unclassified 742
393 Ga0501044_0018257 3300049823 Bacteria 7520
394 Ga0501045_0043561 3300049824 Bacteria 3269
395 nmdc:mga06z11_692412_c1 3300050494 Unclassified 621
396 nmdc:mga05p37_1532491_c1 3300050507 Unclassified 661
397 nmdc:mga05p37_32037_c1 3300050507 Bacteria 6428
398 nmdc:mga05p37_425512_c1 3300050507 Bacteria 1544
399 nmdc:mga0qj67_609043_c1 3300050509 Unclassified 873
400 nmdc:mga06r32_188358_c1 3300050510 Bacteria 2050
401 nmdc:mga08y16_30770_c1 3300050511 Bacteria 5645
402 nmdc:mga0n895_1084290_c1 3300050512 Unclassified 779
403 nmdc:mga0n895_115892_c1 3300050512 Bacteria 2698
404 nmdc:mga0n895_190014_c1 3300050512 Bacteria 2085
405 nmdc:mga0n895_365583_c1 3300050512 Bacteria 1461
406 nmdc:mga0n895_378649_c1 3300050512 Bacteria 1432
407 nmdc:mga0n895_67372_c1 3300050512 Bacteria 3545
408 nmdc:mga0n895_82211_c1 3300050512 Bacteria 3210
409 nmdc:mga0rr50_10346_c1 3300050513 Bacteria 5916
410 nmdc:mga0rr50_11550_c1 3300050513 Bacteria 5660
411 nmdc:mga0rr50_22399_c1 3300050513 Bacteria 4336
412 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
413 nmdc:mga08x19_102_c1 3300050514 Bacteria 75432
414 nmdc:mga08x19_191015_c1 3300050514 Bacteria 1401
415 nmdc:mga08x19_395695_c1 3300050514 Unclassified 969
416 nmdc:mga08x19_462474_c1 3300050514 Bacteria 894
417 nmdc:mga08x19_586250_c1 3300050514 Unclassified 790
418 nmdc:mga08x19_904186_c1 3300050514 Bacteria 627
419 nmdc:mga0a205_186404_c1 3300050515 Bacteria 1968
420 nmdc:mga0a205_732127_c1 3300050515 Unclassified 838
421 Ga0495601_0288505 3300053077 Bacteria 1070
422 Ga0495612_0069818 3300053078 Bacteria 1464
423 Ga0495619_0062007 3300053085 Unclassified 2489
424 Ga0495619_0225400 3300053085 Bacteria 1298
425 Ga0500555_008469 3300053103 Unclassified 2933
426 Ga0501084_1496267 3300054114 Unclassified 565
427 Ga0501082_0421303 3300060353 Bacteria 1166
428 Ga0501082_1534905 3300060353 Bacteria 582
429 Ga0530510_0386682 3300061734 Bacteria 1053
430 Ga0501074_0471094
431 Ga0006759J45824_1031423
432 Ga0007410J51695_1034685
433 Ga0007409J51694_1024222
434 Ga0007416J51690_1044693
435 Ga0007429J51699_1067464
436 Ga0070676_11268252
437 Ga0070690_100017317
438 Ga0070690_100483279
439 Ga0070670_100545005
440 Ga0070670_100735029
441 Ga0068869_100148078
442 Ga0070666_10211824
443 Ga0070666_10301137
444 Ga0070666_10676204
445 Ga0070666_11206561
446 Ga0068868_100075874
447 Ga0068868_100163125
448 Ga0068868_100225619
449 Ga0070687_100218970
450 Ga0070687_100546209
451 Ga0070687_100647584
452 Ga0070661_100139650
453 Ga0070675_100274305
454 Ga0070674_100293425
455 Ga0070674_100734465
456 Ga0070673_100075027
457 Ga0070673_100178640
458 Ga0070673_102092183
459 Ga0070688_100194846
460 Ga0070688_101586443
461 Ga0070667_100106750
462 Ga0070714_100048056
463 Ga0070713_100122690
464 Ga0070711_100178792
465 Ga0070700_100112972
466 Ga0070708_101594067
467 Ga0070663_101359378
468 Ga0070662_100094529
469 Ga0068867_100018847
470 Ga0070685_10638654
471 Ga0070706_101480013
472 Ga0070707_100115110
473 Ga0070699_100003031
474 Ga0070699_100098713
475 Ga0070699_100929795
476 Ga0070684_100191783
477 Ga0070684_102182749
478 Ga0070697_100037660
479 Ga0070697_100401923
480 Ga0068853_100310816
481 Ga0068853_100929860
482 Ga0068853_100957819
483 Ga0070672_101383706
484 Ga0070686_100002422
485 Ga0070686_100113102
486 Ga0070695_100433872
487 Ga0070695_100590300
488 Ga0070693_100138744
489 Ga0070665_100022888
490 Ga0070665_100105265
491 Ga0070665_100389267
492 Ga0070665_102476145
493 Ga0070704_100238802
494 Ga0070704_100287556
495 Ga0070704_101039180
496 Ga0070664_100067577
497 Ga0070664_100228644
498 Ga0068857_101442881
499 Ga0068854_100015576
500 Ga0068856_100142570
501 Ga0068852_100374731
502 Ga0068852_100731386
503 Ga0068852_100876383
504 Ga0068852_102111432
505 Ga0068859_100762019
506 Ga0068864_100010165
507 Ga0068864_100056866
508 Ga0068866_10020095
509 Ga0068866_10241893
510 Ga0068870_10191566
511 Ga0068870_10839478
512 Ga0068863_100111492
513 Ga0068863_100171096
514 Ga0068858_100013605
515 Ga0068858_100558288
516 Ga0068858_101191660
517 Ga0068860_100105015
518 Ga0068860_100191642
519 Ga0068860_100844793
520 Ga0068862_100824022
521 Ga0068862_101653495
522 Ga0070716_100080476
523 Ga0097621_100006722
524 Ga0097621_100294092
525 Ga0097621_101882459
526 Ga0068871_100026412
527 Ga0068871_100303636
528 Ga0068871_100325506
529 Ga0075428_100521637
530 Ga0075430_100968387
531 Ga0075430_100982008
532 Ga0075431_100236416
533 Ga0075431_100240719
534 Ga0075433_10191195
535 Ga0075434_100000023
536 Ga0075434_100007078
537 Ga0075434_100073319
538 Ga0075434_100113851
539 Ga0075434_100528661
540 Ga0068865_100075454
541 Ga0068865_100410445
542 Ga0068865_100487122
543 Ga0075436_100003807
544 Ga0075436_100010734
545 Ga0075436_100110044
546 Ga0075436_100311568
547 Ga0075436_100650770
548 Ga0097620_100762033
549 Ga0075435_100000037
550 Ga0075435_100003997
551 Ga0075435_100039708
552 Ga0075435_100210962
553 Ga0075435_100525630
554 Ga0105240_10274855
555 Ga0105240_10321713
556 Ga0111539_10028404
557 Ga0111539_11087576
558 Ga0105245_10029958
559 Ga0105245_10129679
560 Ga0105245_10565722
561 Ga0105245_11116556
562 Ga0105247_10006215
563 Ga0105247_10280432
564 Ga0105247_10320709
565 Ga0105247_11086709
566 Ga0114129_10032241
567 Ga0114129_10283660
568 Ga0114129_10619712
569 Ga0114129_11106243
570 Ga0114129_11652577
571 Ga0105243_13039418
572 Ga0105241_10120690
573 Ga0105242_10007234
574 Ga0105242_10035914
575 Ga0105248_10005711
576 Ga0105248_10045431
577 Ga0105248_10210647
578 Ga0105248_10344581
579 Ga0105248_11280340
580 Ga0105237_11402467
581 Ga0105238_10310219
582 Ga0105238_10435323
583 Ga0105249_11322787
584 Ga0105249_11444472
585 Ga0105246_11272967
586 Ga0157370_10120180
587 Ga0157369_10074365
588 Ga0157374_10031070
589 Ga0157374_11517967
590 Ga0157378_10366644
591 Ga0157378_10920427
592 Ga0157378_11538078
593 Ga0157375_10518367
594 Ga0157375_12045222
595 Ga0163163_10021362
596 Ga0163163_10239907
597 Ga0157380_10010762
598 Ga0157380_10181768
599 Ga0157377_11038771
600 Ga0157379_10042060
601 Ga0157379_10436440
602 Ga0157379_10531154
603 Ga0157376_10291386
604 Ga0157376_10390003
605 Ga0163161_10492478
606 Ga0213876_10273877
607 Ga0207666_1036745
608 Ga0207697_10139588
609 Ga0207656_10063124
610 Ga0207656_10537889
611 Ga0207642_10149702
612 Ga0207710_10077572
613 Ga0207710_10084785
614 Ga0207680_10123780
615 Ga0207680_10254069
616 Ga0207680_10526802
617 Ga0207685_10173501
618 Ga0207645_10135999
619 Ga0207684_10360282
620 Ga0207684_11275235
621 Ga0207654_10179103
622 Ga0207695_10184660
623 Ga0207695_10519788
624 Ga0207671_10881647
625 Ga0207663_10739349
626 Ga0207660_10060914
627 Ga0207662_10204911
628 Ga0207657_10897263
629 Ga0207649_10488007
630 Ga0207646_10182661
631 Ga0207694_10505955
632 Ga0207694_10523771
633 Ga0207650_10347680
634 Ga0207650_10396659
635 Ga0207659_10177660
636 Ga0207687_10021291
637 Ga0207687_10088896
638 Ga0207687_10362997
639 Ga0207687_11047116
640 Ga0207664_10117128
641 Ga0207644_10449412
642 Ga0207686_10794154
643 Ga0207686_11284254
644 Ga0207669_10798685
645 Ga0207669_11618613
646 Ga0207704_10338104
647 Ga0207704_10387977
648 Ga0207704_10675655
649 Ga0207691_10027045
650 Ga0207711_10012100
651 Ga0207711_10378685
652 Ga0207711_10913064
653 Ga0207711_11779325
654 Ga0207689_10424010
655 Ga0207661_10193520
656 Ga0207679_10098456
657 Ga0207679_10386708
658 Ga0207651_10205111
659 Ga0207651_10501326
660 Ga0207651_10581969
661 Ga0207651_10707466
662 Ga0207651_11304098
663 Ga0207668_11093069
664 Ga0207658_10588725
665 Ga0207658_10778126
666 Ga0207658_10896031
667 Ga0207677_10071279
668 Ga0207677_10387076
669 Ga0207703_10033257
670 Ga0207703_10646096
671 Ga0207639_10646646
672 Ga0207708_10305317
673 Ga0207702_10170472
674 Ga0207641_10059266
675 Ga0207641_10249146
676 Ga0207648_10016700
677 Ga0207676_10068348
678 Ga0207674_10237171
679 Ga0207674_10527645
680 Ga0207675_100126832
681 Ga0207675_100808314
682 Ga0207683_10088038
683 Ga0207683_10102831
684 Ga0207698_10423906
685 Ga0207698_12362901
686 Ga0207428_10268221
687 Ga0268266_10003260
688 Ga0268266_10085017
689 Ga0268266_10153093
690 Ga0268266_10947952
691 Ga0268264_10054932
692 Ga0268264_10347447
693 Ga0268264_10793522
694 Ga0307517_10245307
695 Ga0307408_100728463
696 Ga0307405_10729891
697 Ga0307413_10861538
698 Ga0307410_10007757
699 Ga0307406_11281766
700 Ga0307407_10481449
701 Ga0307412_10077482
702 Ga0307409_100166252
703 Ga0307409_100588367
704 Ga0307416_100292642
705 Ga0307416_100446392
706 Ga0307416_101263596
707 Ga0307414_10490867
708 Ga0307411_10077646
709 Ga0373930_0005826
710 Ga0373950_0002124
711 Ga0373958_0001930
712 Ga0373959_0001792
713 Ga0373938_0001373
714 Ga0373928_0000596
715 Ga0373929_0000466
716 Ga0373934_0207558
717 Ga0373940_0000972
718 Ga0373944_0009842
719 Ga0373949_0001564
720 Ga0373951_0001058
721 Ga0373952_0000508
722 Ga0373932_0006596
723 Ga0373939_0001605
724 Ga0373941_0005492
725 Ga0373945_0364139
726 Ga0373960_0058420
727 Ga0373943_0658895
728 Ga0373946_0089332
729 Ga0373946_0145135
730 Ga0373955_0208073
731 Ga0373955_0513927
732 Ga0373942_0000395
733 Ga0373961_0005836
734 Ga0373931_0027258
735 Ga0373933_0589050
736 Ga0373933_0893322
737 Ga0373947_0038804
738 Ga0373937_0142476
739 Ga0373937_0618665
740 Ga0373937_1597832
741 Ga0395900_1301460
742 Ga0436365_0531443
743 Ga0436365_1294967
744 Ga0436362_0486824
745 Ga0439439_0076699
746 Ga0439453_0037085
747 Ga0451800_0406972
748 Ga0451807_1993033
749 Ga0450912_003471
750 Ga0450923_098295
751 Ga0450888_045845
752 Ga0439435_0010281
753 Ga0439460_0235436
754 Ga0466964_0562169
755 Ga0451576_0007030
756 Ga0466967_1121454
757 Ga0495629_0583477
758 Ga0495580_0185337
759 Ga0495582_0767842
760 Ga0495608_0172856
761 Ga0495630_0821674
762 Ga0495631_0236666
763 Ga0495644_0427010
764 Ga0495666_0104979
765 Ga0495640_0182442
766 Ga0495640_0305817
767 Ga0495645_0009199
768 Ga0495634_0296391
769 Ga0495634_0669755
770 Ga0495635_0237624
771 Ga0495647_0082425
772 Ga0495647_0094096
773 Ga0495647_0457579
774 Ga0495658_0023388
775 Ga0495658_0541839
776 Ga0495671_0590776
777 Ga0495649_0479034
778 Ga0495600_0037668
779 Ga0495674_0137726
780 Ga0495684_0268434
781 Ga0496100_0109997
782 Ga0496100_0445609
783 Ga0496100_0881055
784 Ga0496102_0197108
785 Ga0496104_0038873
786 Ga0496105_0577490
787 Ga0496106_0386227
788 Ga0496106_1110699
789 Ga0496107_0054724
790 Ga0496107_0534676
791 Ga0496107_0686762
792 Ga0496108_0594439
793 Ga0496109_0525030
794 Ga0496109_1315320
795 Ga0496109_1696936
796 Ga0496112_0019186
797 Ga0496112_0113311
798 Ga0496112_0166963
799 Ga0496114_0101151
800 Ga0496114_0534110
801 Ga0496114_0537674
802 Ga0496115_0072262
803 Ga0501033_1211327
804 Ga0501034_0019374
805 Ga0501036_0228702
806 Ga0501036_0594447
807 Ga0501037_0263884
808 Ga0501038_0764271
809 Ga0501040_0243920
810 Ga0501042_0218620
811 Ga0501046_1007310
812 Ga0501047_0259457
813 Ga0501048_0188129
814 Ga0501069_0365900
815 Ga0501072_1323058
816 Ga0501073_0015844
817 Ga0501076_0204404
818 Ga0501077_0450710
819 Ga0501079_1201048
820 Ga0501080_0570352
821 Ga0501081_0733592
822 Ga0501044_0018257
823 Ga0501045_0043561
824 nmdc:mga06z11_692412_c1
825 nmdc:mga05p37_1532491_c1
826 nmdc:mga05p37_32037_c1
827 nmdc:mga05p37_425512_c1
828 nmdc:mga0qj67_609043_c1
829 nmdc:mga06r32_188358_c1
830 nmdc:mga08y16_30770_c1
831 nmdc:mga0n895_1084290_c1
832 nmdc:mga0n895_115892_c1
833 nmdc:mga0n895_190014_c1
834 nmdc:mga0n895_365583_c1
835 nmdc:mga0n895_378649_c1
836 nmdc:mga0n895_67372_c1
837 nmdc:mga0n895_82211_c1
838 nmdc:mga0rr50_10346_c1
839 nmdc:mga0rr50_11550_c1
840 nmdc:mga0rr50_22399_c1
841 nmdc:mga0rr50_4_c1
842 nmdc:mga08x19_102_c1
843 nmdc:mga08x19_191015_c1
844 nmdc:mga08x19_395695_c1
845 nmdc:mga08x19_462474_c1
846 nmdc:mga08x19_586250_c1
847 nmdc:mga08x19_904186_c1
848 nmdc:mga0a205_186404_c1
849 nmdc:mga0a205_732127_c1
850 Ga0495601_0288505
851 Ga0495612_0069818
852 Ga0495619_0062007
853 Ga0495619_0225400
854 Ga0500555_008469
855 Ga0501084_1496267
856 Ga0501082_0421303
857 Ga0501082_1534905
858 Ga0530510_0386682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

43

144

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c4k-assembly1.cif.gz_A ancestral l-amino acid oxidase (anclaao-n5) ligand free form 0.7857 40 69
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7647 36 69
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7621 36 69
4fvm-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha 0.7351 35 71
8foe-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna 0.7351 35 71
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8424 40 67 2.30.29.30
af_Q58598_204_318_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7931 33 114 2.40.50.140
af_Q9UBZ4_1_312_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7903 49 69 3.60.10.10
af_Q3E8Y7_122_291_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.787 39 69 2.120.10.80
af_A4ICD3_527_625_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7565 29 98 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1Q7LF84-F1-model_v4 Uncharacterized protein 0.938 20 130
AF-A0A0Q6BSV4-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9277 15 131
AF-A0A2E4G7C4-F1-model_v4 Uncharacterized protein 0.9261 12 132
AF-A0A317HI40-F1-model_v4 FHA domain-containing protein 0.9232 12 130
AF-A0A6N8ZMG9-F1-model_v4 deleted 0.9212 15 132

Map