F441968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 429 | 230 | 859 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0006468|Ga0451577_0006468_5281_6402 |
| Length | 373 |
| Sequence | MYNILKILSGKNLHTGCGVTGGGNIKNLNDMPELAIVILNWNGLEFLKKFLGTVVRYSTSHSTEIYVADNGSSDDSVKWIMEHFREINLLKLEKNNGFAGGYNIALEQITAKYYLLLNSDIEVTEGWIEPLLKHMNDNPGCAACQPRVLSWFRKEYFEYAGASGGYIDKYGYPFCRGRIFGHIEKDEGQYNDNVRVFWTSGACMMIRSDAWKNCGGFDASFFAHMEEIDLCWRLNNAGFSLECIPESFVYHVGGGTLSYNSPYKTYLNFRNSLYMLYKNLDQNDLKRVLFIRRLLDGIAALTFLARGHFKSFLSVWRAHMDYNKNLPELKVKRRDIQKNINEYYSLPVLNKSIVFEFYARGKRTFRSLNLIFK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 120 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 121 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 122 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 127 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 129 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 132 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 137 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 138 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 139 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 146 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 147 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 148 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 179 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 182 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 183 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 184 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 185 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 186 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 189 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 190 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 191 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 192 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 195 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 196 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 197 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 198 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 199 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 200 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 201 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 202 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 203 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 204 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 205 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 206 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 207 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 208 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 209 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 210 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 211 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 212 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 213 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 214 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 215 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 216 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 217 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 218 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 219 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 220 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 221 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 222 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 223 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 224 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 225 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 226 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 227 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 228 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 229 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 230 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.84 |
| Metatranscriptomes | 0 |
| Isolates | 8.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.39 |
| Nodule | 0 |
| Rhizoplane | 0.47 |
| Rhizosphere | 79.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451577_0006468 | 3300042876 | Bacteria | 11674 |
| 2 | SwRhRL2b_contig_180147 | 2162886007 | Bacteria | 5368 |
| 3 | JGI24736J21556_1001074 | 3300001904 | Bacteria | 5001 |
| 4 | JGI24740J21852_10022546 | 3300001979 | Bacteria | 2165 |
| 5 | JGI24740J21852_10038188 | 3300001979 | Bacteria | 1475 |
| 6 | JGI24737J22298_10005129 | 3300001990 | Bacteria | 4535 |
| 7 | JGI24737J22298_10005632 | 3300001990 | Bacteria | 4316 |
| 8 | JGI24735J21928_10000014 | 3300002067 | Bacteria | 186670 |
| 9 | JGI25162J39368_1000012 | 3300002737 | Bacteria | 373191 |
| 10 | JGI25162J39368_1001031 | 3300002737 | Bacteria | 17224 |
| 11 | JGI25152J39213_1000075 | 3300002773 | Bacteria | 66427 |
| 12 | JGI25150J39212_1000009 | 3300002774 | Bacteria | 249509 |
| 13 | JGI25151J46595_10000017 | 3300003187 | Bacteria | 249509 |
| 14 | JGI25165J46597_1000869 | 3300003214 | Bacteria | 21479 |
| 15 | JGI25153J46596_10000023 | 3300003215 | Bacteria | 249509 |
| 16 | rootH1_10005812 | 3300003316 | Bacteria | 4957 |
| 17 | rootH1_10012723 | 3300003316 | Bacteria | 1260 |
| 18 | rootH1_10021548 | 3300003316 | Bacteria | 2148 |
| 19 | rootH1_10021548 | 3300003323 | Bacteria | 15874 |
| 20 | rootH1_10024554 | 3300003316 | Bacteria | 8245 |
| 21 | rootH1_10029000 | 3300003316 | Bacteria | 3117 |
| 22 | rootH1_10039577 | 3300003316 | Bacteria | 1662 |
| 23 | rootH2_10004581 | 3300003320 | Bacteria | 18930 |
| 24 | rootH2_10086594 | 3300003320 | Bacteria | 7985 |
| 25 | rootH2_10142102 | 3300003320 | Bacteria | 1153 |
| 26 | rootL2_10122897 | 3300003322 | Bacteria | 3188 |
| 27 | rootL2_10128720 | 3300003322 | Bacteria | 4301 |
| 28 | rootL2_10129198 | 3300003322 | Bacteria | 3656 |
| 29 | rootH1_10003212 | 3300003323 | Bacteria | 182359 |
| 30 | rootH1_10019268 | 3300003323 | Bacteria | 3643 |
| 31 | rootH1_10026953 | 3300003323 | Bacteria | 2579 |
| 32 | rootH1_10065451 | 3300003323 | Bacteria | 1537 |
| 33 | rootH1_10087662 | 3300003323 | Bacteria | 1735 |
| 34 | rootH1_10091374 | 3300003323 | Bacteria | 4204 |
| 35 | rootH1_10097271 | 3300003323 | Bacteria | 1630 |
| 36 | rootH1_10130377 | 3300003323 | Bacteria | 3529 |
| 37 | Ga0055536_1000003 | 3300003781 | Bacteria | 447744 |
| 38 | Ga0055536_1005561 | 3300003781 | Bacteria | 6122 |
| 39 | Ga0055530_10010445 | 3300003791 | Bacteria | 3431 |
| 40 | Ga0065165_1000538 | 3300005262 | Bacteria | 57448 |
| 41 | Ga0065714_10004554 | 3300005288 | Bacteria | 7294 |
| 42 | Ga0065714_10005951 | 3300005288 | Bacteria | 7262 |
| 43 | Ga0065714_10006907 | 3300005288 | Bacteria | 4696 |
| 44 | Ga0065714_10064729 | 3300005288 | Bacteria | 20931 |
| 45 | Ga0065714_10064977 | 3300005288 | Bacteria | 14539 |
| 46 | Ga0065714_10078103 | 3300005288 | Bacteria | 2615 |
| 47 | Ga0065704_10000288 | 3300005289 | Bacteria | 77379 |
| 48 | Ga0065704_10110172 | 3300005289 | Bacteria | 1986 |
| 49 | Ga0070658_10000019 | 3300005327 | Bacteria | 194742 |
| 50 | Ga0070658_10028062 | 3300005327 | Bacteria | 4518 |
| 51 | Ga0070658_10032554 | 3300005327 | Unclassified | 4192 |
| 52 | Ga0070658_10297778 | 3300005327 | Bacteria | 1375 |
| 53 | Ga0070676_10001099 | 3300005328 | Bacteria | 13512 |
| 54 | Ga0070683_100050623 | 3300005329 | Unclassified | 3846 |
| 55 | Ga0070670_100054029 | 3300005331 | Bacteria | 3448 |
| 56 | Ga0070680_100056132 | 3300005336 | Bacteria | 3219 |
| 57 | Ga0068868_100018386 | 3300005338 | Bacteria | 5226 |
| 58 | Ga0070660_100006548 | 3300005339 | Bacteria | 8080 |
| 59 | Ga0070689_100103254 | 3300005340 | Bacteria | 2259 |
| 60 | Ga0070674_100024533 | 3300005356 | Bacteria | 3915 |
| 61 | Ga0070673_100001076 | 3300005364 | Bacteria | 15617 |
| 62 | Ga0070688_100145705 | 3300005365 | Bacteria | 1613 |
| 63 | Ga0070667_100077200 | 3300005367 | Unclassified | 2844 |
| 64 | Ga0070663_100041849 | 3300005455 | Bacteria | 3216 |
| 65 | Ga0070662_100000729 | 3300005457 | Bacteria | 20118 |
| 66 | Ga0070662_100054195 | 3300005457 | Bacteria | 2906 |
| 67 | Ga0070681_10451528 | 3300005458 | Bacteria | 1197 |
| 68 | Ga0068867_100000116 | 3300005459 | Bacteria | 50447 |
| 69 | Ga0070679_100001606 | 3300005530 | Bacteria | 20303 |
| 70 | Ga0070684_100048214 | 3300005535 | Bacteria | 3695 |
| 71 | Ga0068853_100037702 | 3300005539 | Bacteria | 4114 |
| 72 | Ga0068853_100174786 | 3300005539 | Bacteria | 1945 |
| 73 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 74 | Ga0068855_100001020 | 3300005563 | Bacteria | 34917 |
| 75 | Ga0068855_100014762 | 3300005563 | Bacteria | 9412 |
| 76 | Ga0068855_100023678 | 3300005563 | Bacteria | 7353 |
| 77 | Ga0068855_100237517 | 3300005563 | Unclassified | 2038 |
| 78 | Ga0068857_100193617 | 3300005577 | Bacteria | 1852 |
| 79 | Ga0068854_100016513 | 3300005578 | Bacteria | 4923 |
| 80 | Ga0068856_100000262 | 3300005614 | Bacteria | 57470 |
| 81 | Ga0068856_100001674 | 3300005614 | Bacteria | 23218 |
| 82 | Ga0068856_100034800 | 3300005614 | Bacteria | 4935 |
| 83 | Ga0068856_100075694 | 3300005614 | Bacteria | 3334 |
| 84 | Ga0068852_100000326 | 3300005616 | Bacteria | 32458 |
| 85 | Ga0068852_100051110 | 3300005616 | Bacteria | 3545 |
| 86 | Ga0068866_10079698 | 3300005718 | Bacteria | 1755 |
| 87 | Ga0068860_100064937 | 3300005843 | Bacteria | 3466 |
| 88 | Ga0075366_10000263 | 3300006195 | Bacteria | 23219 |
| 89 | Ga0075366_10004625 | 3300006195 | Bacteria | 7396 |
| 90 | Ga0068871_100000216 | 3300006358 | Bacteria | 40288 |
| 91 | Ga0068865_100000051 | 3300006881 | Bacteria | 65346 |
| 92 | Ga0105240_10000728 | 3300009093 | Bacteria | 60140 |
| 93 | Ga0105240_10013890 | 3300009093 | Bacteria | 11031 |
| 94 | Ga0105240_10021480 | 3300009093 | Bacteria | 8584 |
| 95 | Ga0105240_10026405 | 3300009093 | Bacteria | 7619 |
| 96 | Ga0105240_10132006 | 3300009093 | Bacteria | 2995 |
| 97 | Ga0105240_10135429 | 3300009093 | Bacteria | 2950 |
| 98 | Ga0105240_10185422 | 3300009093 | Bacteria | 2451 |
| 99 | Ga0111539_10009479 | 3300009094 | Bacteria | 12287 |
| 100 | Ga0105243_10059676 | 3300009148 | Bacteria | 3045 |
| 101 | Ga0105241_10001103 | 3300009174 | Bacteria | 20558 |
| 102 | Ga0105241_10005856 | 3300009174 | Bacteria | 9074 |
| 103 | Ga0105242_10019154 | 3300009176 | Bacteria | 5361 |
| 104 | Ga0105242_10104342 | 3300009176 | Bacteria | 2406 |
| 105 | Ga0105237_10000574 | 3300009545 | Bacteria | 51427 |
| 106 | Ga0105237_10000622 | 3300009545 | Bacteria | 49566 |
| 107 | Ga0105237_10001914 | 3300009545 | Bacteria | 26581 |
| 108 | Ga0105237_10003791 | 3300009545 | Bacteria | 17772 |
| 109 | Ga0105237_10036675 | 3300009545 | Bacteria | 4961 |
| 110 | Ga0105237_10069165 | 3300009545 | Bacteria | 3526 |
| 111 | Ga0105237_10078892 | 3300009545 | Bacteria | 3282 |
| 112 | Ga0105237_10154264 | 3300009545 | Bacteria | 2293 |
| 113 | Ga0105237_10322761 | 3300009545 | Bacteria | 1548 |
| 114 | Ga0105238_10145573 | 3300009551 | Bacteria | 2346 |
| 115 | Ga0105238_10161073 | 3300009551 | Bacteria | 2219 |
| 116 | Ga0105239_10000013 | 3300010375 | Bacteria | 327371 |
| 117 | Ga0105239_10000117 | 3300010375 | Bacteria | 112291 |
| 118 | Ga0105239_10000139 | 3300010375 | Bacteria | 102090 |
| 119 | Ga0105239_10012009 | 3300010375 | Bacteria | 9659 |
| 120 | Ga0105239_10019913 | 3300010375 | Bacteria | 7405 |
| 121 | Ga0105239_10021149 | 3300010375 | Bacteria | 7176 |
| 122 | Ga0105239_10063517 | 3300010375 | Bacteria | 4054 |
| 123 | Ga0105246_10104713 | 3300011119 | Bacteria | 2067 |
| 124 | Ga0157373_10000041 | 3300013100 | Bacteria | 113871 |
| 125 | Ga0157373_10000208 | 3300013100 | Bacteria | 48082 |
| 126 | Ga0157373_10003960 | 3300013100 | Bacteria | 11180 |
| 127 | Ga0157373_10019523 | 3300013100 | Bacteria | 4930 |
| 128 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 129 | Ga0157371_10002094 | 3300013102 | Bacteria | 19489 |
| 130 | Ga0157371_10002124 | 3300013102 | Bacteria | 19289 |
| 131 | Ga0157371_10012367 | 3300013102 | Bacteria | 6528 |
| 132 | Ga0157371_10021144 | 3300013102 | Bacteria | 4781 |
| 133 | Ga0157371_10193530 | 3300013102 | Bacteria | 1456 |
| 134 | Ga0157371_10217757 | 3300013102 | Bacteria | 1371 |
| 135 | Ga0157370_10003446 | 3300013104 | Bacteria | 18565 |
| 136 | Ga0157370_10005009 | 3300013104 | Bacteria | 14976 |
| 137 | Ga0157370_10007867 | 3300013104 | Bacteria | 11555 |
| 138 | Ga0157370_10021200 | 3300013104 | Bacteria | 6478 |
| 139 | Ga0157370_10023237 | 3300013104 | Bacteria | 6157 |
| 140 | Ga0157370_10036084 | 3300013104 | Bacteria | 4800 |
| 141 | Ga0157370_10050236 | 3300013104 | Bacteria | 3986 |
| 142 | Ga0157370_10052601 | 3300013104 | Bacteria | 3888 |
| 143 | Ga0157370_10184168 | 3300013104 | Bacteria | 1939 |
| 144 | Ga0157370_10188351 | 3300013104 | Bacteria | 1916 |
| 145 | Ga0157370_10321099 | 3300013104 | Bacteria | 1428 |
| 146 | Ga0157369_10000006 | 3300013105 | Bacteria | 412230 |
| 147 | Ga0157369_10001212 | 3300013105 | Bacteria | 32139 |
| 148 | Ga0157369_10065263 | 3300013105 | Bacteria | 3918 |
| 149 | Ga0157374_10001372 | 3300013296 | Bacteria | 20693 |
| 150 | Ga0157374_10001374 | 3300013296 | Bacteria | 20684 |
| 151 | Ga0157374_10008308 | 3300013296 | Bacteria | 8857 |
| 152 | Ga0157378_10479973 | 3300013297 | Bacteria | 1238 |
| 153 | Ga0163162_10000058 | 3300013306 | Bacteria | 108298 |
| 154 | Ga0163162_10003377 | 3300013306 | Bacteria | 15275 |
| 155 | Ga0163162_10012985 | 3300013306 | Bacteria | 8127 |
| 156 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 157 | Ga0157372_10000181 | 3300013307 | Bacteria | 69472 |
| 158 | Ga0157372_10001057 | 3300013307 | Bacteria | 30071 |
| 159 | Ga0157372_10001960 | 3300013307 | Bacteria | 22372 |
| 160 | Ga0157372_10170533 | 3300013307 | Bacteria | 2518 |
| 161 | Ga0157372_10209862 | 3300013307 | Bacteria | 2257 |
| 162 | Ga0157375_10013782 | 3300013308 | Bacteria | 7206 |
| 163 | Ga0157375_10028794 | 3300013308 | Bacteria | 5213 |
| 164 | Ga0157375_10054601 | 3300013308 | Bacteria | 3935 |
| 165 | Ga0157375_10179196 | 3300013308 | Bacteria | 2270 |
| 166 | Ga0157375_10635312 | 3300013308 | Bacteria | 1225 |
| 167 | Ga0163163_10081089 | 3300014325 | Bacteria | 3246 |
| 168 | Ga0163163_10281712 | 3300014325 | Unclassified | 1714 |
| 169 | Ga0157380_10000002 | 3300014326 | Bacteria | 236273 |
| 170 | Ga0182008_10000001 | 3300014497 | Bacteria | 540790 |
| 171 | Ga0182008_10000658 | 3300014497 | Bacteria | 25096 |
| 172 | Ga0157376_10102459 | 3300014969 | Bacteria | 2504 |
| 173 | Ga0182006_1000244 | 3300015261 | Bacteria | 50752 |
| 174 | Ga0182006_1004312 | 3300015261 | Bacteria | 7039 |
| 175 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 176 | Ga0183373_1010 | 3300015682 | Bacteria | 196982 |
| 177 | Ga0163161_10000468 | 3300017792 | Bacteria | 33545 |
| 178 | Ga0163161_10000919 | 3300017792 | Bacteria | 22732 |
| 179 | Ga0163161_10011700 | 3300017792 | Bacteria | 6089 |
| 180 | Ga0163161_10025802 | 3300017792 | Bacteria | 4161 |
| 181 | Ga0163161_10044622 | 3300017792 | Bacteria | 3194 |
| 182 | Ga0163161_10146543 | 3300017792 | Bacteria | 1791 |
| 183 | Ga0207427_100085 | 3300025231 | Bacteria | 142561 |
| 184 | Ga0209437_100041 | 3300025233 | Bacteria | 444465 |
| 185 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 186 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 187 | Ga0209026_1001421 | 3300025250 | Bacteria | 10631 |
| 188 | Ga0209026_1001617 | 3300025250 | Bacteria | 9627 |
| 189 | Ga0209026_1010898 | 3300025250 | Bacteria | 1668 |
| 190 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 191 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 192 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 193 | Ga0209676_1001025 | 3300025292 | Bacteria | 32516 |
| 194 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 195 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 196 | Ga0209050_1000016 | 3300025298 | Bacteria | 729149 |
| 197 | Ga0207647_10000063 | 3300025904 | Bacteria | 83442 |
| 198 | Ga0207647_10003913 | 3300025904 | Bacteria | 11123 |
| 199 | Ga0207647_10135036 | 3300025904 | Bacteria | 1448 |
| 200 | Ga0207645_10000127 | 3300025907 | Bacteria | 58003 |
| 201 | Ga0207705_10000069 | 3300025909 | Bacteria | 133094 |
| 202 | Ga0207705_10038630 | 3300025909 | Bacteria | 3419 |
| 203 | Ga0207705_10070996 | 3300025909 | Bacteria | 2524 |
| 204 | Ga0207654_10002013 | 3300025911 | Bacteria | 10448 |
| 205 | Ga0207654_10009834 | 3300025911 | Bacteria | 4863 |
| 206 | Ga0207707_10312509 | 3300025912 | Bacteria | 1357 |
| 207 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 208 | Ga0207695_10008676 | 3300025913 | Bacteria | 12683 |
| 209 | Ga0207695_10012473 | 3300025913 | Bacteria | 10200 |
| 210 | Ga0207695_10029017 | 3300025913 | Bacteria | 6122 |
| 211 | Ga0207695_10109032 | 3300025913 | Bacteria | 2751 |
| 212 | Ga0207695_10135075 | 3300025913 | Bacteria | 2420 |
| 213 | Ga0207671_10002529 | 3300025914 | Bacteria | 19484 |
| 214 | Ga0207671_10005361 | 3300025914 | Bacteria | 11857 |
| 215 | Ga0207671_10005609 | 3300025914 | Bacteria | 11516 |
| 216 | Ga0207671_10025739 | 3300025914 | Bacteria | 4416 |
| 217 | Ga0207671_10040945 | 3300025914 | Bacteria | 3429 |
| 218 | Ga0207671_10055331 | 3300025914 | Bacteria | 2939 |
| 219 | Ga0207671_10185586 | 3300025914 | Bacteria | 1620 |
| 220 | Ga0207671_10230300 | 3300025914 | Bacteria | 1453 |
| 221 | Ga0207657_10022645 | 3300025919 | Bacteria | 5872 |
| 222 | Ga0207652_10007343 | 3300025921 | Bacteria | 8884 |
| 223 | Ga0207694_10149625 | 3300025924 | Bacteria | 1880 |
| 224 | Ga0207650_10103175 | 3300025925 | Bacteria | 2198 |
| 225 | Ga0207690_10008515 | 3300025932 | Bacteria | 6084 |
| 226 | Ga0207706_10001974 | 3300025933 | Bacteria | 20125 |
| 227 | Ga0207706_10093490 | 3300025933 | Bacteria | 2644 |
| 228 | Ga0207669_10028803 | 3300025937 | Bacteria | 3061 |
| 229 | Ga0207704_10000046 | 3300025938 | Bacteria | 86187 |
| 230 | Ga0207704_10098714 | 3300025938 | Bacteria | 1941 |
| 231 | Ga0207661_10035105 | 3300025944 | Unclassified | 3905 |
| 232 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 233 | Ga0207667_10000896 | 3300025949 | Bacteria | 37967 |
| 234 | Ga0207667_10044510 | 3300025949 | Bacteria | 4703 |
| 235 | Ga0207667_10308703 | 3300025949 | Bacteria | 1616 |
| 236 | Ga0207651_10005508 | 3300025960 | Bacteria | 6510 |
| 237 | Ga0207640_10013718 | 3300025981 | Bacteria | 4651 |
| 238 | Ga0207677_10010556 | 3300026023 | Bacteria | 5234 |
| 239 | Ga0207639_10022378 | 3300026041 | Bacteria | 4553 |
| 240 | Ga0207639_10178735 | 3300026041 | Bacteria | 1803 |
| 241 | Ga0207639_10446265 | 3300026041 | Bacteria | 1174 |
| 242 | Ga0207678_10042011 | 3300026067 | Bacteria | 3963 |
| 243 | Ga0207702_10000492 | 3300026078 | Bacteria | 44456 |
| 244 | Ga0207702_10003618 | 3300026078 | Bacteria | 14034 |
| 245 | Ga0207702_10033748 | 3300026078 | Bacteria | 4276 |
| 246 | Ga0207702_10103011 | 3300026078 | Bacteria | 2524 |
| 247 | Ga0207648_10000257 | 3300026089 | Bacteria | 57438 |
| 248 | Ga0207674_10215228 | 3300026116 | Bacteria | 1870 |
| 249 | Ga0207698_10090892 | 3300026142 | Bacteria | 2497 |
| 250 | Ga0268266_10000078 | 3300028379 | Bacteria | 213632 |
| 251 | Ga0268264_10055786 | 3300028381 | Bacteria | 3302 |
| 252 | Ga0307517_10001926 | 3300028786 | Bacteria | 33977 |
| 253 | Ga0307515_10000076 | 3300028794 | Bacteria | 228736 |
| 254 | Ga0307515_10013120 | 3300028794 | Bacteria | 15511 |
| 255 | Ga0307515_10029999 | 3300028794 | Bacteria | 9162 |
| 256 | Ga0265338_10001618 | 3300028800 | Bacteria | 36039 |
| 257 | Ga0316176_1138478 | 3300030732 | Bacteria | 3018 |
| 258 | Ga0316183_1026870 | 3300030742 | Bacteria | 28320 |
| 259 | Ga0316181_1200512 | 3300030744 | Bacteria | 12003 |
| 260 | Ga0316182_1038659 | 3300030745 | Unclassified | 3501 |
| 261 | Ga0265327_10005429 | 3300031251 | Bacteria | 10632 |
| 262 | Ga0265327_10031363 | 3300031251 | Bacteria | 2987 |
| 263 | Ga0307509_10245846 | 3300031507 | Bacteria | 1577 |
| 264 | Ga0307408_100001460 | 3300031548 | Bacteria | 17553 |
| 265 | Ga0307408_100005243 | 3300031548 | Bacteria | 8688 |
| 266 | Ga0316575_10092184 | 3300031665 | Unclassified | 1228 |
| 267 | Ga0265342_10088813 | 3300031712 | Bacteria | 1774 |
| 268 | Ga0316576_10098213 | 3300031727 | Bacteria | 2187 |
| 269 | Ga0316576_10173051 | 3300031727 | Unclassified | 1629 |
| 270 | Ga0316578_10003510 | 3300031728 | Bacteria | 7198 |
| 271 | Ga0316578_10019920 | 3300031728 | Bacteria | 3701 |
| 272 | Ga0307405_10000010 | 3300031731 | Bacteria | 250978 |
| 273 | Ga0316577_10058090 | 3300031733 | Bacteria | 2160 |
| 274 | Ga0316577_10128404 | 3300031733 | Unclassified | 1426 |
| 275 | Ga0307407_10000009 | 3300031903 | Bacteria | 188746 |
| 276 | Ga0307412_10000033 | 3300031911 | Bacteria | 206649 |
| 277 | Ga0307412_10000906 | 3300031911 | Bacteria | 17033 |
| 278 | Ga0307416_100000019 | 3300032002 | Bacteria | 199706 |
| 279 | Ga0307414_10000017 | 3300032004 | Bacteria | 247306 |
| 280 | Ga0307414_10002459 | 3300032004 | Bacteria | 9703 |
| 281 | Ga0307414_10003061 | 3300032004 | Bacteria | 8869 |
| 282 | Ga0307414_10004573 | 3300032004 | Bacteria | 7528 |
| 283 | Ga0316585_10011711 | 3300032137 | Bacteria | 2589 |
| 284 | Ga0307507_10000015 | 3300033179 | Bacteria | 237419 |
| 285 | Ga0316582_0215437 | 3300036647 | Unclassified | 1312 |
| 286 | Ga0316584_0002153 | 3300036712 | Bacteria | 12332 |
| 287 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 288 | Ga0395899_0000733 | 3300037312 | Bacteria | 32767 |
| 289 | Ga0395899_0002325 | 3300037312 | Bacteria | 15475 |
| 290 | Ga0395900_0000501 | 3300037418 | Bacteria | 55054 |
| 291 | Ga0395900_0005430 | 3300037418 | Bacteria | 13356 |
| 292 | Ga0395900_0006437 | 3300037418 | Bacteria | 12240 |
| 293 | Ga0395900_0052252 | 3300037418 | Bacteria | 4207 |
| 294 | Ga0395898_0013107 | 3300037466 | Bacteria | 8548 |
| 295 | Ga0395898_0123682 | 3300037466 | Bacteria | 2479 |
| 296 | Ga0395905_0001099 | 3300037471 | Bacteria | 34042 |
| 297 | Ga0395905_0007115 | 3300037471 | Bacteria | 11181 |
| 298 | Ga0395905_0008184 | 3300037471 | Bacteria | 10325 |
| 299 | Ga0395901_0017156 | 3300038443 | Bacteria | 7385 |
| 300 | Ga0395901_0048154 | 3300038443 | Bacteria | 4427 |
| 301 | Ga0395901_0215283 | 3300038443 | Bacteria | 2009 |
| 302 | Ga0400483_045849 | 3300039062 | Bacteria | 18158 |
| 303 | Ga0400483_247412 | 3300039062 | Bacteria | 16063 |
| 304 | Ga0400489_01897 | 3300039093 | Bacteria | 13325 |
| 305 | Ga0439448_0006462 | 3300042005 | Bacteria | 3372 |
| 306 | Ga0451577_0053174 | 3300042876 | Bacteria | 3616 |
| 307 | Ga0451577_0268285 | 3300042876 | Bacteria | 1546 |
| 308 | Ga0453683_0000140 | 3300044673 | Bacteria | 105316 |
| 309 | Ga0453683_0076336 | 3300044673 | Bacteria | 2098 |
| 310 | Ga0453683_0137456 | 3300044673 | Unclassified | 1541 |
| 311 | Ga0466966_0171675 | 3300044684 | Bacteria | 1317 |
| 312 | Ga0453684_0000948 | 3300044712 | Bacteria | 95689 |
| 313 | Ga0453684_0003935 | 3300044712 | Bacteria | 32603 |
| 314 | Ga0453684_0006558 | 3300044712 | Bacteria | 22028 |
| 315 | Ga0453684_0010531 | 3300044712 | Bacteria | 15789 |
| 316 | Ga0453684_0018092 | 3300044712 | Bacteria | 10848 |
| 317 | Ga0453684_0029550 | 3300044712 | Bacteria | 7778 |
| 318 | Ga0453684_0037597 | 3300044712 | Bacteria | 6642 |
| 319 | Ga0453684_0039364 | 3300044712 | Bacteria | 6444 |
| 320 | Ga0453684_0127473 | 3300044712 | Bacteria | 3061 |
| 321 | Ga0453684_0310401 | 3300044712 | Bacteria | 1790 |
| 322 | Ga0466959_0029637 | 3300045049 | Bacteria | 4055 |
| 323 | Ga0451576_0000795 | 3300045051 | Bacteria | 61946 |
| 324 | Ga0451576_0002738 | 3300045051 | Bacteria | 25581 |
| 325 | Ga0451576_0009157 | 3300045051 | Bacteria | 11505 |
| 326 | Ga0451576_0015780 | 3300045051 | Bacteria | 8359 |
| 327 | Ga0451576_0064630 | 3300045051 | Bacteria | 3811 |
| 328 | Ga0495592_0147355 | 3300046454 | Bacteria | 1631 |
| 329 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 330 | Ga0495650_0125650 | 3300046471 | Bacteria | 940 |
| 331 | Ga0495585_0000510 | 3300046492 | Bacteria | 36718 |
| 332 | Ga0495585_0000904 | 3300046492 | Bacteria | 25136 |
| 333 | Ga0495596_0014549 | 3300046500 | Bacteria | 3315 |
| 334 | Ga0495606_0000145 | 3300046507 | Bacteria | 122857 |
| 335 | Ga0495606_0014766 | 3300046507 | Bacteria | 6068 |
| 336 | Ga0495606_0016434 | 3300046507 | Bacteria | 5641 |
| 337 | Ga0495606_0021807 | 3300046507 | Bacteria | 4685 |
| 338 | Ga0495610_0000028 | 3300046512 | Bacteria | 272572 |
| 339 | Ga0495610_0002358 | 3300046512 | Bacteria | 15963 |
| 340 | Ga0495610_0002790 | 3300046512 | Bacteria | 14304 |
| 341 | Ga0495610_0019770 | 3300046512 | Bacteria | 3756 |
| 342 | Ga0495616_0007696 | 3300046513 | Bacteria | 6440 |
| 343 | Ga0495616_0029348 | 3300046513 | Bacteria | 2905 |
| 344 | Ga0495631_0037090 | 3300046518 | Bacteria | 2173 |
| 345 | Ga0495648_0007367 | 3300046524 | Bacteria | 8814 |
| 346 | Ga0495648_0062000 | 3300046524 | Bacteria | 2217 |
| 347 | Ga0495652_0031760 | 3300046529 | Bacteria | 4622 |
| 348 | Ga0495640_0181199 | 3300046533 | Bacteria | 1342 |
| 349 | Ga0495609_0013121 | 3300046538 | Bacteria | 3918 |
| 350 | Ga0495609_0027579 | 3300046538 | Bacteria | 2595 |
| 351 | Ga0495622_0030966 | 3300046557 | Bacteria | 2501 |
| 352 | Ga0495633_0000069 | 3300046558 | Bacteria | 135128 |
| 353 | Ga0495668_0000021 | 3300046616 | Bacteria | 381308 |
| 354 | Ga0495634_0097754 | 3300046642 | Bacteria | 1900 |
| 355 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 356 | Ga0495625_0003181 | 3300046660 | Bacteria | 16707 |
| 357 | Ga0495625_0022439 | 3300046660 | Bacteria | 4840 |
| 358 | Ga0495625_0108732 | 3300046660 | Bacteria | 1897 |
| 359 | Ga0495625_0206312 | 3300046660 | Bacteria | 1294 |
| 360 | Ga0495661_0000244 | 3300046665 | Bacteria | 62633 |
| 361 | Ga0495661_0007661 | 3300046665 | Bacteria | 7523 |
| 362 | Ga0495661_0040960 | 3300046665 | Bacteria | 2869 |
| 363 | Ga0495658_0054638 | 3300046683 | Bacteria | 2272 |
| 364 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 365 | Ga0495683_0027778 | 3300047323 | Bacteria | 2893 |
| 366 | Ga0495683_0074097 | 3300047323 | Bacteria | 1669 |
| 367 | Ga0495687_001307 | 3300047443 | Bacteria | 23369 |
| 368 | Ga0495687_004955 | 3300047443 | Bacteria | 8711 |
| 369 | Ga0495686_0000106 | 3300047472 | Bacteria | 175852 |
| 370 | Ga0495686_0003562 | 3300047472 | Bacteria | 13388 |
| 371 | Ga0495686_0015132 | 3300047472 | Bacteria | 5284 |
| 372 | Ga0495686_0113526 | 3300047472 | Bacteria | 1622 |
| 373 | Ga0495614_0076436 | 3300048089 | Bacteria | 1447 |
| 374 | Ga0496115_0008303 | 3300048918 | Bacteria | 7676 |
| 375 | Ga0496122_0001345 | 3300048925 | Bacteria | 40096 |
| 376 | Ga0495678_032950 | 3300049459 | Bacteria | 2143 |
| 377 | Ga0495682_0021994 | 3300049460 | Bacteria | 2388 |
| 378 | Ga0501210_000622 | 3300049657 | Bacteria | 1752 |
| 379 | Ga0501217_002957 | 3300049661 | Unclassified | 3401 |
| 380 | Ga0501236_000595 | 3300049670 | Bacteria | 4049 |
| 381 | Ga0501257_000192 | 3300049686 | Bacteria | 12281 |
| 382 | Ga0501264_000239 | 3300049761 | Bacteria | 8852 |
| 383 | nmdc:mga0k408_4467_c1 | 3300050493 | Bacteria | 7421 |
| 384 | nmdc:mga0k408_53_c1 | 3300050493 | Bacteria | 57877 |
| 385 | nmdc:mga08y16_24282_c1 | 3300050511 | Bacteria | 6399 |
| 386 | Ga0500635_0000554 | 3300053080 | Bacteria | 9943 |
| 387 | Ga0500635_0019847 | 3300053080 | Bacteria | 2050 |
| 388 | Ga0500651_0001374 | 3300053093 | Bacteria | 12191 |
| 389 | Ga0500608_012839 | 3300053122 | Bacteria | 3689 |
| 390 | Ga0500608_037643 | 3300053122 | Bacteria | 2311 |
| 391 | Ga0500614_011099 | 3300053123 | Bacteria | 1944 |
| 392 | Ga0500618_000001 | 3300053125 | Bacteria | 538477 |
| 393 | Ga0500616_0024584 | 3300053153 | Bacteria | 3345 |
| 394 | Ga0500622_0000898 | 3300053156 | Bacteria | 25324 |
| 395 | Ga0500624_000449 | 3300053157 | Bacteria | 12370 |
| 396 | 2522549063 | 2522125168 | Bacteria | 7376607 |
| 397 | 2586206591 | 2585427687 | Bacteria | 5544917 |
| 398 | 2599477745 | 2599185184 | Bacteria | 6430550 |
| 399 | 2738754819 | 2738541283 | Bacteria | 7222293 |
| 400 | 2738761265 | 2738541284 | Bacteria | 5199923 |
| 401 | 2738853886 | 2738541302 | Bacteria | 5944758 |
| 402 | 2739305149 | 2738543023 | Bacteria | 6767879 |
| 403 | 2739588498 | 2739367651 | Bacteria | 6359826 |
| 404 | 2739616131 | 2739367656 | Bacteria | 5152243 |
| 405 | 2739645152 | 2739367663 | Bacteria | 5040914 |
| 406 | 2776613391 | 2775506987 | Bacteria | 5373360 |
| 407 | 2819549852 | 2818991437 | Bacteria | 5805520 |
| 408 | 2833643472 | 2833640130 | Bacteria | 4858325 |
| 409 | 2842723640 | 2842722452 | Bacteria | 6263924 |
| 410 | 2842906750 | 2842903701 | Bacteria | 6986368 |
| 411 | 2842910146 | 2842909656 | Bacteria | 6185908 |
| 412 | 2849284388 | 2849281842 | Bacteria | 6065644 |
| 413 | 2852623547 | 2852623160 | Bacteria | 4376875 |
| 414 | 2852631699 | 2852627209 | Bacteria | 5896285 |
| 415 | 2857631038 | 2857627736 | Bacteria | 5625397 |
| 416 | 2884937551 | 2884933994 | Bacteria | 4535041 |
| 417 | 2896317904 | 2896317667 | Bacteria | 4606601 |
| 418 | 2902049269 | 2902048731 | Bacteria | 4976191 |
| 419 | 2904445786 | 2904445276 | Bacteria | 5310396 |
| 420 | 2919187046 | 2919186247 | Bacteria | 6244071 |
| 421 | 2919439197 | 2919437846 | Bacteria | 6199444 |
| 422 | 2928079661 | 2928078545 | Bacteria | 6534839 |
| 423 | 2928147862 | 2928147474 | Bacteria | 6512076 |
| 424 | 2932086713 | 2932082852 | Bacteria | 6563563 |
| 425 | 2939665685 | 2939664404 | Bacteria | 6364494 |
| 426 | 2946000519 | 2945997725 | Bacteria | 6404843 |
| 427 | 2954017377 | 2954016120 | Bacteria | 6446024 |
| 428 | 2977232699 | 2977232053 | Bacteria | 5485925 |
| 429 | 3003234447 | 3003233435 | Bacteria | 4458031 |
| 430 | 8055589083 | 8055588893 | Bacteria | 3619545 |
| 431 | Ga0451577_0006468 | |||
| 432 | SwRhRL2b_contig_180147 | |||
| 433 | JGI24736J21556_1001074 | |||
| 434 | JGI24740J21852_10022546 | |||
| 435 | JGI24740J21852_10038188 | |||
| 436 | JGI24737J22298_10005129 | |||
| 437 | JGI24737J22298_10005632 | |||
| 438 | JGI24735J21928_10000014 | |||
| 439 | JGI25162J39368_1000012 | |||
| 440 | JGI25162J39368_1001031 | |||
| 441 | JGI25152J39213_1000075 | |||
| 442 | JGI25150J39212_1000009 | |||
| 443 | JGI25151J46595_10000017 | |||
| 444 | JGI25165J46597_1000869 | |||
| 445 | JGI25153J46596_10000023 | |||
| 446 | rootH1_10005812 | |||
| 447 | rootH1_10012723 | |||
| 448 | rootH1_10021548 | |||
| 449 | rootH1_10024554 | |||
| 450 | rootH1_10029000 | |||
| 451 | rootH1_10039577 | |||
| 452 | rootH2_10004581 | |||
| 453 | rootH2_10086594 | |||
| 454 | rootH2_10142102 | |||
| 455 | rootL2_10122897 | |||
| 456 | rootL2_10128720 | |||
| 457 | rootL2_10129198 | |||
| 458 | rootH1_10003212 | |||
| 459 | rootH1_10019268 | |||
| 460 | rootH1_10026953 | |||
| 461 | rootH1_10065451 | |||
| 462 | rootH1_10087662 | |||
| 463 | rootH1_10091374 | |||
| 464 | rootH1_10097271 | |||
| 465 | rootH1_10130377 | |||
| 466 | Ga0055536_1000003 | |||
| 467 | Ga0055536_1005561 | |||
| 468 | Ga0055530_10010445 | |||
| 469 | Ga0065165_1000538 | |||
| 470 | Ga0065714_10004554 | |||
| 471 | Ga0065714_10005951 | |||
| 472 | Ga0065714_10006907 | |||
| 473 | Ga0065714_10064729 | |||
| 474 | Ga0065714_10064977 | |||
| 475 | Ga0065714_10078103 | |||
| 476 | Ga0065704_10000288 | |||
| 477 | Ga0065704_10110172 | |||
| 478 | Ga0070658_10000019 | |||
| 479 | Ga0070658_10028062 | |||
| 480 | Ga0070658_10032554 | |||
| 481 | Ga0070658_10297778 | |||
| 482 | Ga0070676_10001099 | |||
| 483 | Ga0070683_100050623 | |||
| 484 | Ga0070670_100054029 | |||
| 485 | Ga0070680_100056132 | |||
| 486 | Ga0068868_100018386 | |||
| 487 | Ga0070660_100006548 | |||
| 488 | Ga0070689_100103254 | |||
| 489 | Ga0070674_100024533 | |||
| 490 | Ga0070673_100001076 | |||
| 491 | Ga0070688_100145705 | |||
| 492 | Ga0070667_100077200 | |||
| 493 | Ga0070663_100041849 | |||
| 494 | Ga0070662_100000729 | |||
| 495 | Ga0070662_100054195 | |||
| 496 | Ga0070681_10451528 | |||
| 497 | Ga0068867_100000116 | |||
| 498 | Ga0070679_100001606 | |||
| 499 | Ga0070684_100048214 | |||
| 500 | Ga0068853_100037702 | |||
| 501 | Ga0068853_100174786 | |||
| 502 | Ga0070665_100000003 | |||
| 503 | Ga0068855_100001020 | |||
| 504 | Ga0068855_100014762 | |||
| 505 | Ga0068855_100023678 | |||
| 506 | Ga0068855_100237517 | |||
| 507 | Ga0068857_100193617 | |||
| 508 | Ga0068854_100016513 | |||
| 509 | Ga0068856_100000262 | |||
| 510 | Ga0068856_100001674 | |||
| 511 | Ga0068856_100034800 | |||
| 512 | Ga0068856_100075694 | |||
| 513 | Ga0068852_100000326 | |||
| 514 | Ga0068852_100051110 | |||
| 515 | Ga0068866_10079698 | |||
| 516 | Ga0068860_100064937 | |||
| 517 | Ga0075366_10000263 | |||
| 518 | Ga0075366_10004625 | |||
| 519 | Ga0068871_100000216 | |||
| 520 | Ga0068865_100000051 | |||
| 521 | Ga0105240_10000728 | |||
| 522 | Ga0105240_10013890 | |||
| 523 | Ga0105240_10021480 | |||
| 524 | Ga0105240_10026405 | |||
| 525 | Ga0105240_10132006 | |||
| 526 | Ga0105240_10135429 | |||
| 527 | Ga0105240_10185422 | |||
| 528 | Ga0111539_10009479 | |||
| 529 | Ga0105243_10059676 | |||
| 530 | Ga0105241_10001103 | |||
| 531 | Ga0105241_10005856 | |||
| 532 | Ga0105242_10019154 | |||
| 533 | Ga0105242_10104342 | |||
| 534 | Ga0105237_10000574 | |||
| 535 | Ga0105237_10000622 | |||
| 536 | Ga0105237_10001914 | |||
| 537 | Ga0105237_10003791 | |||
| 538 | Ga0105237_10036675 | |||
| 539 | Ga0105237_10069165 | |||
| 540 | Ga0105237_10078892 | |||
| 541 | Ga0105237_10154264 | |||
| 542 | Ga0105237_10322761 | |||
| 543 | Ga0105238_10145573 | |||
| 544 | Ga0105238_10161073 | |||
| 545 | Ga0105239_10000013 | |||
| 546 | Ga0105239_10000117 | |||
| 547 | Ga0105239_10000139 | |||
| 548 | Ga0105239_10012009 | |||
| 549 | Ga0105239_10019913 | |||
| 550 | Ga0105239_10021149 | |||
| 551 | Ga0105239_10063517 | |||
| 552 | Ga0105246_10104713 | |||
| 553 | Ga0157373_10000041 | |||
| 554 | Ga0157373_10000208 | |||
| 555 | Ga0157373_10003960 | |||
| 556 | Ga0157373_10019523 | |||
| 557 | Ga0157371_10000009 | |||
| 558 | Ga0157371_10002094 | |||
| 559 | Ga0157371_10002124 | |||
| 560 | Ga0157371_10012367 | |||
| 561 | Ga0157371_10021144 | |||
| 562 | Ga0157371_10193530 | |||
| 563 | Ga0157371_10217757 | |||
| 564 | Ga0157370_10003446 | |||
| 565 | Ga0157370_10005009 | |||
| 566 | Ga0157370_10007867 | |||
| 567 | Ga0157370_10021200 | |||
| 568 | Ga0157370_10023237 | |||
| 569 | Ga0157370_10036084 | |||
| 570 | Ga0157370_10050236 | |||
| 571 | Ga0157370_10052601 | |||
| 572 | Ga0157370_10184168 | |||
| 573 | Ga0157370_10188351 | |||
| 574 | Ga0157370_10321099 | |||
| 575 | Ga0157369_10000006 | |||
| 576 | Ga0157369_10001212 | |||
| 577 | Ga0157369_10065263 | |||
| 578 | Ga0157374_10001372 | |||
| 579 | Ga0157374_10001374 | |||
| 580 | Ga0157374_10008308 | |||
| 581 | Ga0157378_10479973 | |||
| 582 | Ga0163162_10000058 | |||
| 583 | Ga0163162_10003377 | |||
| 584 | Ga0163162_10012985 | |||
| 585 | Ga0157372_10000021 | |||
| 586 | Ga0157372_10000181 | |||
| 587 | Ga0157372_10001057 | |||
| 588 | Ga0157372_10001960 | |||
| 589 | Ga0157372_10170533 | |||
| 590 | Ga0157372_10209862 | |||
| 591 | Ga0157375_10013782 | |||
| 592 | Ga0157375_10028794 | |||
| 593 | Ga0157375_10054601 | |||
| 594 | Ga0157375_10179196 | |||
| 595 | Ga0157375_10635312 | |||
| 596 | Ga0163163_10081089 | |||
| 597 | Ga0163163_10281712 | |||
| 598 | Ga0157380_10000002 | |||
| 599 | Ga0182008_10000001 | |||
| 600 | Ga0182008_10000658 | |||
| 601 | Ga0157376_10102459 | |||
| 602 | Ga0182006_1000244 | |||
| 603 | Ga0182006_1004312 | |||
| 604 | Ga0182007_10000001 | |||
| 605 | Ga0183373_1010 | |||
| 606 | Ga0163161_10000468 | |||
| 607 | Ga0163161_10000919 | |||
| 608 | Ga0163161_10011700 | |||
| 609 | Ga0163161_10025802 | |||
| 610 | Ga0163161_10044622 | |||
| 611 | Ga0163161_10146543 | |||
| 612 | Ga0207427_100085 | |||
| 613 | Ga0209437_100041 | |||
| 614 | Ga0209437_100052 | |||
| 615 | Ga0207425_1000007 | |||
| 616 | Ga0209026_1001421 | |||
| 617 | Ga0209026_1001617 | |||
| 618 | Ga0209026_1010898 | |||
| 619 | Ga0209129_1000006 | |||
| 620 | Ga0209233_1000067 | |||
| 621 | Ga0209676_1000001 | |||
| 622 | Ga0209676_1001025 | |||
| 623 | Ga0209025_1000025 | |||
| 624 | Ga0209758_1000016 | |||
| 625 | Ga0209050_1000016 | |||
| 626 | Ga0207647_10000063 | |||
| 627 | Ga0207647_10003913 | |||
| 628 | Ga0207647_10135036 | |||
| 629 | Ga0207645_10000127 | |||
| 630 | Ga0207705_10000069 | |||
| 631 | Ga0207705_10038630 | |||
| 632 | Ga0207705_10070996 | |||
| 633 | Ga0207654_10002013 | |||
| 634 | Ga0207654_10009834 | |||
| 635 | Ga0207707_10312509 | |||
| 636 | Ga0207695_10000189 | |||
| 637 | Ga0207695_10008676 | |||
| 638 | Ga0207695_10012473 | |||
| 639 | Ga0207695_10029017 | |||
| 640 | Ga0207695_10109032 | |||
| 641 | Ga0207695_10135075 | |||
| 642 | Ga0207671_10002529 | |||
| 643 | Ga0207671_10005361 | |||
| 644 | Ga0207671_10005609 | |||
| 645 | Ga0207671_10025739 | |||
| 646 | Ga0207671_10040945 | |||
| 647 | Ga0207671_10055331 | |||
| 648 | Ga0207671_10185586 | |||
| 649 | Ga0207671_10230300 | |||
| 650 | Ga0207657_10022645 | |||
| 651 | Ga0207652_10007343 | |||
| 652 | Ga0207694_10149625 | |||
| 653 | Ga0207650_10103175 | |||
| 654 | Ga0207690_10008515 | |||
| 655 | Ga0207706_10001974 | |||
| 656 | Ga0207706_10093490 | |||
| 657 | Ga0207669_10028803 | |||
| 658 | Ga0207704_10000046 | |||
| 659 | Ga0207704_10098714 | |||
| 660 | Ga0207661_10035105 | |||
| 661 | Ga0207667_10000009 | |||
| 662 | Ga0207667_10000896 | |||
| 663 | Ga0207667_10044510 | |||
| 664 | Ga0207667_10308703 | |||
| 665 | Ga0207651_10005508 | |||
| 666 | Ga0207640_10013718 | |||
| 667 | Ga0207677_10010556 | |||
| 668 | Ga0207639_10022378 | |||
| 669 | Ga0207639_10178735 | |||
| 670 | Ga0207639_10446265 | |||
| 671 | Ga0207678_10042011 | |||
| 672 | Ga0207702_10000492 | |||
| 673 | Ga0207702_10003618 | |||
| 674 | Ga0207702_10033748 | |||
| 675 | Ga0207702_10103011 | |||
| 676 | Ga0207648_10000257 | |||
| 677 | Ga0207674_10215228 | |||
| 678 | Ga0207698_10090892 | |||
| 679 | Ga0268266_10000078 | |||
| 680 | Ga0268264_10055786 | |||
| 681 | Ga0307517_10001926 | |||
| 682 | Ga0307515_10000076 | |||
| 683 | Ga0307515_10013120 | |||
| 684 | Ga0307515_10029999 | |||
| 685 | Ga0265338_10001618 | |||
| 686 | Ga0316176_1138478 | |||
| 687 | Ga0316183_1026870 | |||
| 688 | Ga0316181_1200512 | |||
| 689 | Ga0316182_1038659 | |||
| 690 | Ga0265327_10005429 | |||
| 691 | Ga0265327_10031363 | |||
| 692 | Ga0307509_10245846 | |||
| 693 | Ga0307408_100001460 | |||
| 694 | Ga0307408_100005243 | |||
| 695 | Ga0316575_10092184 | |||
| 696 | Ga0265342_10088813 | |||
| 697 | Ga0316576_10098213 | |||
| 698 | Ga0316576_10173051 | |||
| 699 | Ga0316578_10003510 | |||
| 700 | Ga0316578_10019920 | |||
| 701 | Ga0307405_10000010 | |||
| 702 | Ga0316577_10058090 | |||
| 703 | Ga0316577_10128404 | |||
| 704 | Ga0307407_10000009 | |||
| 705 | Ga0307412_10000033 | |||
| 706 | Ga0307412_10000906 | |||
| 707 | Ga0307416_100000019 | |||
| 708 | Ga0307414_10000017 | |||
| 709 | Ga0307414_10002459 | |||
| 710 | Ga0307414_10003061 | |||
| 711 | Ga0307414_10004573 | |||
| 712 | Ga0316585_10011711 | |||
| 713 | Ga0307507_10000015 | |||
| 714 | Ga0316582_0215437 | |||
| 715 | Ga0316584_0002153 | |||
| 716 | Ga0395899_0000001 | |||
| 717 | Ga0395899_0000733 | |||
| 718 | Ga0395899_0002325 | |||
| 719 | Ga0395900_0000501 | |||
| 720 | Ga0395900_0005430 | |||
| 721 | Ga0395900_0006437 | |||
| 722 | Ga0395900_0052252 | |||
| 723 | Ga0395898_0013107 | |||
| 724 | Ga0395898_0123682 | |||
| 725 | Ga0395905_0001099 | |||
| 726 | Ga0395905_0007115 | |||
| 727 | Ga0395905_0008184 | |||
| 728 | Ga0395901_0017156 | |||
| 729 | Ga0395901_0048154 | |||
| 730 | Ga0395901_0215283 | |||
| 731 | Ga0400483_045849 | |||
| 732 | Ga0400483_247412 | |||
| 733 | Ga0400489_01897 | |||
| 734 | Ga0439448_0006462 | |||
| 735 | Ga0451577_0053174 | |||
| 736 | Ga0451577_0268285 | |||
| 737 | Ga0453683_0000140 | |||
| 738 | Ga0453683_0076336 | |||
| 739 | Ga0453683_0137456 | |||
| 740 | Ga0466966_0171675 | |||
| 741 | Ga0453684_0000948 | |||
| 742 | Ga0453684_0003935 | |||
| 743 | Ga0453684_0006558 | |||
| 744 | Ga0453684_0010531 | |||
| 745 | Ga0453684_0018092 | |||
| 746 | Ga0453684_0029550 | |||
| 747 | Ga0453684_0037597 | |||
| 748 | Ga0453684_0039364 | |||
| 749 | Ga0453684_0127473 | |||
| 750 | Ga0453684_0310401 | |||
| 751 | Ga0466959_0029637 | |||
| 752 | Ga0451576_0000795 | |||
| 753 | Ga0451576_0002738 | |||
| 754 | Ga0451576_0009157 | |||
| 755 | Ga0451576_0015780 | |||
| 756 | Ga0451576_0064630 | |||
| 757 | Ga0495592_0147355 | |||
| 758 | Ga0495650_0000003 | |||
| 759 | Ga0495650_0125650 | |||
| 760 | Ga0495585_0000510 | |||
| 761 | Ga0495585_0000904 | |||
| 762 | Ga0495596_0014549 | |||
| 763 | Ga0495606_0000145 | |||
| 764 | Ga0495606_0014766 | |||
| 765 | Ga0495606_0016434 | |||
| 766 | Ga0495606_0021807 | |||
| 767 | Ga0495610_0000028 | |||
| 768 | Ga0495610_0002358 | |||
| 769 | Ga0495610_0002790 | |||
| 770 | Ga0495610_0019770 | |||
| 771 | Ga0495616_0007696 | |||
| 772 | Ga0495616_0029348 | |||
| 773 | Ga0495631_0037090 | |||
| 774 | Ga0495648_0007367 | |||
| 775 | Ga0495648_0062000 | |||
| 776 | Ga0495652_0031760 | |||
| 777 | Ga0495640_0181199 | |||
| 778 | Ga0495609_0013121 | |||
| 779 | Ga0495609_0027579 | |||
| 780 | Ga0495622_0030966 | |||
| 781 | Ga0495633_0000069 | |||
| 782 | Ga0495668_0000021 | |||
| 783 | Ga0495634_0097754 | |||
| 784 | Ga0495625_0000005 | |||
| 785 | Ga0495625_0003181 | |||
| 786 | Ga0495625_0022439 | |||
| 787 | Ga0495625_0108732 | |||
| 788 | Ga0495625_0206312 | |||
| 789 | Ga0495661_0000244 | |||
| 790 | Ga0495661_0007661 | |||
| 791 | Ga0495661_0040960 | |||
| 792 | Ga0495658_0054638 | |||
| 793 | Ga0495649_0000003 | |||
| 794 | Ga0495683_0027778 | |||
| 795 | Ga0495683_0074097 | |||
| 796 | Ga0495687_001307 | |||
| 797 | Ga0495687_004955 | |||
| 798 | Ga0495686_0000106 | |||
| 799 | Ga0495686_0003562 | |||
| 800 | Ga0495686_0015132 | |||
| 801 | Ga0495686_0113526 | |||
| 802 | Ga0495614_0076436 | |||
| 803 | Ga0496115_0008303 | |||
| 804 | Ga0496122_0001345 | |||
| 805 | Ga0495678_032950 | |||
| 806 | Ga0495682_0021994 | |||
| 807 | Ga0501210_000622 | |||
| 808 | Ga0501217_002957 | |||
| 809 | Ga0501236_000595 | |||
| 810 | Ga0501257_000192 | |||
| 811 | Ga0501264_000239 | |||
| 812 | nmdc:mga0k408_4467_c1 | |||
| 813 | nmdc:mga0k408_53_c1 | |||
| 814 | nmdc:mga08y16_24282_c1 | |||
| 815 | Ga0500635_0000554 | |||
| 816 | Ga0500635_0019847 | |||
| 817 | Ga0500651_0001374 | |||
| 818 | Ga0500608_012839 | |||
| 819 | Ga0500608_037643 | |||
| 820 | Ga0500614_011099 | |||
| 821 | Ga0500618_000001 | |||
| 822 | Ga0500616_0024584 | |||
| 823 | Ga0500622_0000898 | |||
| 824 | Ga0500624_000449 | |||
| 825 | 2522549063 | |||
| 826 | 2586206591 | |||
| 827 | 2599477745 | |||
| 828 | 2738754819 | |||
| 829 | 2738761265 | |||
| 830 | 2738853886 | |||
| 831 | 2739305149 | |||
| 832 | 2739588498 | |||
| 833 | 2739616131 | |||
| 834 | 2739645152 | |||
| 835 | 2776613391 | |||
| 836 | 2819549852 | |||
| 837 | 2833643472 | |||
| 838 | 2842723640 | |||
| 839 | 2842906750 | |||
| 840 | 2842910146 | |||
| 841 | 2849284388 | |||
| 842 | 2852623547 | |||
| 843 | 2852631699 | |||
| 844 | 2857631038 | |||
| 845 | 2884937551 | |||
| 846 | 2896317904 | |||
| 847 | 2902049269 | |||
| 848 | 2904445786 | |||
| 849 | 2919187046 | |||
| 850 | 2919439197 | |||
| 851 | 2928079661 | |||
| 852 | 2928147862 | |||
| 853 | 2932086713 | |||
| 854 | 2939665685 | |||
| 855 | 2946000519 | |||
| 856 | 2954017377 | |||
| 857 | 2977232699 | |||
| 858 | 3003234447 | |||
| 859 | 8055589083 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4d11-assembly4.cif.gz_F | galnac-t2 crystal soaked with udp-5sgalnac, mea2 peptide and manganese (lower resolution dataset) | 0.8092 | 2 | 224 |
| 4d11-assembly1.cif.gz_A | galnac-t2 crystal soaked with udp-5sgalnac, mea2 peptide and manganese (lower resolution dataset) | 0.7908 | 2 | 254 |
| 6nqt-assembly1.cif.gz_C | galnac-t2 soaked with udp-sugar | 0.7901 | 2 | 254 |
| 7qoq-assembly1.cif.gz_A | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 in complex with ump and magnesium | 0.7878 | 3 | 119 |
| 6h0b-assembly2.cif.gz_B | crystal structure of the human galnac-t4 in complex with udp, manganese and the diglycopeptide 6. | 0.7871 | 2 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71795_2_224_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8381 | 3 | 123 | 3.90.550.10 |
| 4d11F00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8092 | 2 | 224 | 3.90.550.10 |
| af_G3X942_85_462_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8014 | 2 | 261 | 3.90.550.10 |
| af_A0A096MIV6_83_419_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7994 | 2 | 261 | 3.90.550.10 |
| af_A0A2R8QCE8_89_340_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7904 | 3 | 144 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E4L2L8-F1-model_v4 | Glycosyl hydrolase | 0.9743 | 1 | 109 |
GO:0016787
|
| AF-A0A662EF15-F1-model_v4 | Glycosyltransferase family 2 protein | 0.965 | 2 | 336 |
GO:0016020
GO:0016740 |
| AF-A0A532UTV9-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9635 | 6 | 338 |
|
| AF-A0A3C0HEV2-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9609 | 3 | 337 |
|
| AF-A0A7V2RMA3-F1-model_v4 | Bifunctional riboflavin kinase/FMN adenylyltransferase (EC 2.7.1.26) (EC 2.7.7.2) | 0.9581 | 2 | 336 |
GO:0003919
GO:0005524 GO:0006747 GO:0008531 GO:0009231 GO:0009398 GO:0016020 |