F441968

General Info

Members Datasets Scaffolds Average Seq Length
429 230 859 343

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0006468|Ga0451577_0006468_5281_6402
Length 373
Sequence MYNILKILSGKNLHTGCGVTGGGNIKNLNDMPELAIVILNWNGLEFLKKFLGTVVRYSTSHSTEIYVADNGSSDDSVKWIMEHFREINLLKLEKNNGFAGGYNIALEQITAKYYLLLNSDIEVTEGWIEPLLKHMNDNPGCAACQPRVLSWFRKEYFEYAGASGGYIDKYGYPFCRGRIFGHIEKDEGQYNDNVRVFWTSGACMMIRSDAWKNCGGFDASFFAHMEEIDLCWRLNNAGFSLECIPESFVYHVGGGTLSYNSPYKTYLNFRNSLYMLYKNLDQNDLKRVLFIRRLLDGIAALTFLARGHFKSFLSVWRAHMDYNKNLPELKVKRRDIQKNINEYYSLPVLNKSIVFEFYARGKRTFRSLNLIFK

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
146 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
191 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
192 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
196 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
197 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
198 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
199 2738541283 Pedobacter sp. OK701 Isolate Unclassified
200 2738541284 Pedobacter sp. YR016 Isolate Unclassified
201 2738541302 Pedobacter sp. CF074 Isolate Unclassified
202 2738543023 Pedobacter sp. OK628 Isolate Unclassified
203 2739367651 Pedobacter sp. OK291 Isolate Unclassified
204 2739367656 Pedobacter sp. CF523 Isolate Unclassified
205 2739367663 Pedobacter sp. YR510 Isolate Unclassified
206 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
207 2818991437 Pedobacter terrae 518 Isolate Unclassified
208 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
209 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
210 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
211 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
212 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
213 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
214 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
215 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
216 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
217 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
218 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
219 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
220 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
221 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
222 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
223 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
224 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
225 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
226 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
227 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
228 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
229 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
230 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0
Isolates 8.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 0
Rhizoplane 0.47
Rhizosphere 79.49
Stem 0
Stem Tuber 0
Unclassified 3.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0006468 3300042876 Bacteria 11674
2 SwRhRL2b_contig_180147 2162886007 Bacteria 5368
3 JGI24736J21556_1001074 3300001904 Bacteria 5001
4 JGI24740J21852_10022546 3300001979 Bacteria 2165
5 JGI24740J21852_10038188 3300001979 Bacteria 1475
6 JGI24737J22298_10005129 3300001990 Bacteria 4535
7 JGI24737J22298_10005632 3300001990 Bacteria 4316
8 JGI24735J21928_10000014 3300002067 Bacteria 186670
9 JGI25162J39368_1000012 3300002737 Bacteria 373191
10 JGI25162J39368_1001031 3300002737 Bacteria 17224
11 JGI25152J39213_1000075 3300002773 Bacteria 66427
12 JGI25150J39212_1000009 3300002774 Bacteria 249509
13 JGI25151J46595_10000017 3300003187 Bacteria 249509
14 JGI25165J46597_1000869 3300003214 Bacteria 21479
15 JGI25153J46596_10000023 3300003215 Bacteria 249509
16 rootH1_10005812 3300003316 Bacteria 4957
17 rootH1_10012723 3300003316 Bacteria 1260
18 rootH1_10021548 3300003316 Bacteria 2148
19 rootH1_10021548 3300003323 Bacteria 15874
20 rootH1_10024554 3300003316 Bacteria 8245
21 rootH1_10029000 3300003316 Bacteria 3117
22 rootH1_10039577 3300003316 Bacteria 1662
23 rootH2_10004581 3300003320 Bacteria 18930
24 rootH2_10086594 3300003320 Bacteria 7985
25 rootH2_10142102 3300003320 Bacteria 1153
26 rootL2_10122897 3300003322 Bacteria 3188
27 rootL2_10128720 3300003322 Bacteria 4301
28 rootL2_10129198 3300003322 Bacteria 3656
29 rootH1_10003212 3300003323 Bacteria 182359
30 rootH1_10019268 3300003323 Bacteria 3643
31 rootH1_10026953 3300003323 Bacteria 2579
32 rootH1_10065451 3300003323 Bacteria 1537
33 rootH1_10087662 3300003323 Bacteria 1735
34 rootH1_10091374 3300003323 Bacteria 4204
35 rootH1_10097271 3300003323 Bacteria 1630
36 rootH1_10130377 3300003323 Bacteria 3529
37 Ga0055536_1000003 3300003781 Bacteria 447744
38 Ga0055536_1005561 3300003781 Bacteria 6122
39 Ga0055530_10010445 3300003791 Bacteria 3431
40 Ga0065165_1000538 3300005262 Bacteria 57448
41 Ga0065714_10004554 3300005288 Bacteria 7294
42 Ga0065714_10005951 3300005288 Bacteria 7262
43 Ga0065714_10006907 3300005288 Bacteria 4696
44 Ga0065714_10064729 3300005288 Bacteria 20931
45 Ga0065714_10064977 3300005288 Bacteria 14539
46 Ga0065714_10078103 3300005288 Bacteria 2615
47 Ga0065704_10000288 3300005289 Bacteria 77379
48 Ga0065704_10110172 3300005289 Bacteria 1986
49 Ga0070658_10000019 3300005327 Bacteria 194742
50 Ga0070658_10028062 3300005327 Bacteria 4518
51 Ga0070658_10032554 3300005327 Unclassified 4192
52 Ga0070658_10297778 3300005327 Bacteria 1375
53 Ga0070676_10001099 3300005328 Bacteria 13512
54 Ga0070683_100050623 3300005329 Unclassified 3846
55 Ga0070670_100054029 3300005331 Bacteria 3448
56 Ga0070680_100056132 3300005336 Bacteria 3219
57 Ga0068868_100018386 3300005338 Bacteria 5226
58 Ga0070660_100006548 3300005339 Bacteria 8080
59 Ga0070689_100103254 3300005340 Bacteria 2259
60 Ga0070674_100024533 3300005356 Bacteria 3915
61 Ga0070673_100001076 3300005364 Bacteria 15617
62 Ga0070688_100145705 3300005365 Bacteria 1613
63 Ga0070667_100077200 3300005367 Unclassified 2844
64 Ga0070663_100041849 3300005455 Bacteria 3216
65 Ga0070662_100000729 3300005457 Bacteria 20118
66 Ga0070662_100054195 3300005457 Bacteria 2906
67 Ga0070681_10451528 3300005458 Bacteria 1197
68 Ga0068867_100000116 3300005459 Bacteria 50447
69 Ga0070679_100001606 3300005530 Bacteria 20303
70 Ga0070684_100048214 3300005535 Bacteria 3695
71 Ga0068853_100037702 3300005539 Bacteria 4114
72 Ga0068853_100174786 3300005539 Bacteria 1945
73 Ga0070665_100000003 3300005548 Bacteria 811857
74 Ga0068855_100001020 3300005563 Bacteria 34917
75 Ga0068855_100014762 3300005563 Bacteria 9412
76 Ga0068855_100023678 3300005563 Bacteria 7353
77 Ga0068855_100237517 3300005563 Unclassified 2038
78 Ga0068857_100193617 3300005577 Bacteria 1852
79 Ga0068854_100016513 3300005578 Bacteria 4923
80 Ga0068856_100000262 3300005614 Bacteria 57470
81 Ga0068856_100001674 3300005614 Bacteria 23218
82 Ga0068856_100034800 3300005614 Bacteria 4935
83 Ga0068856_100075694 3300005614 Bacteria 3334
84 Ga0068852_100000326 3300005616 Bacteria 32458
85 Ga0068852_100051110 3300005616 Bacteria 3545
86 Ga0068866_10079698 3300005718 Bacteria 1755
87 Ga0068860_100064937 3300005843 Bacteria 3466
88 Ga0075366_10000263 3300006195 Bacteria 23219
89 Ga0075366_10004625 3300006195 Bacteria 7396
90 Ga0068871_100000216 3300006358 Bacteria 40288
91 Ga0068865_100000051 3300006881 Bacteria 65346
92 Ga0105240_10000728 3300009093 Bacteria 60140
93 Ga0105240_10013890 3300009093 Bacteria 11031
94 Ga0105240_10021480 3300009093 Bacteria 8584
95 Ga0105240_10026405 3300009093 Bacteria 7619
96 Ga0105240_10132006 3300009093 Bacteria 2995
97 Ga0105240_10135429 3300009093 Bacteria 2950
98 Ga0105240_10185422 3300009093 Bacteria 2451
99 Ga0111539_10009479 3300009094 Bacteria 12287
100 Ga0105243_10059676 3300009148 Bacteria 3045
101 Ga0105241_10001103 3300009174 Bacteria 20558
102 Ga0105241_10005856 3300009174 Bacteria 9074
103 Ga0105242_10019154 3300009176 Bacteria 5361
104 Ga0105242_10104342 3300009176 Bacteria 2406
105 Ga0105237_10000574 3300009545 Bacteria 51427
106 Ga0105237_10000622 3300009545 Bacteria 49566
107 Ga0105237_10001914 3300009545 Bacteria 26581
108 Ga0105237_10003791 3300009545 Bacteria 17772
109 Ga0105237_10036675 3300009545 Bacteria 4961
110 Ga0105237_10069165 3300009545 Bacteria 3526
111 Ga0105237_10078892 3300009545 Bacteria 3282
112 Ga0105237_10154264 3300009545 Bacteria 2293
113 Ga0105237_10322761 3300009545 Bacteria 1548
114 Ga0105238_10145573 3300009551 Bacteria 2346
115 Ga0105238_10161073 3300009551 Bacteria 2219
116 Ga0105239_10000013 3300010375 Bacteria 327371
117 Ga0105239_10000117 3300010375 Bacteria 112291
118 Ga0105239_10000139 3300010375 Bacteria 102090
119 Ga0105239_10012009 3300010375 Bacteria 9659
120 Ga0105239_10019913 3300010375 Bacteria 7405
121 Ga0105239_10021149 3300010375 Bacteria 7176
122 Ga0105239_10063517 3300010375 Bacteria 4054
123 Ga0105246_10104713 3300011119 Bacteria 2067
124 Ga0157373_10000041 3300013100 Bacteria 113871
125 Ga0157373_10000208 3300013100 Bacteria 48082
126 Ga0157373_10003960 3300013100 Bacteria 11180
127 Ga0157373_10019523 3300013100 Bacteria 4930
128 Ga0157371_10000009 3300013102 Bacteria 392895
129 Ga0157371_10002094 3300013102 Bacteria 19489
130 Ga0157371_10002124 3300013102 Bacteria 19289
131 Ga0157371_10012367 3300013102 Bacteria 6528
132 Ga0157371_10021144 3300013102 Bacteria 4781
133 Ga0157371_10193530 3300013102 Bacteria 1456
134 Ga0157371_10217757 3300013102 Bacteria 1371
135 Ga0157370_10003446 3300013104 Bacteria 18565
136 Ga0157370_10005009 3300013104 Bacteria 14976
137 Ga0157370_10007867 3300013104 Bacteria 11555
138 Ga0157370_10021200 3300013104 Bacteria 6478
139 Ga0157370_10023237 3300013104 Bacteria 6157
140 Ga0157370_10036084 3300013104 Bacteria 4800
141 Ga0157370_10050236 3300013104 Bacteria 3986
142 Ga0157370_10052601 3300013104 Bacteria 3888
143 Ga0157370_10184168 3300013104 Bacteria 1939
144 Ga0157370_10188351 3300013104 Bacteria 1916
145 Ga0157370_10321099 3300013104 Bacteria 1428
146 Ga0157369_10000006 3300013105 Bacteria 412230
147 Ga0157369_10001212 3300013105 Bacteria 32139
148 Ga0157369_10065263 3300013105 Bacteria 3918
149 Ga0157374_10001372 3300013296 Bacteria 20693
150 Ga0157374_10001374 3300013296 Bacteria 20684
151 Ga0157374_10008308 3300013296 Bacteria 8857
152 Ga0157378_10479973 3300013297 Bacteria 1238
153 Ga0163162_10000058 3300013306 Bacteria 108298
154 Ga0163162_10003377 3300013306 Bacteria 15275
155 Ga0163162_10012985 3300013306 Bacteria 8127
156 Ga0157372_10000021 3300013307 Bacteria 207801
157 Ga0157372_10000181 3300013307 Bacteria 69472
158 Ga0157372_10001057 3300013307 Bacteria 30071
159 Ga0157372_10001960 3300013307 Bacteria 22372
160 Ga0157372_10170533 3300013307 Bacteria 2518
161 Ga0157372_10209862 3300013307 Bacteria 2257
162 Ga0157375_10013782 3300013308 Bacteria 7206
163 Ga0157375_10028794 3300013308 Bacteria 5213
164 Ga0157375_10054601 3300013308 Bacteria 3935
165 Ga0157375_10179196 3300013308 Bacteria 2270
166 Ga0157375_10635312 3300013308 Bacteria 1225
167 Ga0163163_10081089 3300014325 Bacteria 3246
168 Ga0163163_10281712 3300014325 Unclassified 1714
169 Ga0157380_10000002 3300014326 Bacteria 236273
170 Ga0182008_10000001 3300014497 Bacteria 540790
171 Ga0182008_10000658 3300014497 Bacteria 25096
172 Ga0157376_10102459 3300014969 Bacteria 2504
173 Ga0182006_1000244 3300015261 Bacteria 50752
174 Ga0182006_1004312 3300015261 Bacteria 7039
175 Ga0182007_10000001 3300015262 Bacteria 1127301
176 Ga0183373_1010 3300015682 Bacteria 196982
177 Ga0163161_10000468 3300017792 Bacteria 33545
178 Ga0163161_10000919 3300017792 Bacteria 22732
179 Ga0163161_10011700 3300017792 Bacteria 6089
180 Ga0163161_10025802 3300017792 Bacteria 4161
181 Ga0163161_10044622 3300017792 Bacteria 3194
182 Ga0163161_10146543 3300017792 Bacteria 1791
183 Ga0207427_100085 3300025231 Bacteria 142561
184 Ga0209437_100041 3300025233 Bacteria 444465
185 Ga0209437_100052 3300025233 Bacteria 380548
186 Ga0207425_1000007 3300025245 Bacteria 777411
187 Ga0209026_1001421 3300025250 Bacteria 10631
188 Ga0209026_1001617 3300025250 Bacteria 9627
189 Ga0209026_1010898 3300025250 Bacteria 1668
190 Ga0209129_1000006 3300025258 Bacteria 777761
191 Ga0209233_1000067 3300025261 Bacteria 380554
192 Ga0209676_1000001 3300025292 Bacteria 1852142
193 Ga0209676_1001025 3300025292 Bacteria 32516
194 Ga0209025_1000025 3300025294 Bacteria 524454
195 Ga0209758_1000016 3300025297 Bacteria 778557
196 Ga0209050_1000016 3300025298 Bacteria 729149
197 Ga0207647_10000063 3300025904 Bacteria 83442
198 Ga0207647_10003913 3300025904 Bacteria 11123
199 Ga0207647_10135036 3300025904 Bacteria 1448
200 Ga0207645_10000127 3300025907 Bacteria 58003
201 Ga0207705_10000069 3300025909 Bacteria 133094
202 Ga0207705_10038630 3300025909 Bacteria 3419
203 Ga0207705_10070996 3300025909 Bacteria 2524
204 Ga0207654_10002013 3300025911 Bacteria 10448
205 Ga0207654_10009834 3300025911 Bacteria 4863
206 Ga0207707_10312509 3300025912 Bacteria 1357
207 Ga0207695_10000189 3300025913 Bacteria 177142
208 Ga0207695_10008676 3300025913 Bacteria 12683
209 Ga0207695_10012473 3300025913 Bacteria 10200
210 Ga0207695_10029017 3300025913 Bacteria 6122
211 Ga0207695_10109032 3300025913 Bacteria 2751
212 Ga0207695_10135075 3300025913 Bacteria 2420
213 Ga0207671_10002529 3300025914 Bacteria 19484
214 Ga0207671_10005361 3300025914 Bacteria 11857
215 Ga0207671_10005609 3300025914 Bacteria 11516
216 Ga0207671_10025739 3300025914 Bacteria 4416
217 Ga0207671_10040945 3300025914 Bacteria 3429
218 Ga0207671_10055331 3300025914 Bacteria 2939
219 Ga0207671_10185586 3300025914 Bacteria 1620
220 Ga0207671_10230300 3300025914 Bacteria 1453
221 Ga0207657_10022645 3300025919 Bacteria 5872
222 Ga0207652_10007343 3300025921 Bacteria 8884
223 Ga0207694_10149625 3300025924 Bacteria 1880
224 Ga0207650_10103175 3300025925 Bacteria 2198
225 Ga0207690_10008515 3300025932 Bacteria 6084
226 Ga0207706_10001974 3300025933 Bacteria 20125
227 Ga0207706_10093490 3300025933 Bacteria 2644
228 Ga0207669_10028803 3300025937 Bacteria 3061
229 Ga0207704_10000046 3300025938 Bacteria 86187
230 Ga0207704_10098714 3300025938 Bacteria 1941
231 Ga0207661_10035105 3300025944 Unclassified 3905
232 Ga0207667_10000009 3300025949 Bacteria 603135
233 Ga0207667_10000896 3300025949 Bacteria 37967
234 Ga0207667_10044510 3300025949 Bacteria 4703
235 Ga0207667_10308703 3300025949 Bacteria 1616
236 Ga0207651_10005508 3300025960 Bacteria 6510
237 Ga0207640_10013718 3300025981 Bacteria 4651
238 Ga0207677_10010556 3300026023 Bacteria 5234
239 Ga0207639_10022378 3300026041 Bacteria 4553
240 Ga0207639_10178735 3300026041 Bacteria 1803
241 Ga0207639_10446265 3300026041 Bacteria 1174
242 Ga0207678_10042011 3300026067 Bacteria 3963
243 Ga0207702_10000492 3300026078 Bacteria 44456
244 Ga0207702_10003618 3300026078 Bacteria 14034
245 Ga0207702_10033748 3300026078 Bacteria 4276
246 Ga0207702_10103011 3300026078 Bacteria 2524
247 Ga0207648_10000257 3300026089 Bacteria 57438
248 Ga0207674_10215228 3300026116 Bacteria 1870
249 Ga0207698_10090892 3300026142 Bacteria 2497
250 Ga0268266_10000078 3300028379 Bacteria 213632
251 Ga0268264_10055786 3300028381 Bacteria 3302
252 Ga0307517_10001926 3300028786 Bacteria 33977
253 Ga0307515_10000076 3300028794 Bacteria 228736
254 Ga0307515_10013120 3300028794 Bacteria 15511
255 Ga0307515_10029999 3300028794 Bacteria 9162
256 Ga0265338_10001618 3300028800 Bacteria 36039
257 Ga0316176_1138478 3300030732 Bacteria 3018
258 Ga0316183_1026870 3300030742 Bacteria 28320
259 Ga0316181_1200512 3300030744 Bacteria 12003
260 Ga0316182_1038659 3300030745 Unclassified 3501
261 Ga0265327_10005429 3300031251 Bacteria 10632
262 Ga0265327_10031363 3300031251 Bacteria 2987
263 Ga0307509_10245846 3300031507 Bacteria 1577
264 Ga0307408_100001460 3300031548 Bacteria 17553
265 Ga0307408_100005243 3300031548 Bacteria 8688
266 Ga0316575_10092184 3300031665 Unclassified 1228
267 Ga0265342_10088813 3300031712 Bacteria 1774
268 Ga0316576_10098213 3300031727 Bacteria 2187
269 Ga0316576_10173051 3300031727 Unclassified 1629
270 Ga0316578_10003510 3300031728 Bacteria 7198
271 Ga0316578_10019920 3300031728 Bacteria 3701
272 Ga0307405_10000010 3300031731 Bacteria 250978
273 Ga0316577_10058090 3300031733 Bacteria 2160
274 Ga0316577_10128404 3300031733 Unclassified 1426
275 Ga0307407_10000009 3300031903 Bacteria 188746
276 Ga0307412_10000033 3300031911 Bacteria 206649
277 Ga0307412_10000906 3300031911 Bacteria 17033
278 Ga0307416_100000019 3300032002 Bacteria 199706
279 Ga0307414_10000017 3300032004 Bacteria 247306
280 Ga0307414_10002459 3300032004 Bacteria 9703
281 Ga0307414_10003061 3300032004 Bacteria 8869
282 Ga0307414_10004573 3300032004 Bacteria 7528
283 Ga0316585_10011711 3300032137 Bacteria 2589
284 Ga0307507_10000015 3300033179 Bacteria 237419
285 Ga0316582_0215437 3300036647 Unclassified 1312
286 Ga0316584_0002153 3300036712 Bacteria 12332
287 Ga0395899_0000001 3300037312 Bacteria 1750322
288 Ga0395899_0000733 3300037312 Bacteria 32767
289 Ga0395899_0002325 3300037312 Bacteria 15475
290 Ga0395900_0000501 3300037418 Bacteria 55054
291 Ga0395900_0005430 3300037418 Bacteria 13356
292 Ga0395900_0006437 3300037418 Bacteria 12240
293 Ga0395900_0052252 3300037418 Bacteria 4207
294 Ga0395898_0013107 3300037466 Bacteria 8548
295 Ga0395898_0123682 3300037466 Bacteria 2479
296 Ga0395905_0001099 3300037471 Bacteria 34042
297 Ga0395905_0007115 3300037471 Bacteria 11181
298 Ga0395905_0008184 3300037471 Bacteria 10325
299 Ga0395901_0017156 3300038443 Bacteria 7385
300 Ga0395901_0048154 3300038443 Bacteria 4427
301 Ga0395901_0215283 3300038443 Bacteria 2009
302 Ga0400483_045849 3300039062 Bacteria 18158
303 Ga0400483_247412 3300039062 Bacteria 16063
304 Ga0400489_01897 3300039093 Bacteria 13325
305 Ga0439448_0006462 3300042005 Bacteria 3372
306 Ga0451577_0053174 3300042876 Bacteria 3616
307 Ga0451577_0268285 3300042876 Bacteria 1546
308 Ga0453683_0000140 3300044673 Bacteria 105316
309 Ga0453683_0076336 3300044673 Bacteria 2098
310 Ga0453683_0137456 3300044673 Unclassified 1541
311 Ga0466966_0171675 3300044684 Bacteria 1317
312 Ga0453684_0000948 3300044712 Bacteria 95689
313 Ga0453684_0003935 3300044712 Bacteria 32603
314 Ga0453684_0006558 3300044712 Bacteria 22028
315 Ga0453684_0010531 3300044712 Bacteria 15789
316 Ga0453684_0018092 3300044712 Bacteria 10848
317 Ga0453684_0029550 3300044712 Bacteria 7778
318 Ga0453684_0037597 3300044712 Bacteria 6642
319 Ga0453684_0039364 3300044712 Bacteria 6444
320 Ga0453684_0127473 3300044712 Bacteria 3061
321 Ga0453684_0310401 3300044712 Bacteria 1790
322 Ga0466959_0029637 3300045049 Bacteria 4055
323 Ga0451576_0000795 3300045051 Bacteria 61946
324 Ga0451576_0002738 3300045051 Bacteria 25581
325 Ga0451576_0009157 3300045051 Bacteria 11505
326 Ga0451576_0015780 3300045051 Bacteria 8359
327 Ga0451576_0064630 3300045051 Bacteria 3811
328 Ga0495592_0147355 3300046454 Bacteria 1631
329 Ga0495650_0000003 3300046471 Bacteria 900730
330 Ga0495650_0125650 3300046471 Bacteria 940
331 Ga0495585_0000510 3300046492 Bacteria 36718
332 Ga0495585_0000904 3300046492 Bacteria 25136
333 Ga0495596_0014549 3300046500 Bacteria 3315
334 Ga0495606_0000145 3300046507 Bacteria 122857
335 Ga0495606_0014766 3300046507 Bacteria 6068
336 Ga0495606_0016434 3300046507 Bacteria 5641
337 Ga0495606_0021807 3300046507 Bacteria 4685
338 Ga0495610_0000028 3300046512 Bacteria 272572
339 Ga0495610_0002358 3300046512 Bacteria 15963
340 Ga0495610_0002790 3300046512 Bacteria 14304
341 Ga0495610_0019770 3300046512 Bacteria 3756
342 Ga0495616_0007696 3300046513 Bacteria 6440
343 Ga0495616_0029348 3300046513 Bacteria 2905
344 Ga0495631_0037090 3300046518 Bacteria 2173
345 Ga0495648_0007367 3300046524 Bacteria 8814
346 Ga0495648_0062000 3300046524 Bacteria 2217
347 Ga0495652_0031760 3300046529 Bacteria 4622
348 Ga0495640_0181199 3300046533 Bacteria 1342
349 Ga0495609_0013121 3300046538 Bacteria 3918
350 Ga0495609_0027579 3300046538 Bacteria 2595
351 Ga0495622_0030966 3300046557 Bacteria 2501
352 Ga0495633_0000069 3300046558 Bacteria 135128
353 Ga0495668_0000021 3300046616 Bacteria 381308
354 Ga0495634_0097754 3300046642 Bacteria 1900
355 Ga0495625_0000005 3300046660 Bacteria 596135
356 Ga0495625_0003181 3300046660 Bacteria 16707
357 Ga0495625_0022439 3300046660 Bacteria 4840
358 Ga0495625_0108732 3300046660 Bacteria 1897
359 Ga0495625_0206312 3300046660 Bacteria 1294
360 Ga0495661_0000244 3300046665 Bacteria 62633
361 Ga0495661_0007661 3300046665 Bacteria 7523
362 Ga0495661_0040960 3300046665 Bacteria 2869
363 Ga0495658_0054638 3300046683 Bacteria 2272
364 Ga0495649_0000003 3300046694 Bacteria 880817
365 Ga0495683_0027778 3300047323 Bacteria 2893
366 Ga0495683_0074097 3300047323 Bacteria 1669
367 Ga0495687_001307 3300047443 Bacteria 23369
368 Ga0495687_004955 3300047443 Bacteria 8711
369 Ga0495686_0000106 3300047472 Bacteria 175852
370 Ga0495686_0003562 3300047472 Bacteria 13388
371 Ga0495686_0015132 3300047472 Bacteria 5284
372 Ga0495686_0113526 3300047472 Bacteria 1622
373 Ga0495614_0076436 3300048089 Bacteria 1447
374 Ga0496115_0008303 3300048918 Bacteria 7676
375 Ga0496122_0001345 3300048925 Bacteria 40096
376 Ga0495678_032950 3300049459 Bacteria 2143
377 Ga0495682_0021994 3300049460 Bacteria 2388
378 Ga0501210_000622 3300049657 Bacteria 1752
379 Ga0501217_002957 3300049661 Unclassified 3401
380 Ga0501236_000595 3300049670 Bacteria 4049
381 Ga0501257_000192 3300049686 Bacteria 12281
382 Ga0501264_000239 3300049761 Bacteria 8852
383 nmdc:mga0k408_4467_c1 3300050493 Bacteria 7421
384 nmdc:mga0k408_53_c1 3300050493 Bacteria 57877
385 nmdc:mga08y16_24282_c1 3300050511 Bacteria 6399
386 Ga0500635_0000554 3300053080 Bacteria 9943
387 Ga0500635_0019847 3300053080 Bacteria 2050
388 Ga0500651_0001374 3300053093 Bacteria 12191
389 Ga0500608_012839 3300053122 Bacteria 3689
390 Ga0500608_037643 3300053122 Bacteria 2311
391 Ga0500614_011099 3300053123 Bacteria 1944
392 Ga0500618_000001 3300053125 Bacteria 538477
393 Ga0500616_0024584 3300053153 Bacteria 3345
394 Ga0500622_0000898 3300053156 Bacteria 25324
395 Ga0500624_000449 3300053157 Bacteria 12370
396 2522549063 2522125168 Bacteria 7376607
397 2586206591 2585427687 Bacteria 5544917
398 2599477745 2599185184 Bacteria 6430550
399 2738754819 2738541283 Bacteria 7222293
400 2738761265 2738541284 Bacteria 5199923
401 2738853886 2738541302 Bacteria 5944758
402 2739305149 2738543023 Bacteria 6767879
403 2739588498 2739367651 Bacteria 6359826
404 2739616131 2739367656 Bacteria 5152243
405 2739645152 2739367663 Bacteria 5040914
406 2776613391 2775506987 Bacteria 5373360
407 2819549852 2818991437 Bacteria 5805520
408 2833643472 2833640130 Bacteria 4858325
409 2842723640 2842722452 Bacteria 6263924
410 2842906750 2842903701 Bacteria 6986368
411 2842910146 2842909656 Bacteria 6185908
412 2849284388 2849281842 Bacteria 6065644
413 2852623547 2852623160 Bacteria 4376875
414 2852631699 2852627209 Bacteria 5896285
415 2857631038 2857627736 Bacteria 5625397
416 2884937551 2884933994 Bacteria 4535041
417 2896317904 2896317667 Bacteria 4606601
418 2902049269 2902048731 Bacteria 4976191
419 2904445786 2904445276 Bacteria 5310396
420 2919187046 2919186247 Bacteria 6244071
421 2919439197 2919437846 Bacteria 6199444
422 2928079661 2928078545 Bacteria 6534839
423 2928147862 2928147474 Bacteria 6512076
424 2932086713 2932082852 Bacteria 6563563
425 2939665685 2939664404 Bacteria 6364494
426 2946000519 2945997725 Bacteria 6404843
427 2954017377 2954016120 Bacteria 6446024
428 2977232699 2977232053 Bacteria 5485925
429 3003234447 3003233435 Bacteria 4458031
430 8055589083 8055588893 Bacteria 3619545
431 Ga0451577_0006468
432 SwRhRL2b_contig_180147
433 JGI24736J21556_1001074
434 JGI24740J21852_10022546
435 JGI24740J21852_10038188
436 JGI24737J22298_10005129
437 JGI24737J22298_10005632
438 JGI24735J21928_10000014
439 JGI25162J39368_1000012
440 JGI25162J39368_1001031
441 JGI25152J39213_1000075
442 JGI25150J39212_1000009
443 JGI25151J46595_10000017
444 JGI25165J46597_1000869
445 JGI25153J46596_10000023
446 rootH1_10005812
447 rootH1_10012723
448 rootH1_10021548
449 rootH1_10024554
450 rootH1_10029000
451 rootH1_10039577
452 rootH2_10004581
453 rootH2_10086594
454 rootH2_10142102
455 rootL2_10122897
456 rootL2_10128720
457 rootL2_10129198
458 rootH1_10003212
459 rootH1_10019268
460 rootH1_10026953
461 rootH1_10065451
462 rootH1_10087662
463 rootH1_10091374
464 rootH1_10097271
465 rootH1_10130377
466 Ga0055536_1000003
467 Ga0055536_1005561
468 Ga0055530_10010445
469 Ga0065165_1000538
470 Ga0065714_10004554
471 Ga0065714_10005951
472 Ga0065714_10006907
473 Ga0065714_10064729
474 Ga0065714_10064977
475 Ga0065714_10078103
476 Ga0065704_10000288
477 Ga0065704_10110172
478 Ga0070658_10000019
479 Ga0070658_10028062
480 Ga0070658_10032554
481 Ga0070658_10297778
482 Ga0070676_10001099
483 Ga0070683_100050623
484 Ga0070670_100054029
485 Ga0070680_100056132
486 Ga0068868_100018386
487 Ga0070660_100006548
488 Ga0070689_100103254
489 Ga0070674_100024533
490 Ga0070673_100001076
491 Ga0070688_100145705
492 Ga0070667_100077200
493 Ga0070663_100041849
494 Ga0070662_100000729
495 Ga0070662_100054195
496 Ga0070681_10451528
497 Ga0068867_100000116
498 Ga0070679_100001606
499 Ga0070684_100048214
500 Ga0068853_100037702
501 Ga0068853_100174786
502 Ga0070665_100000003
503 Ga0068855_100001020
504 Ga0068855_100014762
505 Ga0068855_100023678
506 Ga0068855_100237517
507 Ga0068857_100193617
508 Ga0068854_100016513
509 Ga0068856_100000262
510 Ga0068856_100001674
511 Ga0068856_100034800
512 Ga0068856_100075694
513 Ga0068852_100000326
514 Ga0068852_100051110
515 Ga0068866_10079698
516 Ga0068860_100064937
517 Ga0075366_10000263
518 Ga0075366_10004625
519 Ga0068871_100000216
520 Ga0068865_100000051
521 Ga0105240_10000728
522 Ga0105240_10013890
523 Ga0105240_10021480
524 Ga0105240_10026405
525 Ga0105240_10132006
526 Ga0105240_10135429
527 Ga0105240_10185422
528 Ga0111539_10009479
529 Ga0105243_10059676
530 Ga0105241_10001103
531 Ga0105241_10005856
532 Ga0105242_10019154
533 Ga0105242_10104342
534 Ga0105237_10000574
535 Ga0105237_10000622
536 Ga0105237_10001914
537 Ga0105237_10003791
538 Ga0105237_10036675
539 Ga0105237_10069165
540 Ga0105237_10078892
541 Ga0105237_10154264
542 Ga0105237_10322761
543 Ga0105238_10145573
544 Ga0105238_10161073
545 Ga0105239_10000013
546 Ga0105239_10000117
547 Ga0105239_10000139
548 Ga0105239_10012009
549 Ga0105239_10019913
550 Ga0105239_10021149
551 Ga0105239_10063517
552 Ga0105246_10104713
553 Ga0157373_10000041
554 Ga0157373_10000208
555 Ga0157373_10003960
556 Ga0157373_10019523
557 Ga0157371_10000009
558 Ga0157371_10002094
559 Ga0157371_10002124
560 Ga0157371_10012367
561 Ga0157371_10021144
562 Ga0157371_10193530
563 Ga0157371_10217757
564 Ga0157370_10003446
565 Ga0157370_10005009
566 Ga0157370_10007867
567 Ga0157370_10021200
568 Ga0157370_10023237
569 Ga0157370_10036084
570 Ga0157370_10050236
571 Ga0157370_10052601
572 Ga0157370_10184168
573 Ga0157370_10188351
574 Ga0157370_10321099
575 Ga0157369_10000006
576 Ga0157369_10001212
577 Ga0157369_10065263
578 Ga0157374_10001372
579 Ga0157374_10001374
580 Ga0157374_10008308
581 Ga0157378_10479973
582 Ga0163162_10000058
583 Ga0163162_10003377
584 Ga0163162_10012985
585 Ga0157372_10000021
586 Ga0157372_10000181
587 Ga0157372_10001057
588 Ga0157372_10001960
589 Ga0157372_10170533
590 Ga0157372_10209862
591 Ga0157375_10013782
592 Ga0157375_10028794
593 Ga0157375_10054601
594 Ga0157375_10179196
595 Ga0157375_10635312
596 Ga0163163_10081089
597 Ga0163163_10281712
598 Ga0157380_10000002
599 Ga0182008_10000001
600 Ga0182008_10000658
601 Ga0157376_10102459
602 Ga0182006_1000244
603 Ga0182006_1004312
604 Ga0182007_10000001
605 Ga0183373_1010
606 Ga0163161_10000468
607 Ga0163161_10000919
608 Ga0163161_10011700
609 Ga0163161_10025802
610 Ga0163161_10044622
611 Ga0163161_10146543
612 Ga0207427_100085
613 Ga0209437_100041
614 Ga0209437_100052
615 Ga0207425_1000007
616 Ga0209026_1001421
617 Ga0209026_1001617
618 Ga0209026_1010898
619 Ga0209129_1000006
620 Ga0209233_1000067
621 Ga0209676_1000001
622 Ga0209676_1001025
623 Ga0209025_1000025
624 Ga0209758_1000016
625 Ga0209050_1000016
626 Ga0207647_10000063
627 Ga0207647_10003913
628 Ga0207647_10135036
629 Ga0207645_10000127
630 Ga0207705_10000069
631 Ga0207705_10038630
632 Ga0207705_10070996
633 Ga0207654_10002013
634 Ga0207654_10009834
635 Ga0207707_10312509
636 Ga0207695_10000189
637 Ga0207695_10008676
638 Ga0207695_10012473
639 Ga0207695_10029017
640 Ga0207695_10109032
641 Ga0207695_10135075
642 Ga0207671_10002529
643 Ga0207671_10005361
644 Ga0207671_10005609
645 Ga0207671_10025739
646 Ga0207671_10040945
647 Ga0207671_10055331
648 Ga0207671_10185586
649 Ga0207671_10230300
650 Ga0207657_10022645
651 Ga0207652_10007343
652 Ga0207694_10149625
653 Ga0207650_10103175
654 Ga0207690_10008515
655 Ga0207706_10001974
656 Ga0207706_10093490
657 Ga0207669_10028803
658 Ga0207704_10000046
659 Ga0207704_10098714
660 Ga0207661_10035105
661 Ga0207667_10000009
662 Ga0207667_10000896
663 Ga0207667_10044510
664 Ga0207667_10308703
665 Ga0207651_10005508
666 Ga0207640_10013718
667 Ga0207677_10010556
668 Ga0207639_10022378
669 Ga0207639_10178735
670 Ga0207639_10446265
671 Ga0207678_10042011
672 Ga0207702_10000492
673 Ga0207702_10003618
674 Ga0207702_10033748
675 Ga0207702_10103011
676 Ga0207648_10000257
677 Ga0207674_10215228
678 Ga0207698_10090892
679 Ga0268266_10000078
680 Ga0268264_10055786
681 Ga0307517_10001926
682 Ga0307515_10000076
683 Ga0307515_10013120
684 Ga0307515_10029999
685 Ga0265338_10001618
686 Ga0316176_1138478
687 Ga0316183_1026870
688 Ga0316181_1200512
689 Ga0316182_1038659
690 Ga0265327_10005429
691 Ga0265327_10031363
692 Ga0307509_10245846
693 Ga0307408_100001460
694 Ga0307408_100005243
695 Ga0316575_10092184
696 Ga0265342_10088813
697 Ga0316576_10098213
698 Ga0316576_10173051
699 Ga0316578_10003510
700 Ga0316578_10019920
701 Ga0307405_10000010
702 Ga0316577_10058090
703 Ga0316577_10128404
704 Ga0307407_10000009
705 Ga0307412_10000033
706 Ga0307412_10000906
707 Ga0307416_100000019
708 Ga0307414_10000017
709 Ga0307414_10002459
710 Ga0307414_10003061
711 Ga0307414_10004573
712 Ga0316585_10011711
713 Ga0307507_10000015
714 Ga0316582_0215437
715 Ga0316584_0002153
716 Ga0395899_0000001
717 Ga0395899_0000733
718 Ga0395899_0002325
719 Ga0395900_0000501
720 Ga0395900_0005430
721 Ga0395900_0006437
722 Ga0395900_0052252
723 Ga0395898_0013107
724 Ga0395898_0123682
725 Ga0395905_0001099
726 Ga0395905_0007115
727 Ga0395905_0008184
728 Ga0395901_0017156
729 Ga0395901_0048154
730 Ga0395901_0215283
731 Ga0400483_045849
732 Ga0400483_247412
733 Ga0400489_01897
734 Ga0439448_0006462
735 Ga0451577_0053174
736 Ga0451577_0268285
737 Ga0453683_0000140
738 Ga0453683_0076336
739 Ga0453683_0137456
740 Ga0466966_0171675
741 Ga0453684_0000948
742 Ga0453684_0003935
743 Ga0453684_0006558
744 Ga0453684_0010531
745 Ga0453684_0018092
746 Ga0453684_0029550
747 Ga0453684_0037597
748 Ga0453684_0039364
749 Ga0453684_0127473
750 Ga0453684_0310401
751 Ga0466959_0029637
752 Ga0451576_0000795
753 Ga0451576_0002738
754 Ga0451576_0009157
755 Ga0451576_0015780
756 Ga0451576_0064630
757 Ga0495592_0147355
758 Ga0495650_0000003
759 Ga0495650_0125650
760 Ga0495585_0000510
761 Ga0495585_0000904
762 Ga0495596_0014549
763 Ga0495606_0000145
764 Ga0495606_0014766
765 Ga0495606_0016434
766 Ga0495606_0021807
767 Ga0495610_0000028
768 Ga0495610_0002358
769 Ga0495610_0002790
770 Ga0495610_0019770
771 Ga0495616_0007696
772 Ga0495616_0029348
773 Ga0495631_0037090
774 Ga0495648_0007367
775 Ga0495648_0062000
776 Ga0495652_0031760
777 Ga0495640_0181199
778 Ga0495609_0013121
779 Ga0495609_0027579
780 Ga0495622_0030966
781 Ga0495633_0000069
782 Ga0495668_0000021
783 Ga0495634_0097754
784 Ga0495625_0000005
785 Ga0495625_0003181
786 Ga0495625_0022439
787 Ga0495625_0108732
788 Ga0495625_0206312
789 Ga0495661_0000244
790 Ga0495661_0007661
791 Ga0495661_0040960
792 Ga0495658_0054638
793 Ga0495649_0000003
794 Ga0495683_0027778
795 Ga0495683_0074097
796 Ga0495687_001307
797 Ga0495687_004955
798 Ga0495686_0000106
799 Ga0495686_0003562
800 Ga0495686_0015132
801 Ga0495686_0113526
802 Ga0495614_0076436
803 Ga0496115_0008303
804 Ga0496122_0001345
805 Ga0495678_032950
806 Ga0495682_0021994
807 Ga0501210_000622
808 Ga0501217_002957
809 Ga0501236_000595
810 Ga0501257_000192
811 Ga0501264_000239
812 nmdc:mga0k408_4467_c1
813 nmdc:mga0k408_53_c1
814 nmdc:mga08y16_24282_c1
815 Ga0500635_0000554
816 Ga0500635_0019847
817 Ga0500651_0001374
818 Ga0500608_012839
819 Ga0500608_037643
820 Ga0500614_011099
821 Ga0500618_000001
822 Ga0500616_0024584
823 Ga0500622_0000898
824 Ga0500624_000449
825 2522549063
826 2586206591
827 2599477745
828 2738754819
829 2738761265
830 2738853886
831 2739305149
832 2739588498
833 2739616131
834 2739645152
835 2776613391
836 2819549852
837 2833643472
838 2842723640
839 2842906750
840 2842910146
841 2849284388
842 2852623547
843 2852631699
844 2857631038
845 2884937551
846 2896317904
847 2902049269
848 2904445786
849 2919187046
850 2919439197
851 2928079661
852 2928147862
853 2932086713
854 2939665685
855 2946000519
856 2954017377
857 2977232699
858 3003234447
859 8055589083

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

35

215

0.83

PF10111

Glyco_tranf_2_2

Glycosyltransferase like family 2

37

292

0.82

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

32

266

0.81

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

113

319

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4d11-assembly4.cif.gz_F galnac-t2 crystal soaked with udp-5sgalnac, mea2 peptide and manganese (lower resolution dataset) 0.8092 2 224
4d11-assembly1.cif.gz_A galnac-t2 crystal soaked with udp-5sgalnac, mea2 peptide and manganese (lower resolution dataset) 0.7908 2 254
6nqt-assembly1.cif.gz_C galnac-t2 soaked with udp-sugar 0.7901 2 254
7qoq-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 in complex with ump and magnesium 0.7878 3 119
6h0b-assembly2.cif.gz_B crystal structure of the human galnac-t4 in complex with udp, manganese and the diglycopeptide 6. 0.7871 2 256
ID Description Score Start End Superfamily
af_P71795_2_224_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8381 3 123 3.90.550.10
4d11F00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8092 2 224 3.90.550.10
af_G3X942_85_462_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8014 2 261 3.90.550.10
af_A0A096MIV6_83_419_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7994 2 261 3.90.550.10
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7904 3 144 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2E4L2L8-F1-model_v4 Glycosyl hydrolase 0.9743 1 109 GO:0016787
AF-A0A662EF15-F1-model_v4 Glycosyltransferase family 2 protein 0.965 2 336 GO:0016020
GO:0016740
AF-A0A532UTV9-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9635 6 338
AF-A0A3C0HEV2-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9609 3 337
AF-A0A7V2RMA3-F1-model_v4 Bifunctional riboflavin kinase/FMN adenylyltransferase (EC 2.7.1.26) (EC 2.7.7.2) 0.9581 2 336 GO:0003919
GO:0005524
GO:0006747
GO:0008531
GO:0009231
GO:0009398
GO:0016020

Map