F441967

General Info

Members Datasets Scaffolds Average Seq Length
429 188 858 324

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0044620|Ga0439460_0044620_144_1253
Length 369
Sequence LTSADWDNTIGANTSFVGPLIKIKSRSAGNEKRKGKSMTIKRNMALAVCLSAISIFGSNPLPAQMTRISVGYSAISGDAMPAWVAKDAGIFEKNGLDVQLVFFTGGTTAVMALVSADTPIAQLAGPAVVNSVIAGSDATLIVGGVTSLNYYLLSRSEIKTPEQLKNGTVAISRFGSASDFIARFALSKIGLTPGKDVTLVQIGSTTARVDATLTGRVQATVVNPPASIIAQKRGMNVLADLPKLGLVYQHTAAATTKKYIREHPDIVRRYVKSQLEAVHRIYTDKNAAVRALARFIGQSVDRDVLEKTWENMLSESVLPKKQYPSVEGLKTILASEPKGKSFKPEDFFDATFVKEFDQSGFSDGLYKKR

Samples

Sample ID Description Type Environment
1 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.1
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 18.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439460_0044620 3300042461 Bacteria 1313
2 2214803557 2209111006 Bacteria 2050
3 JGI25405J52794_10000084 3300003911 Bacteria 10458
4 Ga0065704_10129170 3300005289 Bacteria 1652
5 Ga0065712_10068929 3300005290 Bacteria 8550
6 Ga0065712_10073727 3300005290 Bacteria 4295
7 Ga0065712_10076020 3300005290 Plasmid 3747
8 Ga0065715_10001119 3300005293 Bacteria 8384
9 Ga0065715_10005373 3300005293 Bacteria 5632
10 Ga0065715_10092818 3300005293 Bacteria 4922
11 Ga0065715_10123886 3300005293 Bacteria 2151
12 Ga0065707_10007842 3300005295 Bacteria 5025
13 Ga0065707_10139326 3300005295 Bacteria 1794
14 Ga0070658_10017047 3300005327 Bacteria 5813
15 Ga0070676_10023058 3300005328 Bacteria 3496
16 Ga0070676_10067438 3300005328 Bacteria 2139
17 Ga0070690_100202539 3300005330 Unclassified 1382
18 Ga0070690_100291320 3300005330 Bacteria 1167
19 Ga0070670_100000332 3300005331 Bacteria 39628
20 Ga0070677_10023953 3300005333 Bacteria 2265
21 Ga0068869_100072659 3300005334 Bacteria 2549
22 Ga0068869_100106283 3300005334 Bacteria 2130
23 Ga0070666_10005523 3300005335 Bacteria 7756
24 Ga0070666_10060201 3300005335 Unclassified 2569
25 Ga0070680_100003601 3300005336 Bacteria 11566
26 Ga0070680_100007387 3300005336 Bacteria 8386
27 Ga0070680_100047258 3300005336 Bacteria 3504
28 Ga0068868_100077701 3300005338 Unclassified 2656
29 Ga0070660_100020704 3300005339 Unclassified 4839
30 Ga0070689_100145331 3300005340 Unclassified 1910
31 Ga0070689_100255618 3300005340 Bacteria 1447
32 Ga0070691_10070294 3300005341 Bacteria 1698
33 Ga0070691_10169692 3300005341 Bacteria 1130
34 Ga0070687_100075207 3300005343 Viruses 1826
35 Ga0070661_100004696 3300005344 Bacteria 9406
36 Ga0070661_100008074 3300005344 Bacteria 7263
37 Ga0070668_100115178 3300005347 Bacteria 2143
38 Ga0070668_100130592 3300005347 Bacteria 2016
39 Ga0070668_100138050 3300005347 Bacteria 1962
40 Ga0070669_100024107 3300005353 Unclassified 4361
41 Ga0070675_100120537 3300005354 Bacteria 2228
42 Ga0070671_100044457 3300005355 Unclassified 3691
43 Ga0070671_100073878 3300005355 Unclassified 2848
44 Ga0070674_100062721 3300005356 Bacteria 2598
45 Ga0070673_100034063 3300005364 Bacteria 3850
46 Ga0070659_100007640 3300005366 Bacteria 7860
47 Ga0070659_100029777 3300005366 Bacteria 4220
48 Ga0070659_100052409 3300005366 Bacteria 3209
49 Ga0070667_100040872 3300005367 Bacteria 3889
50 Ga0070667_100185969 3300005367 Bacteria 1839
51 Ga0070705_100072183 3300005440 Bacteria 2090
52 Ga0070708_100051732 3300005445 Bacteria 3640
53 Ga0070708_100099254 3300005445 Bacteria 2663
54 Ga0070678_100017645 3300005456 Bacteria 4603
55 Ga0070681_10001395 3300005458 Bacteria 21188
56 Ga0070681_10028455 3300005458 Bacteria 5619
57 Ga0070681_10039502 3300005458 Bacteria 4730
58 Ga0070681_10081854 3300005458 Bacteria 3184
59 Ga0068867_100062176 3300005459 Bacteria 2774
60 Ga0070706_100200999 3300005467 Bacteria 1862
61 Ga0070706_100383414 3300005467 Unclassified 1309
62 Ga0070707_100246492 3300005468 Bacteria 1739
63 Ga0070698_100191079 3300005471 Unclassified 1985
64 Ga0070679_100019036 3300005530 Bacteria 6669
65 Ga0070679_100020673 3300005530 Bacteria 6421
66 Ga0070679_100034319 3300005530 Bacteria 5027
67 Ga0070697_100104479 3300005536 Bacteria 2355
68 Ga0070697_100138790 3300005536 Bacteria 2043
69 Ga0070697_100203778 3300005536 Bacteria 1682
70 Ga0070697_100216520 3300005536 Bacteria 1631
71 Ga0070697_100485813 3300005536 Unclassified 1079
72 Ga0070672_100005040 3300005543 Bacteria 8707
73 Ga0070672_100041922 3300005543 Bacteria 3522
74 Ga0070686_100012690 3300005544 Bacteria 4806
75 Ga0070686_100039362 3300005544 Unclassified 2945
76 Ga0070695_100042849 3300005545 Unclassified 2875
77 Ga0070695_100129069 3300005545 Bacteria 1740
78 Ga0070696_100014825 3300005546 Bacteria 5231
79 Ga0070693_100032439 3300005547 Unclassified 2873
80 Ga0070704_100092519 3300005549 Bacteria 2258
81 Ga0070704_100242614 3300005549 Unclassified 1475
82 Ga0068855_100031805 3300005563 Bacteria 6299
83 Ga0070664_100001425 3300005564 Bacteria 19077
84 Ga0070664_100002022 3300005564 Bacteria 16258
85 Ga0070664_100063539 3300005564 Unclassified 3148
86 Ga0070664_100107966 3300005564 Bacteria 2426
87 Ga0068854_100037698 3300005578 Unclassified 3394
88 Ga0068856_100088351 3300005614 Unclassified 3082
89 Ga0068859_100667828 3300005617 Unclassified 1131
90 Ga0068863_100508817 3300005841 Unclassified 1186
91 Ga0068860_100111139 3300005843 Bacteria 2620
92 Ga0081455_10000242 3300005937 Bacteria 70917
93 Ga0081455_10007238 3300005937 Bacteria 11720
94 Ga0081455_10009077 3300005937 Bacteria 10257
95 Ga0081455_10094465 3300005937 Bacteria 2415
96 Ga0081455_10188296 3300005937 Bacteria 1557
97 Ga0081538_10005144 3300005981 Bacteria 11856
98 Ga0081540_1110612 3300005983 Archaea 1162
99 Ga0070716_100092701 3300006173 Bacteria 1832
100 Ga0097621_100185003 3300006237 Bacteria 1802
101 Ga0068871_100169424 3300006358 Bacteria 1871
102 Ga0068871_100287106 3300006358 Bacteria 1441
103 Ga0068871_100379622 3300006358 Bacteria 1255
104 Ga0075428_100104117 3300006844 Bacteria 3094
105 Ga0075430_100123250 3300006846 Bacteria 2161
106 Ga0075430_100205296 3300006846 Unclassified 1635
107 Ga0075431_100015189 3300006847 Bacteria 7802
108 Ga0075431_100098227 3300006847 Bacteria 3023
109 Ga0075431_100369551 3300006847 Unclassified 1439
110 Ga0075431_100496196 3300006847 Bacteria 1212
111 Ga0075433_10003564 3300006852 Bacteria 12012
112 Ga0075433_10007485 3300006852 Bacteria 8670
113 Ga0075433_10013842 3300006852 Bacteria 6576
114 Ga0075433_10029192 3300006852 Bacteria 4696
115 Ga0075433_10059903 3300006852 Bacteria 3332
116 Ga0075433_10072720 3300006852 Bacteria 3024
117 Ga0075433_10106097 3300006852 Bacteria 2490
118 Ga0075433_10135394 3300006852 Bacteria 2190
119 Ga0075433_10289095 3300006852 Bacteria 1452
120 Ga0075434_100001613 3300006871 Bacteria 19155
121 Ga0075434_100002296 3300006871 Bacteria 16724
122 Ga0075434_100011300 3300006871 Bacteria 8412
123 Ga0075434_100021862 3300006871 Bacteria 6225
124 Ga0075434_100025802 3300006871 Bacteria 5753
125 Ga0075434_100035038 3300006871 Unclassified 4961
126 Ga0075434_100076854 3300006871 Bacteria 3334
127 Ga0075434_100104557 3300006871 Bacteria 2841
128 Ga0075434_100109651 3300006871 Bacteria 2771
129 Ga0075434_100276346 3300006871 Unclassified 1699
130 Ga0075434_100432870 3300006871 Bacteria 1337
131 Ga0075434_100459426 3300006871 Bacteria 1294
132 Ga0075429_100029809 3300006880 Bacteria 4739
133 Ga0075429_100137172 3300006880 Bacteria 2141
134 Ga0068865_100238479 3300006881 Unclassified 1430
135 Ga0075436_100023847 3300006914 Bacteria 4204
136 Ga0075436_100062540 3300006914 Bacteria 2573
137 Ga0097620_100667817 3300006931 Unclassified 1131
138 Ga0075435_100010254 3300007076 Bacteria 6847
139 Ga0075435_100019961 3300007076 Bacteria 5123
140 Ga0075435_100021267 3300007076 Unclassified 4987
141 Ga0075435_100024310 3300007076 Unclassified 4700
142 Ga0075435_100031056 3300007076 Bacteria 4206
143 Ga0075435_100039600 3300007076 Bacteria 3761
144 Ga0075435_100077640 3300007076 Bacteria 2723
145 Ga0075435_100148370 3300007076 Bacteria 1971
146 Ga0075435_100261272 3300007076 Bacteria 1475
147 Ga0105240_10097271 3300009093 Bacteria 3587
148 Ga0111539_10073593 3300009094 Bacteria 4028
149 Ga0111539_10173021 3300009094 Bacteria 2522
150 Ga0111539_10238036 3300009094 Bacteria 2119
151 Ga0111539_10241191 3300009094 Bacteria 2104
152 Ga0111539_10391707 3300009094 Bacteria 1618
153 Ga0111539_10453251 3300009094 Bacteria 1494
154 Ga0111539_10507562 3300009094 Unclassified 1404
155 Ga0105245_10227887 3300009098 Bacteria 1801
156 Ga0114129_10012042 3300009147 Bacteria 12303
157 Ga0114129_10024617 3300009147 Bacteria 8531
158 Ga0114129_10027253 3300009147 Bacteria 8089
159 Ga0114129_10034793 3300009147 Bacteria 7117
160 Ga0114129_10035005 3300009147 Bacteria 7094
161 Ga0114129_10049596 3300009147 Bacteria 5898
162 Ga0114129_10051507 3300009147 Bacteria 5779
163 Ga0114129_10093929 3300009147 Bacteria 4154
164 Ga0114129_10123619 3300009147 Bacteria 3559
165 Ga0114129_10347637 3300009147 Bacteria 1965
166 Ga0114129_10591043 3300009147 Bacteria 1439
167 Ga0105243_10178152 3300009148 Bacteria 1847
168 Ga0105241_10023417 3300009174 Bacteria 4579
169 Ga0105241_10030644 3300009174 Bacteria 4022
170 Ga0105242_10093452 3300009176 Bacteria 2535
171 Ga0105248_10373208 3300009177 Bacteria 1606
172 Ga0105238_10644819 3300009551 Unclassified 1069
173 Ga0105239_10080454 3300010375 Bacteria 3585
174 Ga0105239_10109712 3300010375 Bacteria 3058
175 Ga0105239_10111011 3300010375 Bacteria 3039
176 Ga0105246_10009451 3300011119 Bacteria 6008
177 Ga0157371_10036097 3300013102 Unclassified 3540
178 Ga0157374_10004908 3300013296 Bacteria 11224
179 Ga0157374_10110791 3300013296 Bacteria 2640
180 Ga0157374_10197249 3300013296 Bacteria 1970
181 Ga0157378_10070699 3300013297 Bacteria 3133
182 Ga0157378_10093580 3300013297 Bacteria 2736
183 Ga0157378_10110212 3300013297 Bacteria 2523
184 Ga0157378_10196880 3300013297 Unclassified 1904
185 Ga0157378_10226348 3300013297 Bacteria 1780
186 Ga0163162_10013055 3300013306 Bacteria 8107
187 Ga0163162_10033524 3300013306 Bacteria 5104
188 Ga0163162_10128007 3300013306 Bacteria 2647
189 Ga0163162_10509622 3300013306 Bacteria 1333
190 Ga0157372_10030007 3300013307 Bacteria 5944
191 Ga0157372_10071445 3300013307 Bacteria 3908
192 Ga0157375_10055665 3300013308 Unclassified 3901
193 Ga0157375_10241992 3300013308 Bacteria 1964
194 Ga0163163_10131328 3300014325 Bacteria 2545
195 Ga0163163_10210159 3300014325 Bacteria 1995
196 Ga0157380_10297012 3300014326 Bacteria 1486
197 Ga0157376_10255884 3300014969 Unclassified 1638
198 Ga0207697_10030626 3300025315 Bacteria 2202
199 Ga0207697_10044761 3300025315 Bacteria 1821
200 Ga0207688_10012490 3300025901 Bacteria 4622
201 Ga0207688_10111981 3300025901 Unclassified 1585
202 Ga0207680_10007469 3300025903 Bacteria 5332
203 Ga0207647_10040536 3300025904 Bacteria 2932
204 Ga0207645_10002773 3300025907 Bacteria 13637
205 Ga0207645_10005715 3300025907 Bacteria 8983
206 Ga0207645_10009333 3300025907 Bacteria 6791
207 Ga0207705_10133475 3300025909 Unclassified 1849
208 Ga0207654_10028287 3300025911 Bacteria 3055
209 Ga0207707_10004074 3300025912 Bacteria 12938
210 Ga0207707_10007732 3300025912 Bacteria 9358
211 Ga0207707_10025969 3300025912 Bacteria 5121
212 Ga0207707_10039724 3300025912 Bacteria 4113
213 Ga0207707_10040918 3300025912 Bacteria 4047
214 Ga0207663_10186195 3300025916 Bacteria 1487
215 Ga0207660_10004882 3300025917 Bacteria 8733
216 Ga0207657_10023607 3300025919 Bacteria 5722
217 Ga0207657_10067445 3300025919 Bacteria 3042
218 Ga0207649_10010575 3300025920 Bacteria 5075
219 Ga0207649_10013232 3300025920 Bacteria 4604
220 Ga0207649_10196428 3300025920 Unclassified 1422
221 Ga0207652_10008826 3300025921 Bacteria 8118
222 Ga0207652_10031412 3300025921 Bacteria 4460
223 Ga0207652_10055865 3300025921 Unclassified 3397
224 Ga0207652_10170775 3300025921 Bacteria 1951
225 Ga0207650_10000375 3300025925 Bacteria 42170
226 Ga0207650_10000434 3300025925 Bacteria 36353
227 Ga0207644_10053262 3300025931 Unclassified 2911
228 Ga0207706_10003599 3300025933 Bacteria 14793
229 Ga0207706_10004985 3300025933 Bacteria 12401
230 Ga0207706_10010070 3300025933 Bacteria 8659
231 Ga0207706_10057528 3300025933 Bacteria 3425
232 Ga0207686_10269760 3300025934 Bacteria 1251
233 Ga0207670_10172425 3300025936 Unclassified 1623
234 Ga0207704_10071619 3300025938 Bacteria 2200
235 Ga0207704_10177361 3300025938 Bacteria 1536
236 Ga0207691_10001834 3300025940 Bacteria 20772
237 Ga0207691_10002945 3300025940 Bacteria 16620
238 Ga0207691_10003149 3300025940 Bacteria 16131
239 Ga0207689_10035382 3300025942 Unclassified 4149
240 Ga0207679_10000842 3300025945 Bacteria 19756
241 Ga0207679_10006917 3300025945 Bacteria 7186
242 Ga0207679_10269492 3300025945 Unclassified 1455
243 Ga0207651_10020212 3300025960 Bacteria 4013
244 Ga0207651_10113296 3300025960 Unclassified 2040
245 Ga0207668_10021588 3300025972 Unclassified 4108
246 Ga0207668_10129480 3300025972 Bacteria 1925
247 Ga0207658_10121498 3300025986 Bacteria 2083
248 Ga0207677_10087580 3300026023 Bacteria 2255
249 Ga0207678_10005682 3300026067 Bacteria 11148
250 Ga0207678_10073676 3300026067 Bacteria 2926
251 Ga0207708_10094036 3300026075 Bacteria 2313
252 Ga0207641_10495456 3300026088 Unclassified 1186
253 Ga0207648_10212784 3300026089 Bacteria 1716
254 Ga0207683_10002773 3300026121 Bacteria 15316
255 Ga0207683_10005710 3300026121 Bacteria 10675
256 Ga0209970_1015105 3300027614 Bacteria 1284
257 Ga0210002_1008824 3300027617 Bacteria 1538
258 Ga0209983_1007343 3300027665 Bacteria 2258
259 Ga0209971_1003626 3300027682 Bacteria 3655
260 Ga0209971_1018814 3300027682 Unclassified 1640
261 Ga0209998_10011340 3300027717 Bacteria 1846
262 Ga0209974_10006319 3300027876 Bacteria 4141
263 Ga0307405_10012865 3300031731 Bacteria 4447
264 Ga0307405_10044803 3300031731 Bacteria 2707
265 Ga0307406_10109231 3300031901 Bacteria 1901
266 Ga0307409_100050216 3300031995 Bacteria 3184
267 Ga0307409_100085070 3300031995 Bacteria 2570
268 Ga0307416_100011629 3300032002 Bacteria 5884
269 Ga0307416_100061892 3300032002 Bacteria 3057
270 Ga0307414_10004403 3300032004 Bacteria 7648
271 Ga0307411_10165818 3300032005 Unclassified 1660
272 Ga0307415_100066846 3300032126 Unclassified 2510
273 Ga0373958_0028568 3300034819 Unclassified 1080
274 Ga0373926_0049031 3300035083 Unclassified 1520
275 Ga0373939_0080479 3300035114 Bacteria 1081
276 Ga0373945_0067807 3300035116 Unclassified 1344
277 Ga0373931_0019775 3300035691 Bacteria 3364
278 Ga0373931_0126485 3300035691 Bacteria 1466
279 Ga0373925_0111595 3300037068 Bacteria 2113
280 Ga0451577_0159851 3300042876 Bacteria 2028
281 Ga0453683_0020305 3300044673 Bacteria 4246
282 Ga0451576_0116957 3300045051 Unclassified 2775
283 Ga0451576_0321926 3300045051 Bacteria 1618
284 Ga0495580_0024941 3300046472 Bacteria 4371
285 Ga0495580_0151970 3300046472 Bacteria 1604
286 Ga0495580_0288440 3300046472 Unclassified 1119
287 Ga0495586_0074759 3300046535 Bacteria 1855
288 Ga0495656_0103989 3300046615 Unclassified 1318
289 Ga0495669_0131561 3300046684 Unclassified 1178
290 Ga0496102_0080959 3300048905 Unclassified 2993
291 Ga0496102_0417680 3300048905 Unclassified 1260
292 Ga0496106_0354215 3300048909 Unclassified 1179
293 Ga0496112_0014224 3300048915 Bacteria 7373
294 Ga0496112_0016392 3300048915 Bacteria 6941
295 Ga0496112_0107862 3300048915 Bacteria 2755
296 Ga0496113_0060062 3300048916 Bacteria 2865
297 Ga0496113_0178377 3300048916 Unclassified 1684
298 Ga0496113_0514992 3300048916 Unclassified 960
299 Ga0501032_0020212 3300049569 Bacteria 4642
300 Ga0501033_0043340 3300049570 Bacteria 3351
301 Ga0501033_0269228 3300049570 Bacteria 1204
302 Ga0501036_0010195 3300049572 Bacteria 7744
303 Ga0501036_0072275 3300049572 Bacteria 2916
304 Ga0501036_0228596 3300049572 Bacteria 1561
305 Ga0501037_0005241 3300049573 Bacteria 9426
306 Ga0501037_0184687 3300049573 Bacteria 1478
307 Ga0501038_0044774 3300049574 Bacteria 3843
308 Ga0501038_0104295 3300049574 Bacteria 2356
309 Ga0501039_0011246 3300049575 Bacteria 6821
310 Ga0501039_0023882 3300049575 Bacteria 4694
311 Ga0501039_0237386 3300049575 Unclassified 1433
312 Ga0501040_0024947 3300049576 Bacteria 4017
313 Ga0501040_0240807 3300049576 Bacteria 1289
314 Ga0501041_0004058 3300049577 Bacteria 8458
315 Ga0501042_0001324 3300049578 Bacteria 14447
316 Ga0501042_0035124 3300049578 Bacteria 3556
317 Ga0501042_0300600 3300049578 Bacteria 1159
318 Ga0501043_0033826 3300049579 Bacteria 4022
319 Ga0501043_0291829 3300049579 Bacteria 1248
320 Ga0501046_0006153 3300049580 Bacteria 10660
321 Ga0501046_0045544 3300049580 Bacteria 3485
322 Ga0501046_0256250 3300049580 Bacteria 1286
323 Ga0501048_0018248 3300049582 Bacteria 5161
324 Ga0501048_0052530 3300049582 Bacteria 2900
325 Ga0501048_0104833 3300049582 Bacteria 1995
326 Ga0501068_0016381 3300049584 Bacteria 4273
327 Ga0501070_0025595 3300049586 Bacteria 4949
328 Ga0501070_0193955 3300049586 Unclassified 1669
329 Ga0501071_0000141 3300049587 Bacteria 29626
330 Ga0501071_0083070 3300049587 Bacteria 2346
331 Ga0501071_0195115 3300049587 Bacteria 1519
332 Ga0501072_0002610 3300049588 Bacteria 13495
333 Ga0501072_0036238 3300049588 Bacteria 3867
334 Ga0501072_0322484 3300049588 Bacteria 1228
335 Ga0501072_0331237 3300049588 Unclassified 1209
336 Ga0501074_0071981 3300049590 Bacteria 2484
337 Ga0501074_0172309 3300049590 Unclassified 1544
338 Ga0501075_0002999 3300049591 Bacteria 11283
339 Ga0501075_0171958 3300049591 Bacteria 1653
340 Ga0501076_0000317 3300049592 Bacteria 29822
341 Ga0501076_0072101 3300049592 Bacteria 2764
342 Ga0501076_0103694 3300049592 Bacteria 2294
343 Ga0501076_0226072 3300049592 Unclassified 1529
344 Ga0501076_0282496 3300049592 Unclassified 1360
345 Ga0501076_0306763 3300049592 Bacteria 1302
346 Ga0501077_0000294 3300049593 Bacteria 29604
347 Ga0501077_0013906 3300049593 Bacteria 5045
348 Ga0501077_0030742 3300049593 Bacteria 3417
349 Ga0501077_0228576 3300049593 Bacteria 1182
350 Ga0501079_0036862 3300049741 Bacteria 3766
351 Ga0501079_0199926 3300049741 Bacteria 1561
352 Ga0501079_0208965 3300049741 Bacteria 1524
353 Ga0501079_0348868 3300049741 Unclassified 1159
354 Ga0501080_0039453 3300049742 Bacteria 4407
355 Ga0501080_0423596 3300049742 Bacteria 1195
356 Ga0501081_0000985 3300049743 Bacteria 16936
357 Ga0501081_0130039 3300049743 Bacteria 1798
358 Ga0501081_0163127 3300049743 Unclassified 1606
359 Ga0501081_0207397 3300049743 Bacteria 1422
360 Ga0501083_0025757 3300049744 Bacteria 4071
361 Ga0501083_0102605 3300049744 Bacteria 1885
362 Ga0501035_0057891 3300049822 Bacteria 3454
363 Ga0501035_0060303 3300049822 Bacteria 3377
364 Ga0501035_0161759 3300049822 Bacteria 1937
365 Ga0501045_0007409 3300049824 Bacteria 7626
366 Ga0501045_0132559 3300049824 Bacteria 1852
367 Ga0501045_0264457 3300049824 Bacteria 1280
368 nmdc:mga05p37_102535_c1 3300050507 Bacteria 3524
369 nmdc:mga05p37_14652_c1 3300050507 Bacteria 9420
370 nmdc:mga05p37_191898_c1 3300050507 Bacteria 2480
371 nmdc:mga05p37_196706_c1 3300050507 Bacteria 2444
372 nmdc:mga05p37_3409_c1 3300050507 Bacteria 18550
373 nmdc:mga05p37_471605_c1 3300050507 Unclassified 1448
374 nmdc:mga05p37_480841_c1 3300050507 Bacteria 1430
375 nmdc:mga05p37_50283_c1 3300050507 Bacteria 5126
376 nmdc:mga05p37_531736_c1 3300050507 Unclassified 1342
377 nmdc:mga05p37_60679_c1 3300050507 Bacteria 4656
378 nmdc:mga05p37_656227_c1 3300050507 Unclassified 1174
379 nmdc:mga09592_283054_c1 3300050508 Bacteria 1438
380 nmdc:mga09592_364502_c1 3300050508 Unclassified 1250
381 nmdc:mga0qj67_125312_c1 3300050509 Unclassified 2079
382 nmdc:mga0qj67_142568_c1 3300050509 Bacteria 1943
383 nmdc:mga0qj67_170352_c1 3300050509 Bacteria 1768
384 nmdc:mga0qj67_67369_c1 3300050509 Bacteria 2852
385 nmdc:mga06r32_26026_c1 3300050510 Bacteria 5451
386 nmdc:mga08y16_164267_c1 3300050511 Bacteria 2306
387 nmdc:mga08y16_274524_c1 3300050511 Bacteria 1740
388 nmdc:mga08y16_33844_c1 3300050511 Bacteria 5367
389 nmdc:mga08y16_453723_c1 3300050511 Bacteria 1307
390 nmdc:mga08y16_513711_c1 3300050511 Unclassified 1216
391 nmdc:mga08y16_536218_c1 3300050511 Unclassified 1186
392 nmdc:mga0n895_1681_c1 3300050512 Bacteria 16701
393 nmdc:mga0n895_169177_c1 3300050512 Unclassified 2217
394 nmdc:mga0n895_19637_c1 3300050512 Bacteria 6284
395 nmdc:mga0n895_234860_c1 3300050512 Bacteria 1861
396 nmdc:mga0n895_247234_c1 3300050512 Bacteria 1810
397 nmdc:mga0n895_3679_c1 3300050512 Bacteria 12389
398 nmdc:mga0n895_38705_c1 3300050512 Bacteria 4622
399 nmdc:mga0n895_4764_c1 3300050512 Bacteria 11215
400 nmdc:mga0rr50_14845_c1 3300050513 Bacteria 5126
401 nmdc:mga0rr50_18639_c1 3300050513 Unclassified 4666
402 nmdc:mga0rr50_200919_c1 3300050513 Bacteria 1638
403 nmdc:mga0rr50_235398_c1 3300050513 Bacteria 1516
404 nmdc:mga0rr50_291471_c1 3300050513 Bacteria 1364
405 nmdc:mga0rr50_3127_c1 3300050513 Bacteria 9458
406 nmdc:mga0rr50_33789_c1 3300050513 Bacteria 3657
407 nmdc:mga0rr50_34820_c1 3300050513 Bacteria 3609
408 nmdc:mga0rr50_5185_c1 3300050513 Bacteria 7744
409 nmdc:mga08x19_39670_c1 3300050514 Archaea 2994
410 nmdc:mga0a205_1230_c1 3300050515 Bacteria 21480
411 nmdc:mga0a205_152855_c1 3300050515 Archaea 1473
412 nmdc:mga0a205_16123_c1 3300050515 Bacteria 6996
413 nmdc:mga0a205_28682_c1 3300050515 Bacteria 5323
414 nmdc:mga0a205_46939_c1 3300050515 Bacteria 4166
415 nmdc:mga0a205_51180_c1 3300050515 Bacteria 3987
416 nmdc:mga0a205_6081_c1 3300050515 Bacteria 10886
417 nmdc:mga0a205_7515_c1 3300050515 Bacteria 9870
418 nmdc:mga0a205_76127_c1 3300050515 Bacteria 3242
419 Ga0501084_0000614 3300054114 Bacteria 27144
420 Ga0501084_0140605 3300054114 Unclassified 2033
421 Ga0501084_0254428 3300054114 Bacteria 1482
422 Ga0590071_015207 3300059421 Bacteria 1806
423 Ga0501082_0001178 3300060353 Bacteria 22976
424 Ga0501082_0120565 3300060353 Bacteria 2273
425 Ga0530510_0014551 3300061734 Bacteria 5551
426 Ga0530510_0105460 3300061734 Bacteria 2062
427 Ga0530510_0184474 3300061734 Bacteria 1548
428 Ga0530510_0230190 3300061734 Unclassified 1378
429 Ga0530510_0300450 3300061734 Unclassified 1201
430 Ga0439460_0044620
431 2214803557
432 JGI25405J52794_10000084
433 Ga0065704_10129170
434 Ga0065712_10068929
435 Ga0065712_10073727
436 Ga0065712_10076020
437 Ga0065715_10001119
438 Ga0065715_10005373
439 Ga0065715_10092818
440 Ga0065715_10123886
441 Ga0065707_10007842
442 Ga0065707_10139326
443 Ga0070658_10017047
444 Ga0070676_10023058
445 Ga0070676_10067438
446 Ga0070690_100202539
447 Ga0070690_100291320
448 Ga0070670_100000332
449 Ga0070677_10023953
450 Ga0068869_100072659
451 Ga0068869_100106283
452 Ga0070666_10005523
453 Ga0070666_10060201
454 Ga0070680_100003601
455 Ga0070680_100007387
456 Ga0070680_100047258
457 Ga0068868_100077701
458 Ga0070660_100020704
459 Ga0070689_100145331
460 Ga0070689_100255618
461 Ga0070691_10070294
462 Ga0070691_10169692
463 Ga0070687_100075207
464 Ga0070661_100004696
465 Ga0070661_100008074
466 Ga0070668_100115178
467 Ga0070668_100130592
468 Ga0070668_100138050
469 Ga0070669_100024107
470 Ga0070675_100120537
471 Ga0070671_100044457
472 Ga0070671_100073878
473 Ga0070674_100062721
474 Ga0070673_100034063
475 Ga0070659_100007640
476 Ga0070659_100029777
477 Ga0070659_100052409
478 Ga0070667_100040872
479 Ga0070667_100185969
480 Ga0070705_100072183
481 Ga0070708_100051732
482 Ga0070708_100099254
483 Ga0070678_100017645
484 Ga0070681_10001395
485 Ga0070681_10028455
486 Ga0070681_10039502
487 Ga0070681_10081854
488 Ga0068867_100062176
489 Ga0070706_100200999
490 Ga0070706_100383414
491 Ga0070707_100246492
492 Ga0070698_100191079
493 Ga0070679_100019036
494 Ga0070679_100020673
495 Ga0070679_100034319
496 Ga0070697_100104479
497 Ga0070697_100138790
498 Ga0070697_100203778
499 Ga0070697_100216520
500 Ga0070697_100485813
501 Ga0070672_100005040
502 Ga0070672_100041922
503 Ga0070686_100012690
504 Ga0070686_100039362
505 Ga0070695_100042849
506 Ga0070695_100129069
507 Ga0070696_100014825
508 Ga0070693_100032439
509 Ga0070704_100092519
510 Ga0070704_100242614
511 Ga0068855_100031805
512 Ga0070664_100001425
513 Ga0070664_100002022
514 Ga0070664_100063539
515 Ga0070664_100107966
516 Ga0068854_100037698
517 Ga0068856_100088351
518 Ga0068859_100667828
519 Ga0068863_100508817
520 Ga0068860_100111139
521 Ga0081455_10000242
522 Ga0081455_10007238
523 Ga0081455_10009077
524 Ga0081455_10094465
525 Ga0081455_10188296
526 Ga0081538_10005144
527 Ga0081540_1110612
528 Ga0070716_100092701
529 Ga0097621_100185003
530 Ga0068871_100169424
531 Ga0068871_100287106
532 Ga0068871_100379622
533 Ga0075428_100104117
534 Ga0075430_100123250
535 Ga0075430_100205296
536 Ga0075431_100015189
537 Ga0075431_100098227
538 Ga0075431_100369551
539 Ga0075431_100496196
540 Ga0075433_10003564
541 Ga0075433_10007485
542 Ga0075433_10013842
543 Ga0075433_10029192
544 Ga0075433_10059903
545 Ga0075433_10072720
546 Ga0075433_10106097
547 Ga0075433_10135394
548 Ga0075433_10289095
549 Ga0075434_100001613
550 Ga0075434_100002296
551 Ga0075434_100011300
552 Ga0075434_100021862
553 Ga0075434_100025802
554 Ga0075434_100035038
555 Ga0075434_100076854
556 Ga0075434_100104557
557 Ga0075434_100109651
558 Ga0075434_100276346
559 Ga0075434_100432870
560 Ga0075434_100459426
561 Ga0075429_100029809
562 Ga0075429_100137172
563 Ga0068865_100238479
564 Ga0075436_100023847
565 Ga0075436_100062540
566 Ga0097620_100667817
567 Ga0075435_100010254
568 Ga0075435_100019961
569 Ga0075435_100021267
570 Ga0075435_100024310
571 Ga0075435_100031056
572 Ga0075435_100039600
573 Ga0075435_100077640
574 Ga0075435_100148370
575 Ga0075435_100261272
576 Ga0105240_10097271
577 Ga0111539_10073593
578 Ga0111539_10173021
579 Ga0111539_10238036
580 Ga0111539_10241191
581 Ga0111539_10391707
582 Ga0111539_10453251
583 Ga0111539_10507562
584 Ga0105245_10227887
585 Ga0114129_10012042
586 Ga0114129_10024617
587 Ga0114129_10027253
588 Ga0114129_10034793
589 Ga0114129_10035005
590 Ga0114129_10049596
591 Ga0114129_10051507
592 Ga0114129_10093929
593 Ga0114129_10123619
594 Ga0114129_10347637
595 Ga0114129_10591043
596 Ga0105243_10178152
597 Ga0105241_10023417
598 Ga0105241_10030644
599 Ga0105242_10093452
600 Ga0105248_10373208
601 Ga0105238_10644819
602 Ga0105239_10080454
603 Ga0105239_10109712
604 Ga0105239_10111011
605 Ga0105246_10009451
606 Ga0157371_10036097
607 Ga0157374_10004908
608 Ga0157374_10110791
609 Ga0157374_10197249
610 Ga0157378_10070699
611 Ga0157378_10093580
612 Ga0157378_10110212
613 Ga0157378_10196880
614 Ga0157378_10226348
615 Ga0163162_10013055
616 Ga0163162_10033524
617 Ga0163162_10128007
618 Ga0163162_10509622
619 Ga0157372_10030007
620 Ga0157372_10071445
621 Ga0157375_10055665
622 Ga0157375_10241992
623 Ga0163163_10131328
624 Ga0163163_10210159
625 Ga0157380_10297012
626 Ga0157376_10255884
627 Ga0207697_10030626
628 Ga0207697_10044761
629 Ga0207688_10012490
630 Ga0207688_10111981
631 Ga0207680_10007469
632 Ga0207647_10040536
633 Ga0207645_10002773
634 Ga0207645_10005715
635 Ga0207645_10009333
636 Ga0207705_10133475
637 Ga0207654_10028287
638 Ga0207707_10004074
639 Ga0207707_10007732
640 Ga0207707_10025969
641 Ga0207707_10039724
642 Ga0207707_10040918
643 Ga0207663_10186195
644 Ga0207660_10004882
645 Ga0207657_10023607
646 Ga0207657_10067445
647 Ga0207649_10010575
648 Ga0207649_10013232
649 Ga0207649_10196428
650 Ga0207652_10008826
651 Ga0207652_10031412
652 Ga0207652_10055865
653 Ga0207652_10170775
654 Ga0207650_10000375
655 Ga0207650_10000434
656 Ga0207644_10053262
657 Ga0207706_10003599
658 Ga0207706_10004985
659 Ga0207706_10010070
660 Ga0207706_10057528
661 Ga0207686_10269760
662 Ga0207670_10172425
663 Ga0207704_10071619
664 Ga0207704_10177361
665 Ga0207691_10001834
666 Ga0207691_10002945
667 Ga0207691_10003149
668 Ga0207689_10035382
669 Ga0207679_10000842
670 Ga0207679_10006917
671 Ga0207679_10269492
672 Ga0207651_10020212
673 Ga0207651_10113296
674 Ga0207668_10021588
675 Ga0207668_10129480
676 Ga0207658_10121498
677 Ga0207677_10087580
678 Ga0207678_10005682
679 Ga0207678_10073676
680 Ga0207708_10094036
681 Ga0207641_10495456
682 Ga0207648_10212784
683 Ga0207683_10002773
684 Ga0207683_10005710
685 Ga0209970_1015105
686 Ga0210002_1008824
687 Ga0209983_1007343
688 Ga0209971_1003626
689 Ga0209971_1018814
690 Ga0209998_10011340
691 Ga0209974_10006319
692 Ga0307405_10012865
693 Ga0307405_10044803
694 Ga0307406_10109231
695 Ga0307409_100050216
696 Ga0307409_100085070
697 Ga0307416_100011629
698 Ga0307416_100061892
699 Ga0307414_10004403
700 Ga0307411_10165818
701 Ga0307415_100066846
702 Ga0373958_0028568
703 Ga0373926_0049031
704 Ga0373939_0080479
705 Ga0373945_0067807
706 Ga0373931_0019775
707 Ga0373931_0126485
708 Ga0373925_0111595
709 Ga0451577_0159851
710 Ga0453683_0020305
711 Ga0451576_0116957
712 Ga0451576_0321926
713 Ga0495580_0024941
714 Ga0495580_0151970
715 Ga0495580_0288440
716 Ga0495586_0074759
717 Ga0495656_0103989
718 Ga0495669_0131561
719 Ga0496102_0080959
720 Ga0496102_0417680
721 Ga0496106_0354215
722 Ga0496112_0014224
723 Ga0496112_0016392
724 Ga0496112_0107862
725 Ga0496113_0060062
726 Ga0496113_0178377
727 Ga0496113_0514992
728 Ga0501032_0020212
729 Ga0501033_0043340
730 Ga0501033_0269228
731 Ga0501036_0010195
732 Ga0501036_0072275
733 Ga0501036_0228596
734 Ga0501037_0005241
735 Ga0501037_0184687
736 Ga0501038_0044774
737 Ga0501038_0104295
738 Ga0501039_0011246
739 Ga0501039_0023882
740 Ga0501039_0237386
741 Ga0501040_0024947
742 Ga0501040_0240807
743 Ga0501041_0004058
744 Ga0501042_0001324
745 Ga0501042_0035124
746 Ga0501042_0300600
747 Ga0501043_0033826
748 Ga0501043_0291829
749 Ga0501046_0006153
750 Ga0501046_0045544
751 Ga0501046_0256250
752 Ga0501048_0018248
753 Ga0501048_0052530
754 Ga0501048_0104833
755 Ga0501068_0016381
756 Ga0501070_0025595
757 Ga0501070_0193955
758 Ga0501071_0000141
759 Ga0501071_0083070
760 Ga0501071_0195115
761 Ga0501072_0002610
762 Ga0501072_0036238
763 Ga0501072_0322484
764 Ga0501072_0331237
765 Ga0501074_0071981
766 Ga0501074_0172309
767 Ga0501075_0002999
768 Ga0501075_0171958
769 Ga0501076_0000317
770 Ga0501076_0072101
771 Ga0501076_0103694
772 Ga0501076_0226072
773 Ga0501076_0282496
774 Ga0501076_0306763
775 Ga0501077_0000294
776 Ga0501077_0013906
777 Ga0501077_0030742
778 Ga0501077_0228576
779 Ga0501079_0036862
780 Ga0501079_0199926
781 Ga0501079_0208965
782 Ga0501079_0348868
783 Ga0501080_0039453
784 Ga0501080_0423596
785 Ga0501081_0000985
786 Ga0501081_0130039
787 Ga0501081_0163127
788 Ga0501081_0207397
789 Ga0501083_0025757
790 Ga0501083_0102605
791 Ga0501035_0057891
792 Ga0501035_0060303
793 Ga0501035_0161759
794 Ga0501045_0007409
795 Ga0501045_0132559
796 Ga0501045_0264457
797 nmdc:mga05p37_102535_c1
798 nmdc:mga05p37_14652_c1
799 nmdc:mga05p37_191898_c1
800 nmdc:mga05p37_196706_c1
801 nmdc:mga05p37_3409_c1
802 nmdc:mga05p37_471605_c1
803 nmdc:mga05p37_480841_c1
804 nmdc:mga05p37_50283_c1
805 nmdc:mga05p37_531736_c1
806 nmdc:mga05p37_60679_c1
807 nmdc:mga05p37_656227_c1
808 nmdc:mga09592_283054_c1
809 nmdc:mga09592_364502_c1
810 nmdc:mga0qj67_125312_c1
811 nmdc:mga0qj67_142568_c1
812 nmdc:mga0qj67_170352_c1
813 nmdc:mga0qj67_67369_c1
814 nmdc:mga06r32_26026_c1
815 nmdc:mga08y16_164267_c1
816 nmdc:mga08y16_274524_c1
817 nmdc:mga08y16_33844_c1
818 nmdc:mga08y16_453723_c1
819 nmdc:mga08y16_513711_c1
820 nmdc:mga08y16_536218_c1
821 nmdc:mga0n895_1681_c1
822 nmdc:mga0n895_169177_c1
823 nmdc:mga0n895_19637_c1
824 nmdc:mga0n895_234860_c1
825 nmdc:mga0n895_247234_c1
826 nmdc:mga0n895_3679_c1
827 nmdc:mga0n895_38705_c1
828 nmdc:mga0n895_4764_c1
829 nmdc:mga0rr50_14845_c1
830 nmdc:mga0rr50_18639_c1
831 nmdc:mga0rr50_200919_c1
832 nmdc:mga0rr50_235398_c1
833 nmdc:mga0rr50_291471_c1
834 nmdc:mga0rr50_3127_c1
835 nmdc:mga0rr50_33789_c1
836 nmdc:mga0rr50_34820_c1
837 nmdc:mga0rr50_5185_c1
838 nmdc:mga08x19_39670_c1
839 nmdc:mga0a205_1230_c1
840 nmdc:mga0a205_152855_c1
841 nmdc:mga0a205_16123_c1
842 nmdc:mga0a205_28682_c1
843 nmdc:mga0a205_46939_c1
844 nmdc:mga0a205_51180_c1
845 nmdc:mga0a205_6081_c1
846 nmdc:mga0a205_7515_c1
847 nmdc:mga0a205_76127_c1
848 Ga0501084_0000614
849 Ga0501084_0140605
850 Ga0501084_0254428
851 Ga0590071_015207
852 Ga0501082_0001178
853 Ga0501082_0120565
854 Ga0530510_0014551
855 Ga0530510_0105460
856 Ga0530510_0184474
857 Ga0530510_0230190
858 Ga0530510_0300450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

76

288

0.87

PF13379

NMT1_2

NMT1-like family

62

297

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8317 29 318
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.816 29 318
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.807 28 313
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8018 27 314
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8017 30 313
ID Description Score Start End Superfamily
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8152 112 208 3.40.190.10
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.811 113 203 3.40.190.10
4k3fA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8047 28 106 3.40.190.10
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7995 29 315 3.40.190.10
3k2dB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7942 31 109 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A535AZI6-F1-model_v4 ABC transporter substrate-binding protein 0.9446 34 331
AF-A0A534MZQ2-F1-model_v4 ABC transporter substrate-binding protein 0.9366 34 320
AF-A0A534SZD3-F1-model_v4 ABC transporter substrate-binding protein 0.9356 21 300 GO:0042918
AF-A0A1F8XF38-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9308 30 331 GO:0003676
GO:0008168
GO:0032259
AF-A0A534S9F9-F1-model_v4 ABC transporter substrate-binding protein 0.9271 21 322

Map