F441977

General Info

Members Datasets Scaffolds Average Seq Length
429 280 401 153

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0258919|Ga0495590_0258919_78_608
Length 176
Sequence MARKAAVVWRPTFPPKTWLFRKMSDGAQRGFTLLEMVCALAIIAMMAAVLLPFIPRNTSRSRLQAYAMQTATLLKADRNAAIRRGADVATLVDTGTRLIRSGATTDMVRIPDDVRFDALLPQSCNRRAALSTISFFASGMSCGGTIALTRLDAGYEIRVNWLTGRIEIVSRSSVTN

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
7 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
8 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
9 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
10 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
11 2904699407
12 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
13 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
14 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
15 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
16 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
17 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
18 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
19 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
20 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
21 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
22 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
23 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
24 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
112 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
113 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
114 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
255 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
256 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
257 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
258 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
264 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
265 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
269 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
270 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
273 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
274 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
277 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
278 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
279 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
280 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.69
Metatranscriptomes 0
Isolates 6.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.46
Nodule 5.83
Rhizoplane 10.72
Rhizosphere 66.43
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10095100 3300003320 Bacteria 3664
2 rootH1_10018507 3300003323 Bacteria 5206
3 JGI25404J52841_10000090 3300003659 Bacteria 8660
4 Ga0070683_100300078 3300005329 Bacteria 1528
5 Ga0070683_100815150 3300005329 Bacteria 895
6 Ga0068869_100105004 3300005334 Bacteria 2142
7 Ga0068868_100004145 3300005338 Bacteria 10131
8 Ga0070688_100280631 3300005365 Bacteria 1197
9 Ga0070709_10008246 3300005434 Bacteria 5720
10 Ga0070714_100012783 3300005435 Bacteria 6707
11 Ga0070714_100020575 3300005435 Bacteria 5392
12 Ga0070714_100070134 3300005435 Bacteria 3029
13 Ga0070714_100129154 3300005435 Bacteria 2257
14 Ga0070714_100204205 3300005435 Bacteria 1809
15 Ga0070714_100557731 3300005435 Bacteria 1097
16 Ga0070714_100926734 3300005435 Bacteria 846
17 Ga0070713_100000746 3300005436 Bacteria 20856
18 Ga0070713_100015479 3300005436 Bacteria 5707
19 Ga0070713_100060164 3300005436 Bacteria 3175
20 Ga0070713_100069227 3300005436 Bacteria 2975
21 Ga0070713_101176084 3300005436 Bacteria 742
22 Ga0070710_10008187 3300005437 Bacteria 5084
23 Ga0070710_10025026 3300005437 Bacteria 3156
24 Ga0070711_100001780 3300005439 Bacteria 11992
25 Ga0070711_100002949 3300005439 Bacteria 9811
26 Ga0070711_100062341 3300005439 Bacteria 2598
27 Ga0070711_100101351 3300005439 Bacteria 2095
28 Ga0070700_100374117 3300005441 Bacteria 1063
29 Ga0070708_100874529 3300005445 Bacteria 844
30 Ga0070663_100122621 3300005455 Bacteria 1965
31 Ga0070663_100171988 3300005455 Bacteria 1675
32 Ga0070663_100330974 3300005455 Bacteria 1228
33 Ga0070678_100008322 3300005456 Bacteria 6211
34 Ga0070681_11006280 3300005458 Bacteria 753
35 Ga0070685_10140065 3300005466 Bacteria 1522
36 Ga0070665_100083369 3300005548 Bacteria 3202
37 Ga0070665_100092740 3300005548 Bacteria 3025
38 Ga0070665_101125578 3300005548 Bacteria 796
39 Ga0070664_100434701 3300005564 Bacteria 1203
40 Ga0068856_100321823 3300005614 Bacteria 1564
41 Ga0068852_100020780 3300005616 Bacteria 5224
42 Ga0068859_100379904 3300005617 Bacteria 1508
43 Ga0068864_100053484 3300005618 Bacteria 3483
44 Ga0068864_100081138 3300005618 Bacteria 2843
45 Ga0068866_10229342 3300005718 Bacteria 1125
46 Ga0068851_10021179 3300005834 Bacteria 3156
47 Ga0068863_100594130 3300005841 Bacteria 1095
48 Ga0068858_100510904 3300005842 Unclassified 1161
49 Ga0068860_101296334 3300005843 Bacteria 749
50 Ga0081540_1002640 3300005983 Bacteria 14575
51 Ga0070717_10000983 3300006028 Bacteria 19067
52 Ga0070717_10015199 3300006028 Bacteria 5941
53 Ga0070717_10049533 3300006028 Bacteria 3448
54 Ga0070715_10003571 3300006163 Bacteria 4980
55 Ga0070715_10204572 3300006163 Bacteria 1005
56 Ga0070715_10512684 3300006163 Bacteria 689
57 Ga0070716_100001639 3300006173 Bacteria 10104
58 Ga0070716_100004309 3300006173 Bacteria 6780
59 Ga0070716_100176462 3300006173 Bacteria 1399
60 Ga0070716_100368187 3300006173 Bacteria 1023
61 Ga0070712_100002315 3300006175 Bacteria 11736
62 Ga0070712_100012295 3300006175 Bacteria 5440
63 Ga0070712_100111861 3300006175 Bacteria 2039
64 Ga0070712_100264615 3300006175 Bacteria 1379
65 Ga0070712_100772593 3300006175 Bacteria 823
66 Ga0075366_10162141 3300006195 Bacteria 1355
67 Ga0097621_100067874 3300006237 Bacteria 2939
68 Ga0075370_10029228 3300006353 Bacteria 3069
69 Ga0068871_100054118 3300006358 Bacteria 3255
70 Ga0068865_100050550 3300006881 Bacteria 2872
71 Ga0097620_100045982 3300006931 Bacteria 4385
72 Ga0097620_100379935 3300006931 Bacteria 1508
73 Ga0099824_1005999 3300006942 Bacteria 16878
74 Ga0099822_1000813 3300006943 Bacteria 32810
75 Ga0075435_100923732 3300007076 Bacteria 761
76 Ga0075435_101178307 3300007076 Bacteria 670
77 Ga0099794_10105582 3300007265 Bacteria 1408
78 Ga0099795_10004987 3300007788 Bacteria 3484
79 Ga0099795_10025565 3300007788 Bacteria 1981
80 Ga0105245_10014476 3300009098 Bacteria 6869
81 Ga0105247_10007848 3300009101 Bacteria 6530
82 Ga0105241_10774932 3300009174 Unclassified 881
83 Ga0105242_10249895 3300009176 Bacteria 1598
84 Ga0105237_10063018 3300009545 Bacteria 3706
85 Ga0105238_10088816 3300009551 Bacteria 3077
86 Ga0105238_11090537 3300009551 Bacteria 821
87 Ga0099796_10047417 3300010159 Bacteria 1478
88 Ga0099796_10138441 3300010159 Bacteria 949
89 Ga0105239_10437729 3300010375 Bacteria 1482
90 Ga0105246_10022904 3300011119 Bacteria 4037
91 Ga0157374_10030151 3300013296 Bacteria 4921
92 Ga0157374_10240013 3300013296 Bacteria 1782
93 Ga0163162_10038393 3300013306 Bacteria 4779
94 Ga0163162_10087534 3300013306 Bacteria 3193
95 Ga0163162_10105659 3300013306 Bacteria 2910
96 Ga0163162_11067196 3300013306 Bacteria 914
97 Ga0157375_10023357 3300013308 Bacteria 5706
98 Ga0157375_10068647 3300013308 Bacteria 3548
99 Ga0163163_10005459 3300014325 Bacteria 10990
100 Ga0163163_10581253 3300014325 Bacteria 1183
101 Ga0163163_11312574 3300014325 Bacteria 785
102 Ga0182008_10195891 3300014497 Bacteria 1026
103 Ga0157377_10122436 3300014745 Bacteria 1578
104 Ga0157379_10045533 3300014968 Bacteria 3915
105 Ga0157379_10134807 3300014968 Bacteria 2224
106 Ga0213876_10001555 3300021384 Bacteria 14111
107 Ga0213876_10023154 3300021384 Bacteria 3281
108 Ga0207692_10000701 3300025898 Bacteria 11788
109 Ga0207692_10035815 3300025898 Bacteria 2414
110 Ga0207642_10508242 3300025899 Bacteria 739
111 Ga0207685_10004561 3300025905 Bacteria 3542
112 Ga0207685_10226194 3300025905 Bacteria 892
113 Ga0207699_10003603 3300025906 Bacteria 7403
114 Ga0207699_10089532 3300025906 Bacteria 1929
115 Ga0207699_10227004 3300025906 Bacteria 1277
116 Ga0207705_10226252 3300025909 Bacteria 1422
117 Ga0207654_10557388 3300025911 Bacteria 814
118 Ga0207707_10893889 3300025912 Bacteria 735
119 Ga0207693_10008824 3300025915 Bacteria 8238
120 Ga0207693_10017515 3300025915 Bacteria 5712
121 Ga0207693_10019426 3300025915 Bacteria 5405
122 Ga0207693_10242996 3300025915 Bacteria 1413
123 Ga0207663_10002918 3300025916 Bacteria 8268
124 Ga0207663_10005443 3300025916 Bacteria 6415
125 Ga0207663_10010588 3300025916 Bacteria 4916
126 Ga0207663_10429618 3300025916 Bacteria 1015
127 Ga0207694_10318528 3300025924 Bacteria 1283
128 Ga0207694_10470015 3300025924 Bacteria 1051
129 Ga0207700_10037788 3300025928 Bacteria 3500
130 Ga0207700_10043123 3300025928 Bacteria 3312
131 Ga0207700_10103095 3300025928 Bacteria 2280
132 Ga0207700_10174736 3300025928 Bacteria 1794
133 Ga0207700_10260277 3300025928 Bacteria 1485
134 Ga0207664_10007148 3300025929 Bacteria 7740
135 Ga0207664_10018533 3300025929 Bacteria 5127
136 Ga0207664_10274480 3300025929 Bacteria 1478
137 Ga0207644_10618763 3300025931 Unclassified 900
138 Ga0207690_10359061 3300025932 Bacteria 1154
139 Ga0207704_10039972 3300025938 Bacteria 2737
140 Ga0207665_10000724 3300025939 Bacteria 22366
141 Ga0207665_10001400 3300025939 Bacteria 16221
142 Ga0207665_10005855 3300025939 Bacteria 8178
143 Ga0207665_10141609 3300025939 Bacteria 1715
144 Ga0207691_10200477 3300025940 Bacteria 1737
145 Ga0207679_11113979 3300025945 Bacteria 724
146 Ga0207677_10103791 3300026023 Bacteria 2099
147 Ga0207678_10228634 3300026067 Bacteria 1593
148 Ga0207678_10246590 3300026067 Bacteria 1530
149 Ga0207648_10731881 3300026089 Bacteria 918
150 Ga0207676_10023507 3300026095 Bacteria 4549
151 Ga0207676_10115361 3300026095 Bacteria 2255
152 Ga0207683_10005918 3300026121 Bacteria 10477
153 Ga0207698_10019671 3300026142 Bacteria 4628
154 Ga0209589_1000001 3300027357 Bacteria 794224
155 Ga0209489_100001 3300027361 Bacteria 794224
156 Ga0209700_100001 3300027363 Bacteria 794224
157 Ga0209179_1028432 3300027512 Bacteria 1133
158 Ga0268266_10029269 3300028379 Bacteria 4683
159 Ga0268266_10289205 3300028379 Bacteria 1526
160 Ga0268266_10928005 3300028379 Bacteria 842
161 Ga0307517_10379584 3300028786 Bacteria 756
162 Ga0265330_10141284 3300031235 Bacteria 1024
163 Ga0265339_10007722 3300031249 Bacteria 6916
164 Ga0265331_10064153 3300031250 Bacteria 1729
165 Ga0307508_10623249 3300031616 Bacteria 682
166 Ga0265314_10000822 3300031711 Bacteria 36961
167 Ga0265314_10028917 3300031711 Bacteria 4125
168 Ga0307510_10014666 3300033180 Bacteria 9275
169 Ga0373934_0208366 3300035086 Bacteria 805
170 Ga0373944_0006715 3300035089 Bacteria 3060
171 Ga0373923_0052385 3300035111 Bacteria 1714
172 Ga0373936_0010822 3300035113 Bacteria 3445
173 Ga0373945_0061660 3300035116 Bacteria 1401
174 Ga0373954_0024198 3300035118 Bacteria 2767
175 Ga0373954_0077911 3300035118 Bacteria 1581
176 Ga0373956_0048620 3300035119 Bacteria 1900
177 Ga0373956_0125941 3300035119 Bacteria 1198
178 Ga0373957_0019345 3300035120 Bacteria 2395
179 Ga0373943_0246402 3300035170 Bacteria 1002
180 Ga0373943_0795250 3300035170 Bacteria 563
181 Ga0373946_0123203 3300035171 Bacteria 1185
182 Ga0373955_0056236 3300035172 Bacteria 2158
183 Ga0373924_0030757 3300035410 Bacteria 2153
184 Ga0373935_0099118 3300035692 Bacteria 1918
185 Ga0373927_0069243 3300035695 Bacteria 2283
186 Ga0373933_0000688 3300035724 Bacteria 20820
187 Ga0373933_0095614 3300035724 Bacteria 1838
188 Ga0373933_0577444 3300035724 Bacteria 738
189 Ga0373947_0072440 3300035725 Bacteria 2116
190 Ga0373937_0088517 3300036401 Bacteria 2867
191 Ga0373937_0146377 3300036401 Bacteria 2211
192 Ga0373937_0309253 3300036401 Bacteria 1494
193 Ga0373925_0096930 3300037068 Bacteria 2261
194 Ga0373925_0161783 3300037068 Bacteria 1763
195 Ga0395900_0019255 3300037418 Bacteria 6959
196 Ga0395898_0329162 3300037466 Bacteria 1457
197 Ga0395901_0214564 3300038443 Bacteria 2013
198 Ga0395901_0799897 3300038443 Bacteria 932
199 Ga0436365_0390477 3300039437 Bacteria 38325
200 Ga0436365_1436395 3300039437 Bacteria 4104
201 Ga0436365_1829992 3300039437 Bacteria 23552
202 Ga0436360_0156120 3300039438 Bacteria 2203
203 Ga0436361_0720707 3300039447 Bacteria 855
204 Ga0436363_0238950 3300039450 Bacteria 653
205 Ga0436363_0394673 3300039450 Bacteria 2587
206 Ga0436363_0834782 3300039450 Bacteria 1119
207 Ga0436362_0367752 3300039453 Bacteria 3924
208 Ga0436362_0373566 3300039453 Bacteria 802
209 Ga0466969_0038159 3300044656 Bacteria 2419
210 Ga0466966_0033864 3300044684 Bacteria 3307
211 Ga0466964_0063991 3300044706 Bacteria 1538
212 Ga0466970_0118820 3300044765 Bacteria 1447
213 Ga0466959_0110575 3300045049 Bacteria 1961
214 Ga0466967_0053561 3300045976 Bacteria 3546
215 Ga0495592_0036942 3300046454 Bacteria 3677
216 Ga0495603_0198252 3300046455 Bacteria 1160
217 Ga0495590_0258919 3300046457 Bacteria 648
218 Ga0495638_0329261 3300046460 Bacteria 813
219 Ga0495651_0163773 3300046462 Bacteria 1591
220 Ga0495580_0014542 3300046472 Bacteria 5966
221 Ga0495582_0053227 3300046473 Bacteria 2232
222 Ga0495582_0136839 3300046473 Bacteria 1387
223 Ga0495639_0010793 3300046475 Bacteria 3932
224 Ga0495662_0038929 3300046476 Bacteria 2298
225 Ga0495664_0040328 3300046477 Bacteria 2760
226 Ga0495584_0066605 3300046491 Bacteria 1811
227 Ga0495585_0190964 3300046492 Bacteria 1048
228 Ga0495594_0241030 3300046499 Bacteria 1030
229 Ga0495594_0534165 3300046499 Bacteria 666
230 Ga0495596_0016381 3300046500 Bacteria 3081
231 Ga0495583_0215535 3300046506 Bacteria 777
232 Ga0495606_0154346 3300046507 Bacteria 1344
233 Ga0495606_0328596 3300046507 Bacteria 819
234 Ga0495608_0144896 3300046511 Bacteria 1515
235 Ga0495610_0129520 3300046512 Bacteria 1097
236 Ga0495618_0200142 3300046514 Bacteria 1264
237 Ga0495628_0053310 3300046516 Bacteria 3192
238 Ga0495630_0153321 3300046517 Bacteria 1753
239 Ga0495631_0100673 3300046518 Bacteria 1244
240 Ga0495632_0357525 3300046519 Bacteria 641
241 Ga0495637_0117005 3300046520 Bacteria 1029
242 Ga0495643_0286369 3300046522 Bacteria 756
243 Ga0495644_0234746 3300046523 Bacteria 711
244 Ga0495648_0003895 3300046524 Bacteria 12938
245 Ga0495648_0006893 3300046524 Bacteria 9168
246 Ga0495648_0101495 3300046524 Bacteria 1587
247 Ga0495666_0155416 3300046526 Bacteria 1062
248 Ga0495652_0356238 3300046529 Bacteria 1047
249 Ga0495665_0005846 3300046531 Bacteria 6637
250 Ga0495640_0146237 3300046533 Bacteria 1520
251 Ga0495645_0246472 3300046543 Bacteria 1189
252 Ga0495622_0231609 3300046557 Bacteria 816
253 Ga0495667_0143731 3300046559 Bacteria 1537
254 Ga0495667_0147643 3300046559 Bacteria 1514
255 Ga0495668_0099324 3300046616 Bacteria 1592
256 Ga0495634_0108655 3300046642 Bacteria 1785
257 Ga0495625_0280838 3300046660 Bacteria 1071
258 Ga0495635_0017671 3300046663 Bacteria 4981
259 Ga0495588_0203038 3300046674 Bacteria 1047
260 Ga0495657_0450921 3300046675 Bacteria 753
261 Ga0495599_0214809 3300046678 Bacteria 1178
262 Ga0495623_0256065 3300046679 Bacteria 982
263 Ga0495623_0421209 3300046679 Bacteria 715
264 Ga0495646_0097701 3300046680 Bacteria 1687
265 Ga0495647_0307464 3300046681 Bacteria 715
266 Ga0495658_0007557 3300046683 Bacteria 5386
267 Ga0495669_0052878 3300046684 Bacteria 1826
268 Ga0495669_0073129 3300046684 Bacteria 1565
269 Ga0495624_0066878 3300046690 Bacteria 2243
270 Ga0495671_0081940 3300046692 Bacteria 1581
271 Ga0495581_0005646 3300047315 Bacteria 7254
272 Ga0495604_0024655 3300047317 Bacteria 4799
273 Ga0495604_0271112 3300047317 Bacteria 1150
274 Ga0495674_0005980 3300047319 Bacteria 11677
275 Ga0495674_0936621 3300047319 Bacteria 667
276 Ga0495675_0197561 3300047444 Bacteria 1225
277 Ga0495677_0292550 3300047445 Bacteria 640
278 Ga0495684_0001884 3300047471 Bacteria 16806
279 Ga0495593_0101969 3300047673 Bacteria 1471
280 Ga0495602_0459514 3300048088 Bacteria 897
281 Ga0495614_0198362 3300048089 Bacteria 907
282 Ga0496100_0022400 3300048903 Bacteria 3823
283 Ga0496100_0654890 3300048903 Bacteria 818
284 Ga0496100_0655885 3300048903 Bacteria 817
285 Ga0496101_0001519 3300048904 Bacteria 13894
286 Ga0496101_0042487 3300048904 Bacteria 3245
287 Ga0496101_0350102 3300048904 Bacteria 1161
288 Ga0496101_1606375 3300048904 Bacteria 505
289 Ga0496102_0076287 3300048905 Bacteria 3083
290 Ga0496102_0126176 3300048905 Bacteria 2392
291 Ga0496103_0085285 3300048906 Bacteria 1990
292 Ga0496103_0197143 3300048906 Unclassified 1295
293 Ga0496104_0020403 3300048907 Bacteria 6073
294 Ga0496104_1344638 3300048907 Bacteria 617
295 Ga0496105_0126540 3300048908 Bacteria 2106
296 Ga0496105_1341101 3300048908 Bacteria 521
297 Ga0496106_0190051 3300048909 Bacteria 1632
298 Ga0496106_0212338 3300048909 Bacteria 1542
299 Ga0496106_0438684 3300048909 Unclassified 1049
300 Ga0496106_0587233 3300048909 Bacteria 893
301 Ga0496107_0000413 3300048910 Bacteria 23209
302 Ga0496107_0017819 3300048910 Bacteria 4998
303 Ga0496107_0165112 3300048910 Bacteria 1642
304 Ga0496108_0027559 3300048911 Bacteria 4693
305 Ga0496108_0148570 3300048911 Bacteria 2022
306 Ga0496108_0341117 3300048911 Bacteria 1307
307 Ga0496108_0481439 3300048911 Bacteria 1084
308 Ga0496109_0029600 3300048912 Bacteria 4905
309 Ga0496109_0142845 3300048912 Bacteria 2239
310 Ga0496109_0190784 3300048912 Bacteria 1926
311 Ga0496110_0037964 3300048913 Bacteria 4188
312 Ga0496110_0040855 3300048913 Bacteria 4044
313 Ga0496111_0429698 3300048914 Bacteria 975
314 Ga0496112_0015030 3300048915 Bacteria 7207
315 Ga0496112_0059707 3300048915 Bacteria 3758
316 Ga0496112_0530119 3300048915 Bacteria 1112
317 Ga0496113_0136687 3300048916 Bacteria 1926
318 Ga0496113_0396738 3300048916 Bacteria 1107
319 Ga0496113_0599668 3300048916 Bacteria 882
320 Ga0496114_0005565 3300048917 Bacteria 9874
321 Ga0496114_0249783 3300048917 Bacteria 1561
322 Ga0496114_0398630 3300048917 Bacteria 1218
323 Ga0496114_0854791 3300048917 Bacteria 790
324 Ga0496114_1038250 3300048917 Unclassified 703
325 Ga0496115_0010129 3300048918 Bacteria 7033
326 Ga0496115_0037355 3300048918 Bacteria 3849
327 Ga0496115_0057519 3300048918 Bacteria 3128
328 Ga0496118_0032931 3300048921 Bacteria 4260
329 Ga0496121_0000155 3300048924 Bacteria 149388
330 Ga0496121_0000481 3300048924 Bacteria 77294
331 Ga0496121_0085533 3300048924 Bacteria 2482
332 Ga0496121_0155962 3300048924 Bacteria 1675
333 Ga0496121_0167247 3300048924 Bacteria 1601
334 Ga0496121_0520315 3300048924 Bacteria 751
335 Ga0496124_0116251 3300048927 Bacteria 2144
336 Ga0496124_0414791 3300048927 Bacteria 930
337 Ga0496125_0201638 3300048928 Bacteria 1301
338 Ga0496126_0002713 3300048929 Bacteria 23398
339 Ga0496126_0010764 3300048929 Bacteria 9551
340 Ga0496126_0057142 3300048929 Bacteria 3524
341 Ga0496126_0077018 3300048929 Bacteria 2957
342 Ga0496126_0101123 3300048929 Bacteria 2522
343 Ga0496126_0115580 3300048929 Bacteria 2333
344 Ga0496126_0133842 3300048929 Bacteria 2140
345 Ga0496126_0207772 3300048929 Bacteria 1650
346 Ga0496126_0558052 3300048929 Bacteria 908
347 Ga0496126_0598696 3300048929 Unclassified 869
348 Ga0495678_106715 3300049459 Bacteria 962
349 Ga0495682_0174423 3300049460 Bacteria 764
350 Ga0501031_0004621 3300049568 Bacteria 8933
351 Ga0501031_0298525 3300049568 Bacteria 1044
352 Ga0501032_0049445 3300049569 Bacteria 2836
353 Ga0501032_0062482 3300049569 Bacteria 2495
354 Ga0501033_0000975 3300049570 Bacteria 25977
355 Ga0501037_0001403 3300049573 Bacteria 17665
356 Ga0501038_0001504 3300049574 Bacteria 21443
357 Ga0501038_0018759 3300049574 Bacteria 6245
358 Ga0501039_0219276 3300049575 Bacteria 1495
359 Ga0501041_0420154 3300049577 Bacteria 848
360 Ga0501042_0237674 3300049578 Bacteria 1314
361 Ga0501043_0096008 3300049579 Bacteria 2330
362 Ga0501046_0185323 3300049580 Bacteria 1554
363 Ga0501068_0171357 3300049584 Bacteria 1370
364 Ga0501073_0169666 3300049589 Bacteria 1511
365 Ga0501080_0244801 3300049742 Bacteria 1636
366 Ga0501035_0007268 3300049822 Bacteria 10359
367 Ga0501044_0032956 3300049823 Bacteria 5445
368 nmdc:mga0n895_51469_c1 3300050512 Bacteria 4040
369 Ga0495612_0003680 3300053078 Bacteria 6361
370 Ga0500635_0243649 3300053080 Bacteria 704
371 Ga0495619_0107328 3300053085 Bacteria 1905
372 Ga0500583_0216894 3300053092 Bacteria 949
373 Ga0500650_0188421 3300053098 Bacteria 943
374 Ga0500554_000962 3300053102 Bacteria 5598
375 Ga0500562_136175 3300053108 Bacteria 669
376 Ga0500572_000014 3300053111 Bacteria 52727
377 Ga0500572_000448 3300053111 Bacteria 14369
378 Ga0500595_000234 3300053119 Bacteria 37453
379 Ga0500595_059854 3300053119 Bacteria 1154
380 Ga0500658_0025133 3300053134 Bacteria 2287
381 Ga0500559_0000455 3300053136 Bacteria 29161
382 Ga0500559_0001116 3300053136 Bacteria 16151
383 Ga0500568_0018715 3300053139 Bacteria 3024
384 Ga0500589_233311 3300053147 Bacteria 685
385 Ga0500590_123966 3300053148 Bacteria 1206
386 Ga0500603_001823 3300053150 Bacteria 4781
387 Ga0500603_031314 3300053150 Bacteria 1374
388 Ga0500604_0060700 3300053151 Bacteria 1187
389 Ga0500622_0142899 3300053156 Bacteria 1139
390 Ga0500634_0018562 3300053161 Bacteria 3738
391 Ga0500638_001359 3300053162 Bacteria 7565
392 Ga0500639_005138 3300053163 Bacteria 6676
393 Ga0500639_021659 3300053163 Bacteria 3397
394 Ga0500636_0006930 3300053177 Bacteria 6533
395 Ga0500637_0000709 3300053178 Bacteria 13296
396 Ga0500637_0137726 3300053178 Bacteria 1413
397 Ga0500576_053249 3300053725 Bacteria 1789
398 Ga0500596_000980 3300053735 Bacteria 5699
399 Ga0500596_005132 3300053735 Bacteria 2336
400 Ga0501084_0449340 3300054114 Bacteria 1090
401 Ga0500661_000347 3300055283 Bacteria 8438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048089 Ga0495614_0198362 Ga0495614_0198362_451_876 133
2 3300053085 Ga0495619_0107328 Ga0495619_0107328_1449_1874 133
3 3300050512 nmdc:mga0n895_51469_c1 nmdc:mga0n895_51469_c1_1789_2274 134
4 3300046460 Ga0495638_0329261 Ga0495638_0329261_196_630 136
5 iso_pu_bacteria 2513237141 2513889853 136
6 3300005439 Ga0070711_100101351 Ga0070711_1001013513 137
7 3300005455 Ga0070663_100171988 Ga0070663_1001719883 137
8 3300005564 Ga0070664_100434701 Ga0070664_1004347012 137
9 3300005617 Ga0068859_100379904 Ga0068859_1003799042 137
10 3300005618 Ga0068864_100081138 Ga0068864_1000811384 137
11 3300005841 Ga0068863_100594130 Ga0068863_1005941301 137
12 3300005842 Ga0068858_100510904 Ga0068858_1005109042 137
13 3300006931 Ga0097620_100379935 Ga0097620_1003799352 137
14 3300009174 Ga0105241_10774932 Ga0105241_107749322 137
15 3300010375 Ga0105239_10437729 Ga0105239_104377293 137
16 3300013296 Ga0157374_10240013 Ga0157374_102400133 137
17 3300013306 Ga0163162_10087534 Ga0163162_100875344 137
18 3300013308 Ga0157375_10068647 Ga0157375_100686473 137
19 3300014325 Ga0163163_10005459 Ga0163163_100054595 137
20 3300014968 Ga0157379_10045533 Ga0157379_100455335 137
21 3300025911 Ga0207654_10557388 Ga0207654_105573882 137
22 3300025931 Ga0207644_10618763 Ga0207644_106187632 137
23 3300025932 Ga0207690_10359061 Ga0207690_103590612 137
24 3300026067 Ga0207678_10228634 Ga0207678_102286343 137
25 3300026095 Ga0207676_10023507 Ga0207676_100235075 137
26 3300048904 Ga0496101_0042487 Ga0496101_0042487_2479_2964 137
27 3300048905 Ga0496102_0076287 Ga0496102_0076287_2040_2525 137
28 3300048906 Ga0496103_0197143 Ga0496103_0197143_669_1154 137
29 3300048907 Ga0496104_0020403 Ga0496104_0020403_278_763 137
30 3300048909 Ga0496106_0438684 Ga0496106_0438684_382_867 137
31 3300048911 Ga0496108_0148570 Ga0496108_0148570_637_1122 137
32 3300048913 Ga0496110_0040855 Ga0496110_0040855_3252_3737 137
33 3300048915 Ga0496112_0015030 Ga0496112_0015030_814_1299 137
34 3300048916 Ga0496113_0136687 Ga0496113_0136687_1168_1653 137
35 3300048917 Ga0496114_1038250 Ga0496114_1038250_171_656 137
36 iso_pu_bacteria 2508501128 2509147760 140
37 iso_pu_bacteria 2908756301 2908759743 140
38 3300046524 Ga0495648_0003895 Ga0495648_0003895_10298_10762 141
39 3300047319 Ga0495674_0936621 Ga0495674_0936621_147_611 141
40 3300053111 Ga0500572_000448 Ga0500572_000448_13474_13938 141
41 3300053136 Ga0500559_0001116 Ga0500559_0001116_4381_4845 141
42 3300053163 Ga0500639_021659 Ga0500639_021659_2172_2636 141
43 3300053725 Ga0500576_053249 Ga0500576_053249_565_1029 141
44 3300053735 Ga0500596_000980 Ga0500596_000980_3104_3568 141
45 iso_pu_bacteria 2888378607 2888380578 141
46 iso_pu_bacteria 2908775508 2908775622 141
47 iso_pu_bacteria 2935864058 2935870165 141
48 3300005435 Ga0070714_100129154 Ga0070714_1001291544 142
49 3300006175 Ga0070712_100264615 Ga0070712_1002646152 142
50 3300025929 Ga0207664_10274480 Ga0207664_102744802 142
51 3300048929 Ga0496126_0133842 Ga0496126_0133842_1665_2129 142
52 3300049568 Ga0501031_0004621 Ga0501031_0004621_8322_8786 142
53 3300049568 Ga0501031_0298525 Ga0501031_0298525_302_775 142
54 3300049569 Ga0501032_0049445 Ga0501032_0049445_80_544 142
55 3300049569 Ga0501032_0062482 Ga0501032_0062482_1680_2153 142
56 3300049570 Ga0501033_0000975 Ga0501033_0000975_17361_17825 142
57 3300049573 Ga0501037_0001403 Ga0501037_0001403_16988_17452 142
58 3300049574 Ga0501038_0001504 Ga0501038_0001504_4571_5044 142
59 3300049574 Ga0501038_0018759 Ga0501038_0018759_1805_2269 142
60 3300049575 Ga0501039_0219276 Ga0501039_0219276_652_1125 142
61 3300049577 Ga0501041_0420154 Ga0501041_0420154_341_805 142
62 3300049578 Ga0501042_0237674 Ga0501042_0237674_651_1115 142
63 3300049579 Ga0501043_0096008 Ga0501043_0096008_39_503 142
64 3300049580 Ga0501046_0185323 Ga0501046_0185323_654_1118 142
65 3300049584 Ga0501068_0171357 Ga0501068_0171357_226_690 142
66 3300049589 Ga0501073_0169666 Ga0501073_0169666_801_1265 142
67 3300049742 Ga0501080_0244801 Ga0501080_0244801_1004_1468 142
68 3300049822 Ga0501035_0007268 Ga0501035_0007268_8928_9392 142
69 3300049823 Ga0501044_0032956 Ga0501044_0032956_3684_4148 142
70 3300054114 Ga0501084_0449340 Ga0501084_0449340_602_1066 142
71 iso_pu_bacteria 2513237098 2513678964 142
72 iso_pu_bacteria 2513237137 2513858725 142
73 iso_pu_bacteria 2885383462 2885387601 142
74 iso_pu_bacteria 2903748898 2903759158 142
75 iso_pu_bacteria 2903768456 2903772868 142
76 iso_pu_bacteria 2904699407 2904709915 142
77 iso_pu_bacteria 2906635258 2906636668 142
78 iso_pu_bacteria 2906660503 2906663114 142
79 iso_pu_bacteria 2935908558 2935916226 142
80 iso_pu_bacteria 2935916978 2935924346 142
81 iso_pu_bacteria 2935926038 2935933668 142
82 iso_pu_bacteria 2935934488 2935942197 142
83 iso_pu_bacteria 2935942939 2935950644 142
84 iso_pu_bacteria 2935951376 2935959104 142
85 iso_pu_bacteria 2935967501 2935975379 142
86 iso_pu_bacteria 8019687851 8019691887 142
87 iso_pu_bacteria 8056689827 8056691486 142
88 3300005365 Ga0070688_100280631 Ga0070688_1002806313 143
89 3300048904 Ga0496101_1606375 Ga0496101_1606375_25_486 143
90 3300048909 Ga0496106_0587233 Ga0496106_0587233_370_834 143
91 3300048929 Ga0496126_0598696 Ga0496126_0598696_377_838 143
92 iso_pu_bacteria 2904690495 2904697920 143
93 3300039438 Ga0436360_0156120 Ga0436360_0156120_1098_1562 144
94 3300039453 Ga0436362_0373566 Ga0436362_0373566_164_628 144
95 3300044706 Ga0466964_0063991 Ga0466964_0063991_773_1246 144
96 3300045976 Ga0466967_0053561 Ga0466967_0053561_2042_2515 144
97 3300048929 Ga0496126_0558052 Ga0496126_0558052_212_670 144
98 3300005548 Ga0070665_100083369 Ga0070665_1000833692 145
99 3300013306 Ga0163162_11067196 Ga0163162_110671962 145
100 3300025924 Ga0207694_10470015 Ga0207694_104700152 145
101 3300028379 Ga0268266_10289205 Ga0268266_102892052 145
102 3300031235 Ga0265330_10141284 Ga0265330_101412842 145
103 3300035724 Ga0373933_0577444 Ga0373933_0577444_25_486 145
104 3300036401 Ga0373937_0088517 Ga0373937_0088517_1289_1750 145
105 3300039447 Ga0436361_0720707 Ga0436361_0720707_266_742 145
106 3300039450 Ga0436363_0834782 Ga0436363_0834782_410_871 145
107 3300044656 Ga0466969_0038159 Ga0466969_0038159_540_1001 145
108 3300044684 Ga0466966_0033864 Ga0466966_0033864_2399_2860 145
109 3300044765 Ga0466970_0118820 Ga0466970_0118820_743_1204 145
110 3300045049 Ga0466959_0110575 Ga0466959_0110575_949_1410 145
111 3300046462 Ga0495651_0163773 Ga0495651_0163773_832_1293 145
112 3300048088 Ga0495602_0459514 Ga0495602_0459514_325_786 145
113 3300048910 Ga0496107_0165112 Ga0496107_0165112_958_1428 145
114 3300048921 Ga0496118_0032931 Ga0496118_0032931_1026_1496 145
115 3300048929 Ga0496126_0077018 Ga0496126_0077018_2395_2865 145
116 iso_pu_bacteria 2524023228 2524535485 145
117 iso_pu_bacteria 2935959822 2935961581 145
118 iso_pu_bacteria 8006933436 8006935217 145
119 iso_pu_bacteria 8006973647 8006975186 145
120 3300003659 JGI25404J52841_10000090 JGI25404J52841_100000905 146
121 3300005329 Ga0070683_100300078 Ga0070683_1003000783 146
122 3300005329 Ga0070683_100815150 Ga0070683_1008151502 146
123 3300005334 Ga0068869_100105004 Ga0068869_1001050043 146
124 3300005338 Ga0068868_100004145 Ga0068868_1000041459 146
125 3300005434 Ga0070709_10008246 Ga0070709_100082466 146
126 3300005435 Ga0070714_100012783 Ga0070714_1000127837 146
127 3300005435 Ga0070714_100070134 Ga0070714_1000701343 146
128 3300005435 Ga0070714_100204205 Ga0070714_1002042052 146
129 3300005435 Ga0070714_100557731 Ga0070714_1005577312 146
130 3300005435 Ga0070714_100926734 Ga0070714_1009267342 146
131 3300005436 Ga0070713_100000746 Ga0070713_1000007465 146
132 3300005436 Ga0070713_100060164 Ga0070713_1000601643 146
133 3300005436 Ga0070713_100069227 Ga0070713_1000692273 146
134 3300005436 Ga0070713_101176084 Ga0070713_1011760842 146
135 3300005437 Ga0070710_10025026 Ga0070710_100250262 146
136 3300005439 Ga0070711_100002949 Ga0070711_10000294910 146
137 3300005439 Ga0070711_100062341 Ga0070711_1000623413 146
138 3300005441 Ga0070700_100374117 Ga0070700_1003741172 146
139 3300005455 Ga0070663_100122621 Ga0070663_1001226213 146
140 3300005455 Ga0070663_100330974 Ga0070663_1003309743 146
141 3300005456 Ga0070678_100008322 Ga0070678_1000083225 146
142 3300005458 Ga0070681_11006280 Ga0070681_110062801 146
143 3300005466 Ga0070685_10140065 Ga0070685_101400652 146
144 3300005548 Ga0070665_100092740 Ga0070665_1000927404 146
145 3300005548 Ga0070665_101125578 Ga0070665_1011255782 146
146 3300005614 Ga0068856_100321823 Ga0068856_1003218232 146
147 3300005616 Ga0068852_100020780 Ga0068852_1000207806 146
148 3300005618 Ga0068864_100053484 Ga0068864_1000534842 146
149 3300005718 Ga0068866_10229342 Ga0068866_102293422 146
150 3300005834 Ga0068851_10021179 Ga0068851_100211792 146
151 3300005843 Ga0068860_101296334 Ga0068860_1012963342 146
152 3300005983 Ga0081540_1002640 Ga0081540_100264010 146
153 3300006028 Ga0070717_10000983 Ga0070717_100009836 146
154 3300006028 Ga0070717_10049533 Ga0070717_100495333 146
155 3300006163 Ga0070715_10003571 Ga0070715_100035715 146
156 3300006163 Ga0070715_10204572 Ga0070715_102045722 146
157 3300006173 Ga0070716_100004309 Ga0070716_1000043093 146
158 3300006173 Ga0070716_100176462 Ga0070716_1001764622 146
159 3300006173 Ga0070716_100368187 Ga0070716_1003681872 146
160 3300006175 Ga0070712_100002315 Ga0070712_10000231511 146
161 3300006175 Ga0070712_100111861 Ga0070712_1001118613 146
162 3300006175 Ga0070712_100772593 Ga0070712_1007725932 146
163 3300006195 Ga0075366_10162141 Ga0075366_101621412 146
164 3300006237 Ga0097621_100067874 Ga0097621_1000678744 146
165 3300006353 Ga0075370_10029228 Ga0075370_100292283 146
166 3300006358 Ga0068871_100054118 Ga0068871_1000541183 146
167 3300006881 Ga0068865_100050550 Ga0068865_1000505504 146
168 3300006942 Ga0099824_1005999 Ga0099824_100599910 146
169 3300006943 Ga0099822_1000813 Ga0099822_10008133 146
170 3300007076 Ga0075435_100923732 Ga0075435_1009237322 146
171 3300007076 Ga0075435_101178307 Ga0075435_1011783072 146
172 3300007265 Ga0099794_10105582 Ga0099794_101055823 146
173 3300007788 Ga0099795_10004987 Ga0099795_100049874 146
174 3300007788 Ga0099795_10025565 Ga0099795_100255653 146
175 3300009098 Ga0105245_10014476 Ga0105245_100144766 146
176 3300009176 Ga0105242_10249895 Ga0105242_102498952 146
177 3300009551 Ga0105238_11090537 Ga0105238_110905372 146
178 3300010159 Ga0099796_10047417 Ga0099796_100474172 146
179 3300010159 Ga0099796_10138441 Ga0099796_101384412 146
180 3300011119 Ga0105246_10022904 Ga0105246_100229045 146
181 3300013296 Ga0157374_10030151 Ga0157374_100301513 146
182 3300013306 Ga0163162_10038393 Ga0163162_100383934 146
183 3300013306 Ga0163162_10105659 Ga0163162_101056592 146
184 3300013308 Ga0157375_10023357 Ga0157375_100233571 146
185 3300014325 Ga0163163_10581253 Ga0163163_105812531 146
186 3300014497 Ga0182008_10195891 Ga0182008_101958911 146
187 3300014745 Ga0157377_10122436 Ga0157377_101224363 146
188 3300014968 Ga0157379_10134807 Ga0157379_101348073 146
189 3300021384 Ga0213876_10023154 Ga0213876_100231544 146
190 3300025898 Ga0207692_10035815 Ga0207692_100358154 146
191 3300025899 Ga0207642_10508242 Ga0207642_105082422 146
192 3300025905 Ga0207685_10004561 Ga0207685_100045613 146
193 3300025906 Ga0207699_10089532 Ga0207699_100895323 146
194 3300025906 Ga0207699_10227004 Ga0207699_102270043 146
195 3300025909 Ga0207705_10226252 Ga0207705_102262523 146
196 3300025912 Ga0207707_10893889 Ga0207707_108938892 146
197 3300025915 Ga0207693_10008824 Ga0207693_100088243 146
198 3300025915 Ga0207693_10017515 Ga0207693_100175157 146
199 3300025915 Ga0207693_10242996 Ga0207693_102429962 146
200 3300025916 Ga0207663_10005443 Ga0207663_100054432 146
201 3300025916 Ga0207663_10010588 Ga0207663_100105885 146
202 3300025916 Ga0207663_10429618 Ga0207663_104296182 146
203 3300025924 Ga0207694_10318528 Ga0207694_103185282 146
204 3300025928 Ga0207700_10037788 Ga0207700_100377883 146
205 3300025928 Ga0207700_10043123 Ga0207700_100431233 146
206 3300025928 Ga0207700_10103095 Ga0207700_101030953 146
207 3300025928 Ga0207700_10174736 Ga0207700_101747363 146
208 3300025929 Ga0207664_10007148 Ga0207664_100071484 146
209 3300025938 Ga0207704_10039972 Ga0207704_100399723 146
210 3300025939 Ga0207665_10000724 Ga0207665_100007247 146
211 3300025939 Ga0207665_10005855 Ga0207665_1000585510 146
212 3300025939 Ga0207665_10141609 Ga0207665_101416093 146
213 3300025940 Ga0207691_10200477 Ga0207691_102004773 146
214 3300025945 Ga0207679_11113979 Ga0207679_111139792 146
215 3300026023 Ga0207677_10103791 Ga0207677_101037913 146
216 3300026067 Ga0207678_10246590 Ga0207678_102465903 146
217 3300026089 Ga0207648_10731881 Ga0207648_107318812 146
218 3300026095 Ga0207676_10115361 Ga0207676_101153612 146
219 3300026121 Ga0207683_10005918 Ga0207683_100059184 146
220 3300026142 Ga0207698_10019671 Ga0207698_100196713 146
221 3300027357 Ga0209589_1000001 Ga0209589_1000001530 146
222 3300027361 Ga0209489_100001 Ga0209489_100001530 146
223 3300027363 Ga0209700_100001 Ga0209700_100001530 146
224 3300027512 Ga0209179_1028432 Ga0209179_10284322 146
225 3300028379 Ga0268266_10029269 Ga0268266_100292693 146
226 3300028379 Ga0268266_10928005 Ga0268266_109280052 146
227 3300028786 Ga0307517_10379584 Ga0307517_103795842 146
228 3300031711 Ga0265314_10000822 Ga0265314_1000082217 146
229 3300033180 Ga0307510_10014666 Ga0307510_100146663 146
230 3300035086 Ga0373934_0208366 Ga0373934_0208366_264_737 146
231 3300035089 Ga0373944_0006715 Ga0373944_0006715_99_572 146
232 3300035111 Ga0373923_0052385 Ga0373923_0052385_915_1388 146
233 3300035113 Ga0373936_0010822 Ga0373936_0010822_1813_2286 146
234 3300035116 Ga0373945_0061660 Ga0373945_0061660_523_996 146
235 3300035118 Ga0373954_0024198 Ga0373954_0024198_752_1225 146
236 3300035118 Ga0373954_0077911 Ga0373954_0077911_161_625 146
237 3300035119 Ga0373956_0048620 Ga0373956_0048620_1280_1744 146
238 3300035119 Ga0373956_0125941 Ga0373956_0125941_275_748 146
239 3300035120 Ga0373957_0019345 Ga0373957_0019345_1610_2083 146
240 3300035170 Ga0373943_0246402 Ga0373943_0246402_459_932 146
241 3300035170 Ga0373943_0795250 Ga0373943_0795250_22_486 146
242 3300035171 Ga0373946_0123203 Ga0373946_0123203_405_878 146
243 3300035172 Ga0373955_0056236 Ga0373955_0056236_132_596 146
244 3300035410 Ga0373924_0030757 Ga0373924_0030757_1656_2129 146
245 3300035692 Ga0373935_0099118 Ga0373935_0099118_456_929 146
246 3300035695 Ga0373927_0069243 Ga0373927_0069243_1160_1633 146
247 3300035724 Ga0373933_0000688 Ga0373933_0000688_11394_11858 146
248 3300035724 Ga0373933_0095614 Ga0373933_0095614_1027_1491 146
249 3300035725 Ga0373947_0072440 Ga0373947_0072440_1323_1796 146
250 3300036401 Ga0373937_0146377 Ga0373937_0146377_1168_1632 146
251 3300036401 Ga0373937_0309253 Ga0373937_0309253_638_1111 146
252 3300037068 Ga0373925_0096930 Ga0373925_0096930_1193_1666 146
253 3300037068 Ga0373925_0161783 Ga0373925_0161783_1034_1498 146
254 3300037418 Ga0395900_0019255 Ga0395900_0019255_1963_2427 146
255 3300037466 Ga0395898_0329162 Ga0395898_0329162_978_1442 146
256 3300038443 Ga0395901_0214564 Ga0395901_0214564_560_1024 146
257 3300038443 Ga0395901_0799897 Ga0395901_0799897_414_878 146
258 3300039437 Ga0436365_0390477 Ga0436365_0390477_32001_32465 146
259 3300039437 Ga0436365_1436395 Ga0436365_1436395_3256_3720 146
260 3300039450 Ga0436363_0238950 Ga0436363_0238950_126_590 146
261 3300039453 Ga0436362_0367752 Ga0436362_0367752_161_625 146
262 3300046454 Ga0495592_0036942 Ga0495592_0036942_2834_3307 146
263 3300046455 Ga0495603_0198252 Ga0495603_0198252_248_721 146
264 3300046457 Ga0495590_0258919 Ga0495590_0258919_78_608 146
265 3300046472 Ga0495580_0014542 Ga0495580_0014542_852_1325 146
266 3300046473 Ga0495582_0053227 Ga0495582_0053227_237_710 146
267 3300046473 Ga0495582_0136839 Ga0495582_0136839_211_675 146
268 3300046475 Ga0495639_0010793 Ga0495639_0010793_2155_2628 146
269 3300046476 Ga0495662_0038929 Ga0495662_0038929_288_761 146
270 3300046477 Ga0495664_0040328 Ga0495664_0040328_473_946 146
271 3300046491 Ga0495584_0066605 Ga0495584_0066605_904_1368 146
272 3300046492 Ga0495585_0190964 Ga0495585_0190964_195_659 146
273 3300046499 Ga0495594_0241030 Ga0495594_0241030_26_499 146
274 3300046499 Ga0495594_0534165 Ga0495594_0534165_11_475 146
275 3300046500 Ga0495596_0016381 Ga0495596_0016381_1385_1849 146
276 3300046506 Ga0495583_0215535 Ga0495583_0215535_297_761 146
277 3300046507 Ga0495606_0154346 Ga0495606_0154346_843_1307 146
278 3300046507 Ga0495606_0328596 Ga0495606_0328596_195_659 146
279 3300046511 Ga0495608_0144896 Ga0495608_0144896_208_681 146
280 3300046512 Ga0495610_0129520 Ga0495610_0129520_521_985 146
281 3300046514 Ga0495618_0200142 Ga0495618_0200142_109_582 146
282 3300046516 Ga0495628_0053310 Ga0495628_0053310_759_1232 146
283 3300046517 Ga0495630_0153321 Ga0495630_0153321_511_984 146
284 3300046518 Ga0495631_0100673 Ga0495631_0100673_637_1101 146
285 3300046519 Ga0495632_0357525 Ga0495632_0357525_143_607 146
286 3300046520 Ga0495637_0117005 Ga0495637_0117005_385_849 146
287 3300046522 Ga0495643_0286369 Ga0495643_0286369_120_584 146
288 3300046523 Ga0495644_0234746 Ga0495644_0234746_79_543 146
289 3300046524 Ga0495648_0006893 Ga0495648_0006893_7388_7852 146
290 3300046524 Ga0495648_0101495 Ga0495648_0101495_631_1095 146
291 3300046526 Ga0495666_0155416 Ga0495666_0155416_166_639 146
292 3300046529 Ga0495652_0356238 Ga0495652_0356238_526_990 146
293 3300046531 Ga0495665_0005846 Ga0495665_0005846_1565_2038 146
294 3300046533 Ga0495640_0146237 Ga0495640_0146237_547_1020 146
295 3300046543 Ga0495645_0246472 Ga0495645_0246472_374_847 146
296 3300046557 Ga0495622_0231609 Ga0495622_0231609_154_627 146
297 3300046559 Ga0495667_0143731 Ga0495667_0143731_709_1173 146
298 3300046559 Ga0495667_0147643 Ga0495667_0147643_1017_1490 146
299 3300046616 Ga0495668_0099324 Ga0495668_0099324_625_1089 146
300 3300046642 Ga0495634_0108655 Ga0495634_0108655_275_748 146
301 3300046660 Ga0495625_0280838 Ga0495625_0280838_338_802 146
302 3300046663 Ga0495635_0017671 Ga0495635_0017671_3752_4225 146
303 3300046674 Ga0495588_0203038 Ga0495588_0203038_456_929 146
304 3300046675 Ga0495657_0450921 Ga0495657_0450921_18_491 146
305 3300046678 Ga0495599_0214809 Ga0495599_0214809_275_748 146
306 3300046679 Ga0495623_0256065 Ga0495623_0256065_99_572 146
307 3300046679 Ga0495623_0421209 Ga0495623_0421209_144_608 146
308 3300046680 Ga0495646_0097701 Ga0495646_0097701_982_1455 146
309 3300046681 Ga0495647_0307464 Ga0495647_0307464_66_539 146
310 3300046683 Ga0495658_0007557 Ga0495658_0007557_2147_2620 146
311 3300046684 Ga0495669_0052878 Ga0495669_0052878_190_654 146
312 3300046684 Ga0495669_0073129 Ga0495669_0073129_758_1222 146
313 3300046690 Ga0495624_0066878 Ga0495624_0066878_789_1262 146
314 3300046692 Ga0495671_0081940 Ga0495671_0081940_362_826 146
315 3300047315 Ga0495581_0005646 Ga0495581_0005646_3766_4239 146
316 3300047317 Ga0495604_0024655 Ga0495604_0024655_4074_4547 146
317 3300047317 Ga0495604_0271112 Ga0495604_0271112_190_654 146
318 3300047319 Ga0495674_0005980 Ga0495674_0005980_10819_11292 146
319 3300047444 Ga0495675_0197561 Ga0495675_0197561_251_724 146
320 3300047445 Ga0495677_0292550 Ga0495677_0292550_152_616 146
321 3300047471 Ga0495684_0001884 Ga0495684_0001884_14708_15181 146
322 3300047673 Ga0495593_0101969 Ga0495593_0101969_360_833 146
323 3300048903 Ga0496100_0022400 Ga0496100_0022400_2171_2635 146
324 3300048903 Ga0496100_0654890 Ga0496100_0654890_307_771 146
325 3300048903 Ga0496100_0655885 Ga0496100_0655885_271_735 146
326 3300048904 Ga0496101_0001519 Ga0496101_0001519_1125_1589 146
327 3300048904 Ga0496101_0350102 Ga0496101_0350102_532_996 146
328 3300048905 Ga0496102_0126176 Ga0496102_0126176_242_706 146
329 3300048906 Ga0496103_0085285 Ga0496103_0085285_1482_1946 146
330 3300048907 Ga0496104_1344638 Ga0496104_1344638_48_512 146
331 3300048908 Ga0496105_0126540 Ga0496105_0126540_221_685 146
332 3300048908 Ga0496105_1341101 Ga0496105_1341101_16_480 146
333 3300048909 Ga0496106_0190051 Ga0496106_0190051_973_1437 146
334 3300048909 Ga0496106_0212338 Ga0496106_0212338_961_1434 146
335 3300048910 Ga0496107_0000413 Ga0496107_0000413_7701_8165 146
336 3300048910 Ga0496107_0017819 Ga0496107_0017819_4091_4555 146
337 3300048911 Ga0496108_0027559 Ga0496108_0027559_4036_4500 146
338 3300048911 Ga0496108_0341117 Ga0496108_0341117_142_606 146
339 3300048911 Ga0496108_0481439 Ga0496108_0481439_411_875 146
340 3300048912 Ga0496109_0029600 Ga0496109_0029600_4113_4577 146
341 3300048912 Ga0496109_0142845 Ga0496109_0142845_189_653 146
342 3300048912 Ga0496109_0190784 Ga0496109_0190784_470_934 146
343 3300048913 Ga0496110_0037964 Ga0496110_0037964_198_662 146
344 3300048914 Ga0496111_0429698 Ga0496111_0429698_366_830 146
345 3300048915 Ga0496112_0059707 Ga0496112_0059707_2540_3004 146
346 3300048915 Ga0496112_0530119 Ga0496112_0530119_254_718 146
347 3300048916 Ga0496113_0396738 Ga0496113_0396738_175_639 146
348 3300048916 Ga0496113_0599668 Ga0496113_0599668_32_496 146
349 3300048917 Ga0496114_0005565 Ga0496114_0005565_6635_7099 146
350 3300048917 Ga0496114_0249783 Ga0496114_0249783_934_1398 146
351 3300048917 Ga0496114_0398630 Ga0496114_0398630_514_978 146
352 3300048917 Ga0496114_0854791 Ga0496114_0854791_239_712 146
353 3300048918 Ga0496115_0010129 Ga0496115_0010129_463_927 146
354 3300048918 Ga0496115_0037355 Ga0496115_0037355_661_1125 146
355 3300048918 Ga0496115_0057519 Ga0496115_0057519_2177_2641 146
356 3300048924 Ga0496121_0000481 Ga0496121_0000481_46175_46639 146
357 3300048924 Ga0496121_0085533 Ga0496121_0085533_1923_2387 146
358 3300048924 Ga0496121_0167247 Ga0496121_0167247_776_1249 146
359 3300048927 Ga0496124_0116251 Ga0496124_0116251_1254_1727 146
360 3300048927 Ga0496124_0414791 Ga0496124_0414791_382_846 146
361 3300048928 Ga0496125_0201638 Ga0496125_0201638_368_841 146
362 3300048929 Ga0496126_0002713 Ga0496126_0002713_22663_23127 146
363 3300048929 Ga0496126_0010764 Ga0496126_0010764_2667_3131 146
364 3300048929 Ga0496126_0057142 Ga0496126_0057142_471_935 146
365 3300048929 Ga0496126_0101123 Ga0496126_0101123_1798_2262 146
366 3300048929 Ga0496126_0115580 Ga0496126_0115580_1823_2287 146
367 3300048929 Ga0496126_0207772 Ga0496126_0207772_31_495 146
368 3300049459 Ga0495678_106715 Ga0495678_106715_197_661 146
369 3300049460 Ga0495682_0174423 Ga0495682_0174423_236_700 146
370 3300053078 Ga0495612_0003680 Ga0495612_0003680_4974_5447 146
371 3300053080 Ga0500635_0243649 Ga0500635_0243649_77_541 146
372 3300053092 Ga0500583_0216894 Ga0500583_0216894_114_578 146
373 3300053098 Ga0500650_0188421 Ga0500650_0188421_268_732 146
374 3300053108 Ga0500562_136175 Ga0500562_136175_26_556 146
375 3300053119 Ga0500595_059854 Ga0500595_059854_425_889 146
376 3300053134 Ga0500658_0025133 Ga0500658_0025133_1289_1753 146
377 3300053147 Ga0500589_233311 Ga0500589_233311_199_663 146
378 3300053148 Ga0500590_123966 Ga0500590_123966_710_1174 146
379 3300053150 Ga0500603_001823 Ga0500603_001823_1096_1560 146
380 3300053150 Ga0500603_031314 Ga0500603_031314_538_1002 146
381 3300053151 Ga0500604_0060700 Ga0500604_0060700_315_779 146
382 3300053156 Ga0500622_0142899 Ga0500622_0142899_504_968 146
383 3300053161 Ga0500634_0018562 Ga0500634_0018562_222_686 146
384 3300053178 Ga0500637_0137726 Ga0500637_0137726_761_1225 146
385 3300009551 Ga0105238_10088816 Ga0105238_100888162 147
386 3300031249 Ga0265339_10007722 Ga0265339_100077229 147
387 3300031250 Ga0265331_10064153 Ga0265331_100641532 147
388 3300031616 Ga0307508_10623249 Ga0307508_106232491 147
389 3300031711 Ga0265314_10028917 Ga0265314_100289176 147
390 3300048924 Ga0496121_0000155 Ga0496121_0000155_69761_70231 148
391 3300053102 Ga0500554_000962 Ga0500554_000962_3173_3643 148
392 3300053119 Ga0500595_000234 Ga0500595_000234_21717_22187 148
393 3300053139 Ga0500568_0018715 Ga0500568_0018715_159_629 148
394 3300053162 Ga0500638_001359 Ga0500638_001359_2022_2492 148
395 3300053177 Ga0500636_0006930 Ga0500636_0006930_3183_3653 148
396 3300053178 Ga0500637_0000709 Ga0500637_0000709_8782_9252 148
397 3300055283 Ga0500661_000347 Ga0500661_000347_5859_6329 148
398 3300003320 rootH2_10095100 rootH2_100951005 149
399 3300003323 rootH1_10018507 rootH1_100185076 149
400 3300005435 Ga0070714_100020575 Ga0070714_1000205754 149
401 3300005436 Ga0070713_100015479 Ga0070713_1000154792 149
402 3300005437 Ga0070710_10008187 Ga0070710_100081877 149
403 3300005439 Ga0070711_100001780 Ga0070711_1000017809 149
404 3300005445 Ga0070708_100874529 Ga0070708_1008745292 149
405 3300006028 Ga0070717_10015199 Ga0070717_100151995 149
406 3300006163 Ga0070715_10512684 Ga0070715_105126842 149
407 3300006173 Ga0070716_100001639 Ga0070716_1000016397 149
408 3300006175 Ga0070712_100012295 Ga0070712_1000122957 149
409 3300006931 Ga0097620_100045982 Ga0097620_1000459823 149
410 3300009101 Ga0105247_10007848 Ga0105247_100078488 149
411 3300009545 Ga0105237_10063018 Ga0105237_100630184 149
412 3300014325 Ga0163163_11312574 Ga0163163_113125742 149
413 3300021384 Ga0213876_10001555 Ga0213876_100015558 149
414 3300025898 Ga0207692_10000701 Ga0207692_100007019 149
415 3300025905 Ga0207685_10226194 Ga0207685_102261942 149
416 3300025906 Ga0207699_10003603 Ga0207699_100036037 149
417 3300025915 Ga0207693_10019426 Ga0207693_100194267 149
418 3300025916 Ga0207663_10002918 Ga0207663_100029186 149
419 3300025928 Ga0207700_10260277 Ga0207700_102602773 149
420 3300025929 Ga0207664_10018533 Ga0207664_100185334 149
421 3300025939 Ga0207665_10001400 Ga0207665_100014003 149
422 3300039437 Ga0436365_1829992 Ga0436365_1829992_2795_3268 149
423 3300039450 Ga0436363_0394673 Ga0436363_0394673_661_1134 149
424 3300048924 Ga0496121_0155962 Ga0496121_0155962_202_675 149
425 3300048924 Ga0496121_0520315 Ga0496121_0520315_17_493 149
426 3300053111 Ga0500572_000014 Ga0500572_000014_21209_21682 149
427 3300053136 Ga0500559_0000455 Ga0500559_0000455_19986_20459 149
428 3300053163 Ga0500639_005138 Ga0500639_005138_2596_3069 149
429 3300053735 Ga0500596_005132 Ga0500596_005132_452_925 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07963

N_methyl

Prokaryotic N-terminal methylation motif

26

51

0.94

PF12019

GspH

Type II transport protein GspH

66

164

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qqj-assembly1.cif.gz_A sucrose phosphorylase from jeotgalibaca ciconiae 0.7681 113 143
4dq9-assembly2.cif.gz_A crystal structure of the minor pseudopilin epsh from the type ii secretion system of vibrio cholerae 0.7575 39 141
7qqj-assembly2.cif.gz_B sucrose phosphorylase from jeotgalibaca ciconiae 0.7551 113 143
4dq9-assembly3.cif.gz_B crystal structure of the minor pseudopilin epsh from the type ii secretion system of vibrio cholerae 0.755 39 141
4ipu-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa (strain: pao1) type iv minor pilin fimu in space group p21 0.7476 32 141
ID Description Score Start End Superfamily
4dq9B00 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;minor pseudopilin epsh domain 0.755 39 141 3.55.40.10
af_Q4W5R0_1_262_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7529 115 145 3.80.10.10
af_Q2G2I7_34_148_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7457 36 142 2.40.50.140
2qv8B00 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;minor pseudopilin epsh domain 0.7302 39 148 3.55.40.10
af_Q84Q83_471_817_2.40.160.50 Mainly Beta;Beta Barrel;Porin;membrane protein fhac: a member of the omp85/tpsb transporter family 0.7131 103 143 2.40.160.50
ID Description Score Start End GO Terms
AF-A0A537LCC2-F1-model_v4 Type II secretion system protein GspH 0.9448 22 143
AF-A5EF17-F1-model_v4 deleted 0.9407 14 149
AF-A0A317HX18-F1-model_v4 deleted 0.9338 49 145
AF-S6U7X6-F1-model_v4 General secretion pathway protein H 0.908 53 142
AF-A0A317HX18-F1-model_v4 deleted 0.9066 49 145

Feature Viewer

pLDDT pTM Quality
85.88 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map