F441783

General Info

Members Datasets Scaffolds Average Seq Length
428 170 856 236

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_3957_c1|nmdc:mga0qj67_3957_c1_5470_6324
Length 275
Sequence LDIARVVSERDTDGRAFLAVKSRRSLAHSLPCGRYLAFTLSSRGGKMARRALFVSLVGLLFLWPLQTKGDAQKEAPVVKIPDAGVPQVSTIEGKFYVILGYQASNRSIGEPWMLLEVGITVLDNVPDYRLTRAAISLDTPDGKNIPLPTTEEFRKGNQTAIQSIQQRAKVQRDSINYFPVKASRACAILFFPELGQRALPFDEVDLSDDRACLGRFYFNIPGGIAYGQHWLNVKFQNSVVRVPFRILTNDEEKLLSKNYKSIERQVKEAFAPKKK

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.34
Rhizosphere 97.2
Stem 0
Stem Tuber 0
Unclassified 23.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_3957_c1 3300050509 Bacteria 10723
2 JGI24746J21847_1002136 3300001977 Bacteria 3161
3 JGI24749J21850_1006454 3300002076 Bacteria 1635
4 Ga0058859_11469612 3300004798 Unclassified 864
5 Ga0058860_10013441 3300004801 Bacteria 886
6 Ga0065704_10180901 3300005289 Unclassified 1237
7 Ga0065712_10007115 3300005290 Bacteria 3074
8 Ga0065712_10260049 3300005290 Unclassified 939
9 Ga0065715_10019652 3300005293 Unclassified 1889
10 Ga0065715_10345701 3300005293 Bacteria 959
11 Ga0065707_10005998 3300005295 Unclassified 4319
12 Ga0070676_10010431 3300005328 Bacteria 5041
13 Ga0070676_10082644 3300005328 Unclassified 1952
14 Ga0070690_100004322 3300005330 Bacteria 7878
15 Ga0070670_100002849 3300005331 Bacteria 14296
16 Ga0070670_100026895 3300005331 Bacteria 4948
17 Ga0070677_10002810 3300005333 Bacteria 5576
18 Ga0070677_10082684 3300005333 Bacteria 1378
19 Ga0068869_100005484 3300005334 Bacteria 7982
20 Ga0068869_100014015 3300005334 Bacteria 5348
21 Ga0068869_100028678 3300005334 Unclassified 3893
22 Ga0068869_100128342 3300005334 Bacteria 1947
23 Ga0068869_100427724 3300005334 Bacteria 1093
24 Ga0070666_10012044 3300005335 Bacteria 5444
25 Ga0070666_10039165 3300005335 Bacteria 3158
26 Ga0070666_10052586 3300005335 Unclassified 2745
27 Ga0070666_10133223 3300005335 Bacteria 1728
28 Ga0070666_10139704 3300005335 Bacteria 1687
29 Ga0070680_100080145 3300005336 Unclassified 2692
30 Ga0068868_100051719 3300005338 Bacteria 3233
31 Ga0070687_100011676 3300005343 Bacteria 3852
32 Ga0070687_100064116 3300005343 Bacteria 1951
33 Ga0070661_100041093 3300005344 Unclassified 3374
34 Ga0070668_100022091 3300005347 Bacteria 4809
35 Ga0070668_100147497 3300005347 Bacteria 1900
36 Ga0070669_100029786 3300005353 Bacteria 3937
37 Ga0070669_100045530 3300005353 Bacteria 3197
38 Ga0070669_100181549 3300005353 Bacteria 1646
39 Ga0070669_100206274 3300005353 Bacteria 1549
40 Ga0070669_100376124 3300005353 Bacteria 1158
41 Ga0070669_100526148 3300005353 Bacteria 984
42 Ga0070675_100005781 3300005354 Bacteria 9463
43 Ga0070675_100010248 3300005354 Bacteria 7312
44 Ga0070675_100084940 3300005354 Unclassified 2644
45 Ga0070675_100109958 3300005354 Bacteria 2330
46 Ga0070675_100111565 3300005354 Bacteria 2314
47 Ga0070675_100231068 3300005354 Unclassified 1613
48 Ga0070675_100415825 3300005354 Unclassified 1202
49 Ga0070671_100002435 3300005355 Bacteria 14387
50 Ga0070671_100158054 3300005355 Bacteria 1915
51 Ga0070674_100000369 3300005356 Bacteria 22527
52 Ga0070674_100103514 3300005356 Bacteria 2079
53 Ga0070674_100107780 3300005356 Bacteria 2040
54 Ga0070674_100205379 3300005356 Bacteria 1524
55 Ga0070674_100333954 3300005356 Unclassified 1219
56 Ga0070673_100014944 3300005364 Bacteria 5433
57 Ga0070673_100043300 3300005364 Bacteria 3478
58 Ga0070673_100049188 3300005364 Bacteria 3291
59 Ga0070673_100125451 3300005364 Bacteria 2147
60 Ga0070673_100168148 3300005364 Bacteria 1870
61 Ga0070673_100239777 3300005364 Bacteria 1576
62 Ga0070688_100001287 3300005365 Bacteria 12505
63 Ga0070688_100021409 3300005365 Bacteria 3776
64 Ga0070688_100468835 3300005365 Unclassified 945
65 Ga0070667_100020997 3300005367 Bacteria 5424
66 Ga0070667_100125677 3300005367 Bacteria 2235
67 Ga0070667_100803948 3300005367 Bacteria 873
68 Ga0070713_100026191 3300005436 Bacteria 4574
69 Ga0070713_100413239 3300005436 Bacteria 1262
70 Ga0070701_10003567 3300005438 Bacteria 6181
71 Ga0070701_10195452 3300005438 Bacteria 1192
72 Ga0070700_100013066 3300005441 Bacteria 4656
73 Ga0070700_100029275 3300005441 Bacteria 3282
74 Ga0070663_100701364 3300005455 Unclassified 860
75 Ga0070678_100029127 3300005456 Unclassified 3778
76 Ga0070678_100048073 3300005456 Unclassified 3070
77 Ga0070678_100061066 3300005456 Bacteria 2777
78 Ga0070678_100079731 3300005456 Bacteria 2478
79 Ga0070678_100201003 3300005456 Bacteria 1645
80 Ga0070678_100331746 3300005456 Unclassified 1302
81 Ga0070678_100444156 3300005456 Unclassified 1135
82 Ga0070662_100483461 3300005457 Bacteria 1031
83 Ga0068867_100013350 3300005459 Bacteria 5818
84 Ga0068867_100188432 3300005459 Bacteria 1645
85 Ga0068867_100336737 3300005459 Bacteria 1255
86 Ga0068867_100756854 3300005459 Bacteria 862
87 Ga0070685_10034298 3300005466 Bacteria 2857
88 Ga0070698_100566371 3300005471 Bacteria 1076
89 Ga0070699_100000001 3300005518 Bacteria 910751
90 Ga0070672_100012252 3300005543 Bacteria 6010
91 Ga0070672_100020207 3300005543 Bacteria 4852
92 Ga0070672_100103068 3300005543 Bacteria 2317
93 Ga0070672_100113006 3300005543 Unclassified 2216
94 Ga0070672_100131719 3300005543 Bacteria 2056
95 Ga0070672_100210141 3300005543 Bacteria 1630
96 Ga0070686_100001366 3300005544 Bacteria 13797
97 Ga0070686_100325864 3300005544 Bacteria 1147
98 Ga0070695_100009678 3300005545 Bacteria 5740
99 Ga0070695_100497920 3300005545 Bacteria 942
100 Ga0070665_100005607 3300005548 Bacteria 12908
101 Ga0070665_100089862 3300005548 Unclassified 3077
102 Ga0070665_100315768 3300005548 Bacteria 1567
103 Ga0070704_100058010 3300005549 Unclassified 2756
104 Ga0070704_100379453 3300005549 Bacteria 1200
105 Ga0070704_100484191 3300005549 Bacteria 1071
106 Ga0070664_100009101 3300005564 Bacteria 8060
107 Ga0070664_100043095 3300005564 Unclassified 3808
108 Ga0070664_100069870 3300005564 Bacteria 3006
109 Ga0068857_100279961 3300005577 Bacteria 1534
110 Ga0068859_100008142 3300005617 Bacteria 10630
111 Ga0068859_100028978 3300005617 Bacteria 5555
112 Ga0068864_100043365 3300005618 Bacteria 3852
113 Ga0068864_100384927 3300005618 Bacteria 1330
114 Ga0068864_100402660 3300005618 Unclassified 1301
115 Ga0068864_100407132 3300005618 Bacteria 1294
116 Ga0068866_10054644 3300005718 Bacteria 2047
117 Ga0068861_100021889 3300005719 Unclassified 4598
118 Ga0068861_100149773 3300005719 Bacteria 1913
119 Ga0068861_100596902 3300005719 Bacteria 1013
120 Ga0068870_10003472 3300005840 Bacteria 6680
121 Ga0068870_10015214 3300005840 Unclassified 3647
122 Ga0068870_10233166 3300005840 Unclassified 1133
123 Ga0068870_10253057 3300005840 Bacteria 1093
124 Ga0068863_100230644 3300005841 Bacteria 1786
125 Ga0068863_100316029 3300005841 Bacteria 1517
126 Ga0068858_100323234 3300005842 Bacteria 1475
127 Ga0068858_100655925 3300005842 Bacteria 1020
128 Ga0068860_100052765 3300005843 Unclassified 3867
129 Ga0068862_100003403 3300005844 Bacteria 13719
130 Ga0068862_100075437 3300005844 Bacteria 2917
131 Ga0068862_100161049 3300005844 Unclassified 2003
132 Ga0068862_100321611 3300005844 Unclassified 1428
133 Ga0068862_100903131 3300005844 Bacteria 868
134 Ga0097621_100018457 3300006237 Bacteria 5329
135 Ga0097621_100039730 3300006237 Bacteria 3780
136 Ga0097621_100313164 3300006237 Unclassified 1389
137 Ga0097621_100349423 3300006237 Bacteria 1315
138 Ga0068871_100030087 3300006358 Bacteria 4273
139 Ga0068871_100038944 3300006358 Bacteria 3801
140 Ga0068871_100068669 3300006358 Bacteria 2910
141 Ga0068871_100166977 3300006358 Bacteria 1885
142 Ga0068871_100196288 3300006358 Bacteria 1741
143 Ga0068871_100254327 3300006358 Bacteria 1531
144 Ga0068871_100809632 3300006358 Archaea 864
145 Ga0075428_100019853 3300006844 Bacteria 7439
146 Ga0075428_100033720 3300006844 Bacteria 5650
147 Ga0075428_100068949 3300006844 Unclassified 3868
148 Ga0075428_100656092 3300006844 Unclassified 1119
149 Ga0075430_100010283 3300006846 Bacteria 7921
150 Ga0075430_100017435 3300006846 Bacteria 6116
151 Ga0075431_100000102 3300006847 Bacteria 53476
152 Ga0075431_100024288 3300006847 Bacteria 6209
153 Ga0075431_100043935 3300006847 Bacteria 4609
154 Ga0075431_100062060 3300006847 Bacteria 3857
155 Ga0075431_100071513 3300006847 Bacteria 3579
156 Ga0075431_100386537 3300006847 Bacteria 1403
157 Ga0075433_10005237 3300006852 Bacteria 10166
158 Ga0075433_10017030 3300006852 Bacteria 6008
159 Ga0075434_100028167 3300006871 Bacteria 5519
160 Ga0075434_100044178 3300006871 Bacteria 4421
161 Ga0075429_100056745 3300006880 Unclassified 3409
162 Ga0075429_100097555 3300006880 Bacteria 2564
163 Ga0075429_100207908 3300006880 Bacteria 1715
164 Ga0075429_100307388 3300006880 Unclassified 1388
165 Ga0068865_100022038 3300006881 Bacteria 4149
166 Ga0068865_100151592 3300006881 Bacteria 1759
167 Ga0097620_100008142 3300006931 Bacteria 10630
168 Ga0097620_100028979 3300006931 Bacteria 5555
169 Ga0075435_100032417 3300007076 Bacteria 4126
170 Ga0075435_100080854 3300007076 Bacteria 2669
171 Ga0111539_10000001 3300009094 Bacteria 1035431
172 Ga0111539_10013196 3300009094 Bacteria 10331
173 Ga0111539_10024289 3300009094 Bacteria 7442
174 Ga0111539_10040703 3300009094 Bacteria 5592
175 Ga0111539_10130606 3300009094 Bacteria 2941
176 Ga0111539_11076489 3300009094 Bacteria 934
177 Ga0111539_11455976 3300009094 Unclassified 794
178 Ga0105245_10022325 3300009098 Bacteria 5554
179 Ga0105245_10100228 3300009098 Bacteria 2679
180 Ga0105245_10418470 3300009098 Bacteria 1343
181 Ga0114129_10039075 3300009147 Bacteria 6691
182 Ga0114129_10039664 3300009147 Bacteria 6640
183 Ga0114129_10770492 3300009147 Unclassified 1230
184 Ga0105243_10014111 3300009148 Bacteria 6044
185 Ga0105243_10017721 3300009148 Bacteria 5386
186 Ga0105242_10023034 3300009176 Unclassified 4907
187 Ga0105242_10070795 3300009176 Bacteria 2892
188 Ga0105242_10107862 3300009176 Bacteria 2369
189 Ga0105248_10002803 3300009177 Bacteria 19379
190 Ga0105248_10063699 3300009177 Bacteria 4138
191 Ga0105248_10143700 3300009177 Bacteria 2692
192 Ga0105248_10260514 3300009177 Bacteria 1952
193 Ga0105248_10423448 3300009177 Bacteria 1499
194 Ga0105248_10513017 3300009177 Bacteria 1352
195 Ga0105248_10517402 3300009177 Unclassified 1346
196 Ga0105238_10002237 3300009551 Bacteria 19526
197 Ga0105238_10520730 3300009551 Bacteria 1192
198 Ga0105249_10063753 3300009553 Bacteria 3386
199 Ga0105246_10068504 3300011119 Bacteria 2489
200 Ga0105246_10286941 3300011119 Bacteria 1323
201 Ga0157371_10229851 3300013102 Bacteria 1333
202 Ga0157374_10475917 3300013296 Bacteria 1252
203 Ga0163162_10012968 3300013306 Bacteria 8133
204 Ga0163162_10055936 3300013306 Unclassified 3974
205 Ga0163162_10148786 3300013306 Bacteria 2458
206 Ga0157375_10014476 3300013308 Bacteria 7037
207 Ga0157375_10150757 3300013308 Bacteria 2460
208 Ga0157375_10273636 3300013308 Bacteria 1851
209 Ga0157375_10511548 3300013308 Bacteria 1364
210 Ga0163163_10002154 3300014325 Bacteria 16652
211 Ga0163163_10076442 3300014325 Unclassified 3343
212 Ga0163163_10218988 3300014325 Unclassified 1952
213 Ga0157380_10024112 3300014326 Unclassified 4600
214 Ga0157380_10028128 3300014326 Bacteria 4283
215 Ga0157380_10076512 3300014326 Bacteria 2724
216 Ga0157380_10125441 3300014326 Bacteria 2181
217 Ga0157380_10137638 3300014326 Bacteria 2093
218 Ga0157380_10138237 3300014326 Unclassified 2089
219 Ga0157380_10167121 3300014326 Unclassified 1918
220 Ga0157380_10172136 3300014326 Bacteria 1893
221 Ga0157380_10314162 3300014326 Bacteria 1450
222 Ga0157380_10472422 3300014326 Unclassified 1210
223 Ga0157377_10006657 3300014745 Bacteria 5525
224 Ga0157377_10222819 3300014745 Bacteria 1208
225 Ga0157377_10252527 3300014745 Bacteria 1144
226 Ga0157379_10642050 3300014968 Bacteria 993
227 Ga0157376_10054017 3300014969 Unclassified 3347
228 Ga0157376_10176101 3300014969 Bacteria 1951
229 Ga0157376_10631554 3300014969 Unclassified 1069
230 Ga0207697_10004654 3300025315 Bacteria 6507
231 Ga0207697_10144893 3300025315 Unclassified 1032
232 Ga0207682_10007339 3300025893 Unclassified 4396
233 Ga0207682_10061274 3300025893 Bacteria 1575
234 Ga0207682_10115395 3300025893 Bacteria 1186
235 Ga0207642_10013776 3300025899 Bacteria 2961
236 Ga0207688_10001825 3300025901 Bacteria 11355
237 Ga0207680_10011755 3300025903 Bacteria 4435
238 Ga0207680_10108252 3300025903 Bacteria 1798
239 Ga0207645_10009873 3300025907 Bacteria 6579
240 Ga0207645_10017515 3300025907 Unclassified 4727
241 Ga0207645_10076748 3300025907 Bacteria 2140
242 Ga0207645_10160092 3300025907 Unclassified 1472
243 Ga0207643_10000661 3300025908 Bacteria 21517
244 Ga0207643_10022782 3300025908 Unclassified 3452
245 Ga0207643_10053183 3300025908 Bacteria 2300
246 Ga0207643_10291742 3300025908 Unclassified 1013
247 Ga0207662_10097680 3300025918 Bacteria 1816
248 Ga0207649_10578793 3300025920 Unclassified 862
249 Ga0207681_10036627 3300025923 Unclassified 3238
250 Ga0207681_10103797 3300025923 Unclassified 2055
251 Ga0207681_10131500 3300025923 Bacteria 1851
252 Ga0207681_10141074 3300025923 Unclassified 1794
253 Ga0207681_10322899 3300025923 Bacteria 1228
254 Ga0207681_10450324 3300025923 Bacteria 1047
255 Ga0207694_10036382 3300025924 Bacteria 3779
256 Ga0207650_10038871 3300025925 Unclassified 3477
257 Ga0207650_10271973 3300025925 Bacteria 1377
258 Ga0207659_10000426 3300025926 Bacteria 25434
259 Ga0207659_10005407 3300025926 Bacteria 7737
260 Ga0207659_10019006 3300025926 Bacteria 4514
261 Ga0207659_10030204 3300025926 Bacteria 3700
262 Ga0207659_10063448 3300025926 Unclassified 2671
263 Ga0207659_10103172 3300025926 Unclassified 2154
264 Ga0207659_10155128 3300025926 Bacteria 1792
265 Ga0207659_10553782 3300025926 Unclassified 978
266 Ga0207687_10029653 3300025927 Bacteria 3682
267 Ga0207687_10173561 3300025927 Bacteria 1664
268 Ga0207700_10019361 3300025928 Bacteria 4596
269 Ga0207644_10057668 3300025931 Bacteria 2804
270 Ga0207644_10130932 3300025931 Unclassified 1920
271 Ga0207706_10007241 3300025933 Bacteria 10258
272 Ga0207706_10063626 3300025933 Bacteria 3248
273 Ga0207706_10411816 3300025933 Bacteria 1171
274 Ga0207686_10035749 3300025934 Unclassified 2984
275 Ga0207686_10173818 3300025934 Bacteria 1521
276 Ga0207709_10124211 3300025935 Bacteria 1748
277 Ga0207709_10279136 3300025935 Bacteria 1233
278 Ga0207669_10002494 3300025937 Bacteria 7850
279 Ga0207669_10063723 3300025937 Bacteria 2277
280 Ga0207669_10069981 3300025937 Archaea 2198
281 Ga0207669_10076553 3300025937 Bacteria 2124
282 Ga0207669_10234939 3300025937 Bacteria 1355
283 Ga0207669_10238474 3300025937 Bacteria 1346
284 Ga0207704_10028021 3300025938 Bacteria 3118
285 Ga0207704_10073281 3300025938 Bacteria 2180
286 Ga0207691_10004382 3300025940 Bacteria 13682
287 Ga0207691_10023020 3300025940 Bacteria 5867
288 Ga0207691_10091086 3300025940 Unclassified 2733
289 Ga0207691_10152997 3300025940 Unclassified 2027
290 Ga0207711_10014552 3300025941 Bacteria 6539
291 Ga0207711_10041336 3300025941 Unclassified 3926
292 Ga0207711_10088780 3300025941 Bacteria 2715
293 Ga0207711_10166694 3300025941 Bacteria 1997
294 Ga0207711_10363631 3300025941 Unclassified 1341
295 Ga0207711_10377550 3300025941 Unclassified 1315
296 Ga0207711_10401063 3300025941 Bacteria 1274
297 Ga0207711_10696668 3300025941 Unclassified 947
298 Ga0207711_10873764 3300025941 Unclassified 836
299 Ga0207689_10005621 3300025942 Bacteria 11170
300 Ga0207689_10005732 3300025942 Bacteria 11036
301 Ga0207689_10009071 3300025942 Bacteria 8612
302 Ga0207689_10428273 3300025942 Bacteria 1104
303 Ga0207679_10009265 3300025945 Bacteria 6297
304 Ga0207679_10029780 3300025945 Bacteria 3804
305 Ga0207679_10335967 3300025945 Bacteria 1313
306 Ga0207651_10004045 3300025960 Bacteria 7301
307 Ga0207651_10017355 3300025960 Bacteria 4251
308 Ga0207651_10176014 3300025960 Unclassified 1692
309 Ga0207651_10223168 3300025960 Bacteria 1525
310 Ga0207651_10305005 3300025960 Bacteria 1325
311 Ga0207668_10084442 3300025972 Bacteria 2314
312 Ga0207668_10097605 3300025972 Bacteria 2175
313 Ga0207640_10448527 3300025981 Bacteria 1063
314 Ga0207658_10497804 3300025986 Bacteria 1085
315 Ga0207677_10056621 3300026023 Bacteria 2687
316 Ga0207677_10483913 3300026023 Bacteria 1067
317 Ga0207677_10756221 3300026023 Bacteria 867
318 Ga0207703_10031552 3300026035 Bacteria 4191
319 Ga0207703_10149366 3300026035 Bacteria 2036
320 Ga0207703_10218523 3300026035 Bacteria 1703
321 Ga0207678_10075466 3300026067 Bacteria 2888
322 Ga0207678_10272591 3300026067 Bacteria 1451
323 Ga0207678_10903277 3300026067 Unclassified 781
324 Ga0207708_10008494 3300026075 Bacteria 7603
325 Ga0207708_10108128 3300026075 Bacteria 2157
326 Ga0207641_10025507 3300026088 Bacteria 4875
327 Ga0207641_10131181 3300026088 Bacteria 2251
328 Ga0207641_10136553 3300026088 Bacteria 2208
329 Ga0207641_10481967 3300026088 Bacteria 1202
330 Ga0207648_10008274 3300026089 Bacteria 10100
331 Ga0207648_10040548 3300026089 Bacteria 4091
332 Ga0207648_10436958 3300026089 Bacteria 1190
333 Ga0207676_10242261 3300026095 Unclassified 1618
334 Ga0207674_10078625 3300026116 Bacteria 3303
335 Ga0207674_10209677 3300026116 Bacteria 1897
336 Ga0207674_10692594 3300026116 Bacteria 984
337 Ga0207675_100091992 3300026118 Unclassified 2852
338 Ga0207675_100313055 3300026118 Unclassified 1531
339 Ga0207675_100883994 3300026118 Bacteria 909
340 Ga0207683_10007178 3300026121 Bacteria 9551
341 Ga0207683_10044718 3300026121 Bacteria 3871
342 Ga0207683_10070625 3300026121 Bacteria 3085
343 Ga0207683_10186005 3300026121 Bacteria 1885
344 Ga0207683_10187064 3300026121 Unclassified 1879
345 Ga0207683_10385170 3300026121 Unclassified 1289
346 Ga0207683_10480092 3300026121 Unclassified 1147
347 Ga0207683_10480899 3300026121 Bacteria 1146
348 Ga0207683_10571528 3300026121 Bacteria 1046
349 Ga0207683_10640046 3300026121 Unclassified 985
350 Ga0209971_1023251 3300027682 Bacteria 1478
351 Ga0209974_10111770 3300027876 Unclassified 962
352 Ga0207428_10000205 3300027907 Bacteria 82100
353 Ga0207428_10004988 3300027907 Bacteria 12491
354 Ga0207428_10009581 3300027907 Bacteria 8675
355 Ga0207428_10012266 3300027907 Bacteria 7534
356 Ga0268266_10003995 3300028379 Bacteria 14290
357 Ga0268266_10080259 3300028379 Unclassified 2842
358 Ga0268266_10802743 3300028379 Bacteria 909
359 Ga0268265_10070696 3300028380 Bacteria 2715
360 Ga0268265_10264925 3300028380 Bacteria 1530
361 Ga0268265_10272613 3300028380 Bacteria 1510
362 Ga0268265_10587709 3300028380 Unclassified 1062
363 Ga0307410_10295239 3300031852 Unclassified 1277
364 Ga0307416_100006131 3300032002 Bacteria 7490
365 Ga0373954_0214780 3300035118 Bacteria 946
366 Ga0373937_0004076 3300036401 Bacteria 12392
367 Ga0373937_0214617 3300036401 Bacteria 1811
368 Ga0373925_0086484 3300037068 Bacteria 2392
369 Ga0373925_0505914 3300037068 Bacteria 992
370 Ga0451798_0327949 3300041458 Unclassified 779
371 Ga0439435_0004464 3300042436 Bacteria 3017
372 Ga0439435_0058004 3300042436 Bacteria 1122
373 Ga0453683_0041413 3300044673 Unclassified 2893
374 Ga0495603_0288841 3300046455 Bacteria 942
375 Ga0495630_0266656 3300046517 Bacteria 1308
376 Ga0495640_0043633 3300046533 Bacteria 3122
377 Ga0495621_0057142 3300046539 Bacteria 1408
378 Ga0495656_0006093 3300046615 Unclassified 4207
379 Ga0495588_0375859 3300046674 Bacteria 746
380 Ga0495624_0029878 3300046690 Bacteria 3553
381 Ga0495674_0081113 3300047319 Unclassified 2783
382 Ga0495676_0046798 3300047321 Bacteria 3506
383 Ga0495680_0004674 3300047322 Bacteria 13045
384 Ga0495684_0084754 3300047471 Bacteria 2403
385 Ga0495614_0104115 3300048089 Unclassified 1243
386 Ga0496100_0005342 3300048903 Bacteria 6908
387 Ga0496101_0005906 3300048904 Bacteria 7839
388 Ga0496102_0165369 3300048905 Bacteria 2081
389 Ga0496104_0030826 3300048907 Bacteria 4986
390 Ga0496104_0192183 3300048907 Bacteria 1953
391 Ga0496105_0382736 3300048908 Bacteria 1119
392 Ga0496106_0170034 3300048909 Bacteria 1727
393 Ga0496114_0000906 3300048917 Bacteria 22197
394 Ga0496115_0539151 3300048918 Bacteria 934
395 Ga0501036_0132244 3300049572 Bacteria 2106
396 Ga0501039_0204854 3300049575 Bacteria 1551
397 Ga0501040_0508842 3300049576 Unclassified 868
398 Ga0501041_0147370 3300049577 Bacteria 1469
399 Ga0501042_0409111 3300049578 Unclassified 983
400 Ga0501043_0374853 3300049579 Bacteria 1078
401 Ga0501071_0343422 3300049587 Bacteria 1135
402 Ga0501075_0449175 3300049591 Unclassified 983
403 nmdc:mga05p37_133545_c1 3300050507 Bacteria 3045
404 nmdc:mga05p37_463712_c1 3300050507 Bacteria 1463
405 nmdc:mga05p37_94320_c1 3300050507 Bacteria 3688
406 nmdc:mga09592_31939_c1 3300050508 Bacteria 4388
407 nmdc:mga09592_470439_c1 3300050508 Bacteria 1084
408 nmdc:mga09592_94210_c1 3300050508 Bacteria 2561
409 nmdc:mga0qj67_158303_c1 3300050509 Bacteria 1838
410 nmdc:mga0qj67_74219_c1 3300050509 Bacteria 2718
411 nmdc:mga06r32_17205_c1 3300050510 Bacteria 6599
412 nmdc:mga06r32_50982_c1 3300050510 Bacteria 3960
413 nmdc:mga06r32_59699_c1 3300050510 Bacteria 3669
414 nmdc:mga08y16_1077814_c1 3300050511 Unclassified 779
415 nmdc:mga08y16_174844_c1 3300050511 Bacteria 2230
416 nmdc:mga08y16_229711_c1 3300050511 Bacteria 1919
417 nmdc:mga08y16_2750_c1 3300050511 Bacteria 16613
418 nmdc:mga08y16_322029_c1 3300050511 Bacteria 1591
419 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
420 nmdc:mga08y16_815151_c1 3300050511 Unclassified 925
421 nmdc:mga08y16_92112_c1 3300050511 Unclassified 3159
422 nmdc:mga0n895_23117_c1 3300050512 Bacteria 5839
423 nmdc:mga0n895_502925_c1 3300050512 Unclassified 1221
424 nmdc:mga0rr50_498975_c1 3300050513 Bacteria 1035
425 nmdc:mga0a205_2758_c1 3300050515 Bacteria 15515
426 nmdc:mga0a205_48280_c1 3300050515 Unclassified 4109
427 nmdc:mga0a205_62045_c1 3300050515 Bacteria 3612
428 Ga0495619_0444370 3300053085 Unclassified 894
429 nmdc:mga0qj67_3957_c1
430 JGI24746J21847_1002136
431 JGI24749J21850_1006454
432 Ga0058859_11469612
433 Ga0058860_10013441
434 Ga0065704_10180901
435 Ga0065712_10007115
436 Ga0065712_10260049
437 Ga0065715_10019652
438 Ga0065715_10345701
439 Ga0065707_10005998
440 Ga0070676_10010431
441 Ga0070676_10082644
442 Ga0070690_100004322
443 Ga0070670_100002849
444 Ga0070670_100026895
445 Ga0070677_10002810
446 Ga0070677_10082684
447 Ga0068869_100005484
448 Ga0068869_100014015
449 Ga0068869_100028678
450 Ga0068869_100128342
451 Ga0068869_100427724
452 Ga0070666_10012044
453 Ga0070666_10039165
454 Ga0070666_10052586
455 Ga0070666_10133223
456 Ga0070666_10139704
457 Ga0070680_100080145
458 Ga0068868_100051719
459 Ga0070687_100011676
460 Ga0070687_100064116
461 Ga0070661_100041093
462 Ga0070668_100022091
463 Ga0070668_100147497
464 Ga0070669_100029786
465 Ga0070669_100045530
466 Ga0070669_100181549
467 Ga0070669_100206274
468 Ga0070669_100376124
469 Ga0070669_100526148
470 Ga0070675_100005781
471 Ga0070675_100010248
472 Ga0070675_100084940
473 Ga0070675_100109958
474 Ga0070675_100111565
475 Ga0070675_100231068
476 Ga0070675_100415825
477 Ga0070671_100002435
478 Ga0070671_100158054
479 Ga0070674_100000369
480 Ga0070674_100103514
481 Ga0070674_100107780
482 Ga0070674_100205379
483 Ga0070674_100333954
484 Ga0070673_100014944
485 Ga0070673_100043300
486 Ga0070673_100049188
487 Ga0070673_100125451
488 Ga0070673_100168148
489 Ga0070673_100239777
490 Ga0070688_100001287
491 Ga0070688_100021409
492 Ga0070688_100468835
493 Ga0070667_100020997
494 Ga0070667_100125677
495 Ga0070667_100803948
496 Ga0070713_100026191
497 Ga0070713_100413239
498 Ga0070701_10003567
499 Ga0070701_10195452
500 Ga0070700_100013066
501 Ga0070700_100029275
502 Ga0070663_100701364
503 Ga0070678_100029127
504 Ga0070678_100048073
505 Ga0070678_100061066
506 Ga0070678_100079731
507 Ga0070678_100201003
508 Ga0070678_100331746
509 Ga0070678_100444156
510 Ga0070662_100483461
511 Ga0068867_100013350
512 Ga0068867_100188432
513 Ga0068867_100336737
514 Ga0068867_100756854
515 Ga0070685_10034298
516 Ga0070698_100566371
517 Ga0070699_100000001
518 Ga0070672_100012252
519 Ga0070672_100020207
520 Ga0070672_100103068
521 Ga0070672_100113006
522 Ga0070672_100131719
523 Ga0070672_100210141
524 Ga0070686_100001366
525 Ga0070686_100325864
526 Ga0070695_100009678
527 Ga0070695_100497920
528 Ga0070665_100005607
529 Ga0070665_100089862
530 Ga0070665_100315768
531 Ga0070704_100058010
532 Ga0070704_100379453
533 Ga0070704_100484191
534 Ga0070664_100009101
535 Ga0070664_100043095
536 Ga0070664_100069870
537 Ga0068857_100279961
538 Ga0068859_100008142
539 Ga0068859_100028978
540 Ga0068864_100043365
541 Ga0068864_100384927
542 Ga0068864_100402660
543 Ga0068864_100407132
544 Ga0068866_10054644
545 Ga0068861_100021889
546 Ga0068861_100149773
547 Ga0068861_100596902
548 Ga0068870_10003472
549 Ga0068870_10015214
550 Ga0068870_10233166
551 Ga0068870_10253057
552 Ga0068863_100230644
553 Ga0068863_100316029
554 Ga0068858_100323234
555 Ga0068858_100655925
556 Ga0068860_100052765
557 Ga0068862_100003403
558 Ga0068862_100075437
559 Ga0068862_100161049
560 Ga0068862_100321611
561 Ga0068862_100903131
562 Ga0097621_100018457
563 Ga0097621_100039730
564 Ga0097621_100313164
565 Ga0097621_100349423
566 Ga0068871_100030087
567 Ga0068871_100038944
568 Ga0068871_100068669
569 Ga0068871_100166977
570 Ga0068871_100196288
571 Ga0068871_100254327
572 Ga0068871_100809632
573 Ga0075428_100019853
574 Ga0075428_100033720
575 Ga0075428_100068949
576 Ga0075428_100656092
577 Ga0075430_100010283
578 Ga0075430_100017435
579 Ga0075431_100000102
580 Ga0075431_100024288
581 Ga0075431_100043935
582 Ga0075431_100062060
583 Ga0075431_100071513
584 Ga0075431_100386537
585 Ga0075433_10005237
586 Ga0075433_10017030
587 Ga0075434_100028167
588 Ga0075434_100044178
589 Ga0075429_100056745
590 Ga0075429_100097555
591 Ga0075429_100207908
592 Ga0075429_100307388
593 Ga0068865_100022038
594 Ga0068865_100151592
595 Ga0097620_100008142
596 Ga0097620_100028979
597 Ga0075435_100032417
598 Ga0075435_100080854
599 Ga0111539_10000001
600 Ga0111539_10013196
601 Ga0111539_10024289
602 Ga0111539_10040703
603 Ga0111539_10130606
604 Ga0111539_11076489
605 Ga0111539_11455976
606 Ga0105245_10022325
607 Ga0105245_10100228
608 Ga0105245_10418470
609 Ga0114129_10039075
610 Ga0114129_10039664
611 Ga0114129_10770492
612 Ga0105243_10014111
613 Ga0105243_10017721
614 Ga0105242_10023034
615 Ga0105242_10070795
616 Ga0105242_10107862
617 Ga0105248_10002803
618 Ga0105248_10063699
619 Ga0105248_10143700
620 Ga0105248_10260514
621 Ga0105248_10423448
622 Ga0105248_10513017
623 Ga0105248_10517402
624 Ga0105238_10002237
625 Ga0105238_10520730
626 Ga0105249_10063753
627 Ga0105246_10068504
628 Ga0105246_10286941
629 Ga0157371_10229851
630 Ga0157374_10475917
631 Ga0163162_10012968
632 Ga0163162_10055936
633 Ga0163162_10148786
634 Ga0157375_10014476
635 Ga0157375_10150757
636 Ga0157375_10273636
637 Ga0157375_10511548
638 Ga0163163_10002154
639 Ga0163163_10076442
640 Ga0163163_10218988
641 Ga0157380_10024112
642 Ga0157380_10028128
643 Ga0157380_10076512
644 Ga0157380_10125441
645 Ga0157380_10137638
646 Ga0157380_10138237
647 Ga0157380_10167121
648 Ga0157380_10172136
649 Ga0157380_10314162
650 Ga0157380_10472422
651 Ga0157377_10006657
652 Ga0157377_10222819
653 Ga0157377_10252527
654 Ga0157379_10642050
655 Ga0157376_10054017
656 Ga0157376_10176101
657 Ga0157376_10631554
658 Ga0207697_10004654
659 Ga0207697_10144893
660 Ga0207682_10007339
661 Ga0207682_10061274
662 Ga0207682_10115395
663 Ga0207642_10013776
664 Ga0207688_10001825
665 Ga0207680_10011755
666 Ga0207680_10108252
667 Ga0207645_10009873
668 Ga0207645_10017515
669 Ga0207645_10076748
670 Ga0207645_10160092
671 Ga0207643_10000661
672 Ga0207643_10022782
673 Ga0207643_10053183
674 Ga0207643_10291742
675 Ga0207662_10097680
676 Ga0207649_10578793
677 Ga0207681_10036627
678 Ga0207681_10103797
679 Ga0207681_10131500
680 Ga0207681_10141074
681 Ga0207681_10322899
682 Ga0207681_10450324
683 Ga0207694_10036382
684 Ga0207650_10038871
685 Ga0207650_10271973
686 Ga0207659_10000426
687 Ga0207659_10005407
688 Ga0207659_10019006
689 Ga0207659_10030204
690 Ga0207659_10063448
691 Ga0207659_10103172
692 Ga0207659_10155128
693 Ga0207659_10553782
694 Ga0207687_10029653
695 Ga0207687_10173561
696 Ga0207700_10019361
697 Ga0207644_10057668
698 Ga0207644_10130932
699 Ga0207706_10007241
700 Ga0207706_10063626
701 Ga0207706_10411816
702 Ga0207686_10035749
703 Ga0207686_10173818
704 Ga0207709_10124211
705 Ga0207709_10279136
706 Ga0207669_10002494
707 Ga0207669_10063723
708 Ga0207669_10069981
709 Ga0207669_10076553
710 Ga0207669_10234939
711 Ga0207669_10238474
712 Ga0207704_10028021
713 Ga0207704_10073281
714 Ga0207691_10004382
715 Ga0207691_10023020
716 Ga0207691_10091086
717 Ga0207691_10152997
718 Ga0207711_10014552
719 Ga0207711_10041336
720 Ga0207711_10088780
721 Ga0207711_10166694
722 Ga0207711_10363631
723 Ga0207711_10377550
724 Ga0207711_10401063
725 Ga0207711_10696668
726 Ga0207711_10873764
727 Ga0207689_10005621
728 Ga0207689_10005732
729 Ga0207689_10009071
730 Ga0207689_10428273
731 Ga0207679_10009265
732 Ga0207679_10029780
733 Ga0207679_10335967
734 Ga0207651_10004045
735 Ga0207651_10017355
736 Ga0207651_10176014
737 Ga0207651_10223168
738 Ga0207651_10305005
739 Ga0207668_10084442
740 Ga0207668_10097605
741 Ga0207640_10448527
742 Ga0207658_10497804
743 Ga0207677_10056621
744 Ga0207677_10483913
745 Ga0207677_10756221
746 Ga0207703_10031552
747 Ga0207703_10149366
748 Ga0207703_10218523
749 Ga0207678_10075466
750 Ga0207678_10272591
751 Ga0207678_10903277
752 Ga0207708_10008494
753 Ga0207708_10108128
754 Ga0207641_10025507
755 Ga0207641_10131181
756 Ga0207641_10136553
757 Ga0207641_10481967
758 Ga0207648_10008274
759 Ga0207648_10040548
760 Ga0207648_10436958
761 Ga0207676_10242261
762 Ga0207674_10078625
763 Ga0207674_10209677
764 Ga0207674_10692594
765 Ga0207675_100091992
766 Ga0207675_100313055
767 Ga0207675_100883994
768 Ga0207683_10007178
769 Ga0207683_10044718
770 Ga0207683_10070625
771 Ga0207683_10186005
772 Ga0207683_10187064
773 Ga0207683_10385170
774 Ga0207683_10480092
775 Ga0207683_10480899
776 Ga0207683_10571528
777 Ga0207683_10640046
778 Ga0209971_1023251
779 Ga0209974_10111770
780 Ga0207428_10000205
781 Ga0207428_10004988
782 Ga0207428_10009581
783 Ga0207428_10012266
784 Ga0268266_10003995
785 Ga0268266_10080259
786 Ga0268266_10802743
787 Ga0268265_10070696
788 Ga0268265_10264925
789 Ga0268265_10272613
790 Ga0268265_10587709
791 Ga0307410_10295239
792 Ga0307416_100006131
793 Ga0373954_0214780
794 Ga0373937_0004076
795 Ga0373937_0214617
796 Ga0373925_0086484
797 Ga0373925_0505914
798 Ga0451798_0327949
799 Ga0439435_0004464
800 Ga0439435_0058004
801 Ga0453683_0041413
802 Ga0495603_0288841
803 Ga0495630_0266656
804 Ga0495640_0043633
805 Ga0495621_0057142
806 Ga0495656_0006093
807 Ga0495588_0375859
808 Ga0495624_0029878
809 Ga0495674_0081113
810 Ga0495676_0046798
811 Ga0495680_0004674
812 Ga0495684_0084754
813 Ga0495614_0104115
814 Ga0496100_0005342
815 Ga0496101_0005906
816 Ga0496102_0165369
817 Ga0496104_0030826
818 Ga0496104_0192183
819 Ga0496105_0382736
820 Ga0496106_0170034
821 Ga0496114_0000906
822 Ga0496115_0539151
823 Ga0501036_0132244
824 Ga0501039_0204854
825 Ga0501040_0508842
826 Ga0501041_0147370
827 Ga0501042_0409111
828 Ga0501043_0374853
829 Ga0501071_0343422
830 Ga0501075_0449175
831 nmdc:mga05p37_133545_c1
832 nmdc:mga05p37_463712_c1
833 nmdc:mga05p37_94320_c1
834 nmdc:mga09592_31939_c1
835 nmdc:mga09592_470439_c1
836 nmdc:mga09592_94210_c1
837 nmdc:mga0qj67_158303_c1
838 nmdc:mga0qj67_74219_c1
839 nmdc:mga06r32_17205_c1
840 nmdc:mga06r32_50982_c1
841 nmdc:mga06r32_59699_c1
842 nmdc:mga08y16_1077814_c1
843 nmdc:mga08y16_174844_c1
844 nmdc:mga08y16_229711_c1
845 nmdc:mga08y16_2750_c1
846 nmdc:mga08y16_322029_c1
847 nmdc:mga08y16_3_c1
848 nmdc:mga08y16_815151_c1
849 nmdc:mga08y16_92112_c1
850 nmdc:mga0n895_23117_c1
851 nmdc:mga0n895_502925_c1
852 nmdc:mga0rr50_498975_c1
853 nmdc:mga0a205_2758_c1
854 nmdc:mga0a205_48280_c1
855 nmdc:mga0a205_62045_c1
856 Ga0495619_0444370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tfy-assembly1.cif.gz_I the archaeal flagellum of methanospirillum hungatei strain jf1. 0.6988 78 204
7wjc-assembly1.cif.gz_A crystal structure of lactococcus lactis subsp. cremoris gh31 alpha-1,3-glucosidase mutant d394a in complex with nigerose 0.6983 43 88
7wj9-assembly1.cif.gz_A crystal structure of lactococcus lactis subsp. cremoris gh31 alpha-1,3-glucosidase, p21 space group 0.6964 43 88
5ljh-assembly1.cif.gz_A crystal structure of human apo crbp1/k40l mutant 0.6073 184 209
4eej-assembly2.cif.gz_B crystal structure of the q108k:k40l:t51v:t53c:y19w:r58w:t29l:q4r mutant of cellular retinol binding protein type ii in complex with all-trans-retinal at 1.5 angstrom resolution 0.6032 185 206
ID Description Score Start End Superfamily
af_Q6NYH1_303_554_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7556 44 66 2.130.10.10
af_I6XVW9_490_582_3.30.1120.10 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.659 43 66 3.30.1120.10
af_G5EEZ1_22_315_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.6579 43 68 2.130.10.30
3wovA03 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6403 71 209 2.60.40.3020
af_A0A0R4IZE2_263_647_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6271 44 68 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V8F6J6-F1-model_v4 Uncharacterized protein 0.8984 43 206
AF-A0A2U1S336-F1-model_v4 Uncharacterized protein 0.8601 44 206
AF-A0A7X9EFR6-F1-model_v4 DUF4412 domain-containing protein 0.8405 41 207
AF-A0A7Z1R471-F1-model_v4 Uncharacterized protein 0.8293 15 230
AF-A0A7Z1R4F7-F1-model_v4 DUF4352 domain-containing protein 0.8192 19 210

Map