F441779

General Info

Members Datasets Scaffolds Average Seq Length
428 296 856 326

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_169642_c1|nmdc:mga05p37_169642_c1_384_1439
Length 351
Sequence VKHLTVNEIAVRFGGRFATTGAIMLTRRSLIAGASLGCLLPSASRAAAQSYPTQTIRIIAGFPAGGGIDLVARLLAEPFKTMGQPVIVENRTGAAGMIAAQAVAKAPADGYMLLMATSGEIAISHHLYKEKMAYDPMGELAPVALVGIVPCVVVVAETTPVRTPQELIAYTKANPRKLSFSSSGVGNPQQLAGELMNIMAGTDVLHVPYRGAAPAVADVATGAVTMSFASLAAALPLIEAGKLRAVAVTSLERMPQLPDVAPLQEGAPGLKGYELLNWFGLFATGGTPASIIARLNGIANKTLQEPSTVALLMKQGIIPRPLSSAEYRSFVLSESEKFAKVIDQAKIKPEG

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
163 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
168 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
294 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.84
Nodule 0
Rhizoplane 5.61
Rhizosphere 88.32
Stem 0
Stem Tuber 0
Unclassified 3.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_169642_c1 3300050507 Bacteria 2662
2 ARSoilYngRDRAFT_c00285 3300000042 Bacteria 7442
3 ARSoilOldRDRAFT_c000264 3300000044 Bacteria 7510
4 ARCol0oldRDRAFT_c00257 3300000045 Bacteria 5037
5 ARCol0yngRDRAFT_1000034 3300000652 Bacteria 23733
6 JGI24737J22298_10006975 3300001990 Bacteria 3830
7 JGI25153J46596_10017951 3300003215 Bacteria 2766
8 JGI25405J52794_10009486 3300003911 Bacteria 1838
9 Ga0065712_10119657 3300005290 Unclassified 1676
10 Ga0065712_10147479 3300005290 Bacteria 1396
11 Ga0070658_10171637 3300005327 Bacteria 1822
12 Ga0070683_100150753 3300005329 Bacteria 2204
13 Ga0070670_100060496 3300005331 Bacteria 3252
14 Ga0070670_100069449 3300005331 Bacteria 3024
15 Ga0068869_100090317 3300005334 Bacteria 2302
16 Ga0070666_10069023 3300005335 Bacteria 2402
17 Ga0070682_100131093 3300005337 Bacteria 1697
18 Ga0068868_100016130 3300005338 Bacteria 5541
19 Ga0068868_100018747 3300005338 Bacteria 5176
20 Ga0070689_100100233 3300005340 Bacteria 2291
21 Ga0070689_100122745 3300005340 Bacteria 2076
22 Ga0070689_100130699 3300005340 Bacteria 2013
23 Ga0070689_100182635 3300005340 Bacteria 1704
24 Ga0070691_10068386 3300005341 Bacteria 1719
25 Ga0070687_100020324 3300005343 Bacteria 3103
26 Ga0070661_100057734 3300005344 Unclassified 2843
27 Ga0070668_100098185 3300005347 Bacteria 2317
28 Ga0070668_100120161 3300005347 Bacteria 2099
29 Ga0070669_100062445 3300005353 Bacteria 2739
30 Ga0070675_100005893 3300005354 Bacteria 9391
31 Ga0070675_100321264 3300005354 Bacteria 1367
32 Ga0070671_100020376 3300005355 Bacteria 5407
33 Ga0070671_100028755 3300005355 Bacteria 4580
34 Ga0070674_100019468 3300005356 Bacteria 4312
35 Ga0070673_100051440 3300005364 Bacteria 3227
36 Ga0070673_100213120 3300005364 Bacteria 1669
37 Ga0070673_100346280 3300005364 Bacteria 1318
38 Ga0070688_100027545 3300005365 Bacteria 3385
39 Ga0070688_100134455 3300005365 Bacteria 1672
40 Ga0070659_100013416 3300005366 Bacteria 6098
41 Ga0070667_100142143 3300005367 Bacteria 2102
42 Ga0070709_10227679 3300005434 Bacteria 1332
43 Ga0070714_100017605 3300005435 Bacteria 5791
44 Ga0070713_100013256 3300005436 Bacteria 6078
45 Ga0070701_10003764 3300005438 Bacteria 6059
46 Ga0070711_100032052 3300005439 Bacteria 3491
47 Ga0070705_100093428 3300005440 Bacteria 1880
48 Ga0070700_100072489 3300005441 Bacteria 2202
49 Ga0070694_100023686 3300005444 Bacteria 3952
50 Ga0070663_100051972 3300005455 Bacteria 2921
51 Ga0070663_100118789 3300005455 Bacteria 1995
52 Ga0070678_100029626 3300005456 Bacteria 3750
53 Ga0070678_100098242 3300005456 Unclassified 2263
54 Ga0070678_100233168 3300005456 Bacteria 1535
55 Ga0070662_100033115 3300005457 Bacteria 3637
56 Ga0070662_100036782 3300005457 Bacteria 3466
57 Ga0070681_10185725 3300005458 Bacteria 1999
58 Ga0068867_100099942 3300005459 Bacteria 2214
59 Ga0068867_100203119 3300005459 Bacteria 1587
60 Ga0070685_10102675 3300005466 Bacteria 1748
61 Ga0070698_100348680 3300005471 Bacteria 1412
62 Ga0070684_100073096 3300005535 Bacteria 3021
63 Ga0070684_100110312 3300005535 Unclassified 2467
64 Ga0070684_100115926 3300005535 Bacteria 2406
65 Ga0068853_100109769 3300005539 Bacteria 2449
66 Ga0070672_100033284 3300005543 Bacteria 3901
67 Ga0070672_100093386 3300005543 Bacteria 2430
68 Ga0070672_100215919 3300005543 Bacteria 1608
69 Ga0070686_100052086 3300005544 Bacteria 2608
70 Ga0070695_100054286 3300005545 Bacteria 2578
71 Ga0070696_100027672 3300005546 Bacteria 3865
72 Ga0070693_100005990 3300005547 Bacteria 5879
73 Ga0068855_100234512 3300005563 Bacteria 2052
74 Ga0068854_100012380 3300005578 Bacteria 5584
75 Ga0068852_100016330 3300005616 Bacteria 5784
76 Ga0068852_100084344 3300005616 Unclassified 2827
77 Ga0068852_100220692 3300005616 Bacteria 1803
78 Ga0068859_100032685 3300005617 Bacteria 5226
79 Ga0068859_100267766 3300005617 Bacteria 1800
80 Ga0068864_100009619 3300005618 Bacteria 7973
81 Ga0068851_10041029 3300005834 Unclassified 2327
82 Ga0068863_100017555 3300005841 Bacteria 6857
83 Ga0068860_100125617 3300005843 Bacteria 2458
84 Ga0068862_100004105 3300005844 Bacteria 12346
85 Ga0068862_100364750 3300005844 Bacteria 1343
86 Ga0081455_10000237 3300005937 Bacteria 71335
87 Ga0081455_10001351 3300005937 Bacteria 30344
88 Ga0081455_10052290 3300005937 Bacteria 3498
89 Ga0081455_10247152 3300005937 Bacteria 1307
90 Ga0081540_1020893 3300005983 Bacteria 3920
91 Ga0070717_10005794 3300006028 Bacteria 9047
92 Ga0075368_10020575 3300006042 Bacteria 2500
93 Ga0075368_10038160 3300006042 Bacteria 1880
94 Ga0075363_100206481 3300006048 Bacteria 1123
95 Ga0075432_10010154 3300006058 Bacteria 3195
96 Ga0070716_100021457 3300006173 Bacteria 3404
97 Ga0070712_100228021 3300006175 Bacteria 1478
98 Ga0075362_10040763 3300006177 Bacteria 2046
99 Ga0075367_10133343 3300006178 Bacteria 1536
100 Ga0075369_10006562 3300006186 Bacteria 4402
101 Ga0075366_10004543 3300006195 Bacteria 7451
102 Ga0075366_10035135 3300006195 Bacteria 2955
103 Ga0075366_10161833 3300006195 Bacteria 1356
104 Ga0097621_100043576 3300006237 Bacteria 3617
105 Ga0097621_100212909 3300006237 Unclassified 1681
106 Ga0075370_10085911 3300006353 Bacteria 1812
107 Ga0068871_100042547 3300006358 Bacteria 3647
108 Ga0068871_100117265 3300006358 Unclassified 2245
109 Ga0075428_100110485 3300006844 Bacteria 2995
110 Ga0075430_100012390 3300006846 Bacteria 7254
111 Ga0075430_100035210 3300006846 Bacteria 4248
112 Ga0075431_100000867 3300006847 Bacteria 26566
113 Ga0075433_10002474 3300006852 Bacteria 14058
114 Ga0075429_100104020 3300006880 Unclassified 2480
115 Ga0068865_100259282 3300006881 Bacteria 1376
116 Ga0075436_100049476 3300006914 Bacteria 2900
117 Ga0097620_100032683 3300006931 Bacteria 5226
118 Ga0097620_100267761 3300006931 Bacteria 1800
119 Ga0075435_100001554 3300007076 Bacteria 14808
120 Ga0075435_100228023 3300007076 Bacteria 1582
121 Ga0111539_10000527 3300009094 Bacteria 48473
122 Ga0111539_10041599 3300009094 Bacteria 5523
123 Ga0111539_10500503 3300009094 Bacteria 1415
124 Ga0105243_10024175 3300009148 Bacteria 4634
125 Ga0105243_10154188 3300009148 Bacteria 1974
126 Ga0105242_10047936 3300009176 Bacteria 3471
127 Ga0105248_10198202 3300009177 Bacteria 2262
128 Ga0105248_10305877 3300009177 Unclassified 1790
129 Ga0105238_10178760 3300009551 Bacteria 2099
130 Ga0157338_1000667 3300012515 Bacteria 2139
131 Ga0157371_10225769 3300013102 Bacteria 1345
132 Ga0157370_10172442 3300013104 Bacteria 2011
133 Ga0157378_10017615 3300013297 Bacteria 6272
134 Ga0163162_10290417 3300013306 Bacteria 1767
135 Ga0163162_10353784 3300013306 Bacteria 1601
136 Ga0157372_10259898 3300013307 Bacteria 2016
137 Ga0157375_10014198 3300013308 Bacteria 7101
138 Ga0157375_10285895 3300013308 Bacteria 1812
139 Ga0157375_10288650 3300013308 Bacteria 1803
140 Ga0157377_10114453 3300014745 Bacteria 1626
141 Ga0157376_10041195 3300014969 Bacteria 3780
142 Ga0157376_10057688 3300014969 Bacteria 3249
143 Ga0157376_10284898 3300014969 Bacteria 1558
144 Ga0157376_10304884 3300014969 Bacteria 1509
145 Ga0209758_1001345 3300025297 Bacteria 29653
146 Ga0207697_10003964 3300025315 Bacteria 7195
147 Ga0207697_10028758 3300025315 Bacteria 2274
148 Ga0207682_10002501 3300025893 Bacteria 8214
149 Ga0207642_10059976 3300025899 Bacteria 1762
150 Ga0207647_10007434 3300025904 Bacteria 7914
151 Ga0207645_10085090 3300025907 Bacteria 2030
152 Ga0207705_10015442 3300025909 Bacteria 5480
153 Ga0207705_10156684 3300025909 Unclassified 1709
154 Ga0207671_10141723 3300025914 Bacteria 1852
155 Ga0207693_10003392 3300025915 Bacteria 13609
156 Ga0207693_10027650 3300025915 Bacteria 4483
157 Ga0207693_10222523 3300025915 Bacteria 1483
158 Ga0207663_10236937 3300025916 Bacteria 1336
159 Ga0207662_10014496 3300025918 Bacteria 4426
160 Ga0207662_10029325 3300025918 Bacteria 3187
161 Ga0207657_10117781 3300025919 Bacteria 2187
162 Ga0207657_10160835 3300025919 Bacteria 1824
163 Ga0207649_10037611 3300025920 Bacteria 2924
164 Ga0207681_10055188 3300025923 Bacteria 2705
165 Ga0207694_10033312 3300025924 Bacteria 3947
166 Ga0207650_10009804 3300025925 Bacteria 6549
167 Ga0207700_10014221 3300025928 Bacteria 5208
168 Ga0207644_10322917 3300025931 Bacteria 1248
169 Ga0207706_10028808 3300025933 Bacteria 4957
170 Ga0207706_10129460 3300025933 Bacteria 2220
171 Ga0207709_10017396 3300025935 Bacteria 4013
172 Ga0207709_10191470 3300025935 Bacteria 1453
173 Ga0207670_10111499 3300025936 Bacteria 1972
174 Ga0207670_10120148 3300025936 Bacteria 1909
175 Ga0207669_10099760 3300025937 Bacteria 1916
176 Ga0207669_10202451 3300025937 Bacteria 1442
177 Ga0207704_10038754 3300025938 Bacteria 2768
178 Ga0207704_10177718 3300025938 Bacteria 1534
179 Ga0207665_10037188 3300025939 Bacteria 3240
180 Ga0207691_10051305 3300025940 Bacteria 3773
181 Ga0207691_10059595 3300025940 Bacteria 3471
182 Ga0207689_10052597 3300025942 Bacteria 3355
183 Ga0207661_10261020 3300025944 Bacteria 1543
184 Ga0207667_10030324 3300025949 Bacteria 5852
185 Ga0207651_10033358 3300025960 Bacteria 3320
186 Ga0207712_10034551 3300025961 Bacteria 3427
187 Ga0207668_10051772 3300025972 Bacteria 2838
188 Ga0207658_10222154 3300025986 Bacteria 1590
189 Ga0207703_10195159 3300026035 Bacteria 1796
190 Ga0207639_10280403 3300026041 Bacteria 1465
191 Ga0207678_10071677 3300026067 Bacteria 2971
192 Ga0207678_10350902 3300026067 Bacteria 1272
193 Ga0207708_10007296 3300026075 Bacteria 8176
194 Ga0207708_10025604 3300026075 Bacteria 4465
195 Ga0207708_10073052 3300026075 Bacteria 2629
196 Ga0207641_10022095 3300026088 Bacteria 5234
197 Ga0207648_10006078 3300026089 Bacteria 12038
198 Ga0207648_10042645 3300026089 Bacteria 3983
199 Ga0207676_10002995 3300026095 Bacteria 12043
200 Ga0207676_10335171 3300026095 Bacteria 1393
201 Ga0207674_10452450 3300026116 Bacteria 1241
202 Ga0207675_100056402 3300026118 Bacteria 3664
203 Ga0207675_100238279 3300026118 Bacteria 1757
204 Ga0207683_10017584 3300026121 Bacteria 6097
205 Ga0207683_10035623 3300026121 Bacteria 4329
206 Ga0207683_10196996 3300026121 Bacteria 1830
207 Ga0207698_10036923 3300026142 Bacteria 3593
208 Ga0207698_10204185 3300026142 Bacteria 1772
209 Ga0209966_1004215 3300027695 Bacteria 2434
210 Ga0209813_10051551 3300027866 Bacteria 1288
211 Ga0207428_10000124 3300027907 Bacteria 105795
212 Ga0207428_10051858 3300027907 Bacteria 3278
213 Ga0207428_10155601 3300027907 Bacteria 1739
214 Ga0268266_10035045 3300028379 Bacteria 4268
215 Ga0268265_10092111 3300028380 Bacteria 2425
216 Ga0268264_10061242 3300028381 Bacteria 3156
217 Ga0265318_10026005 3300028577 Bacteria 2307
218 Ga0265338_10068636 3300028800 Bacteria 3052
219 Ga0265328_10000361 3300031239 Bacteria 21322
220 Ga0265325_10031859 3300031241 Bacteria 2818
221 Ga0265329_10005351 3300031242 Bacteria 5198
222 Ga0265340_10106185 3300031247 Bacteria 1301
223 Ga0265339_10095748 3300031249 Bacteria 1550
224 Ga0265331_10001401 3300031250 Bacteria 17695
225 Ga0265314_10000660 3300031711 Bacteria 42242
226 Ga0265314_10011017 3300031711 Bacteria 7498
227 Ga0265342_10028016 3300031712 Bacteria 3514
228 Ga0307405_10061516 3300031731 Bacteria 2374
229 Ga0307410_10108980 3300031852 Bacteria 2001
230 Ga0307411_10261548 3300032005 Bacteria 1367
231 Ga0373948_0000067 3300034817 Bacteria 10961
232 Ga0373950_0003655 3300034818 Bacteria 2213
233 Ga0373958_0007611 3300034819 Bacteria 1733
234 Ga0373938_0008272 3300034957 Bacteria 1854
235 Ga0373938_0039911 3300034957 Bacteria 1039
236 Ga0373940_0032519 3300035088 Bacteria 1398
237 Ga0373940_0043313 3300035088 Bacteria 1243
238 Ga0373949_0002305 3300035090 Bacteria 4963
239 Ga0373951_0012281 3300035091 Bacteria 1926
240 Ga0373952_0002130 3300035092 Bacteria 3557
241 Ga0373939_0002156 3300035114 Bacteria 4673
242 Ga0373939_0003364 3300035114 Bacteria 3754
243 Ga0373945_0066499 3300035116 Bacteria 1355
244 Ga0373953_0014761 3300035117 Bacteria 2817
245 Ga0373956_0035272 3300035119 Bacteria 2205
246 Ga0373943_0049713 3300035170 Bacteria 2058
247 Ga0373946_0022178 3300035171 Bacteria 2469
248 Ga0373946_0132874 3300035171 Bacteria 1146
249 Ga0373955_0003754 3300035172 Bacteria 6690
250 Ga0373955_0049079 3300035172 Bacteria 2291
251 Ga0373955_0276675 3300035172 Bacteria 1009
252 Ga0373942_0008186 3300035207 Bacteria 2432
253 Ga0373961_0013511 3300035241 Bacteria 2060
254 Ga0373962_0053270 3300035242 Bacteria 1170
255 Ga0373924_0020807 3300035410 Bacteria 2553
256 Ga0373924_0025460 3300035410 Bacteria 2340
257 Ga0373931_0010301 3300035691 Bacteria 4492
258 Ga0373927_0033939 3300035695 Bacteria 3320
259 Ga0373933_0005164 3300035724 Bacteria 7124
260 Ga0373947_0008683 3300035725 Bacteria 5847
261 Ga0373947_0066480 3300035725 Bacteria 2200
262 Ga0373937_0003541 3300036401 Bacteria 13147
263 Ga0373925_0047557 3300037068 Bacteria 3193
264 Ga0373925_0069120 3300037068 Bacteria 2667
265 Ga0395901_0204857 3300038443 Bacteria 2067
266 Ga0436365_0539632 3300039437 Bacteria 5194
267 Ga0466963_0168532 3300044694 Bacteria 1526
268 Ga0466963_0202525 3300044694 Bacteria 1388
269 Ga0453684_0124335 3300044712 Bacteria 3108
270 Ga0451576_0169118 3300045051 Bacteria 2281
271 Ga0466967_0303391 3300045976 Bacteria 1537
272 Ga0495592_0044311 3300046454 Bacteria 3325
273 Ga0495629_0002798 3300046459 Bacteria 13303
274 Ga0495641_0041398 3300046461 Bacteria 2140
275 Ga0495653_0020398 3300046463 Bacteria 5373
276 Ga0495653_0125194 3300046463 Bacteria 1826
277 Ga0495653_0278359 3300046463 Bacteria 1099
278 Ga0495580_0018697 3300046472 Bacteria 5157
279 Ga0495580_0033333 3300046472 Bacteria 3713
280 Ga0495582_0004712 3300046473 Bacteria 7665
281 Ga0495582_0008539 3300046473 Bacteria 5650
282 Ga0495605_0084226 3300046474 Bacteria 1483
283 Ga0495639_0009233 3300046475 Bacteria 4226
284 Ga0495662_0080825 3300046476 Bacteria 1580
285 Ga0495664_0095002 3300046477 Bacteria 1795
286 Ga0495664_0174849 3300046477 Bacteria 1302
287 Ga0495584_0035673 3300046491 Bacteria 2513
288 Ga0495585_0102042 3300046492 Bacteria 1533
289 Ga0495594_0078828 3300046499 Bacteria 1838
290 Ga0495607_0016993 3300046501 Bacteria 4684
291 Ga0495608_0050938 3300046511 Bacteria 2746
292 Ga0495608_0094991 3300046511 Bacteria 1926
293 Ga0495608_0235416 3300046511 Bacteria 1145
294 Ga0495618_0027620 3300046514 Bacteria 3532
295 Ga0495644_0002123 3300046523 Bacteria 7962
296 Ga0495666_0121947 3300046526 Bacteria 1220
297 Ga0495652_0098495 3300046529 Bacteria 2376
298 Ga0495665_0038182 3300046531 Bacteria 2561
299 Ga0495586_0029557 3300046535 Bacteria 2933
300 Ga0495587_0041786 3300046536 Bacteria 2735
301 Ga0495609_0045393 3300046538 Bacteria 1969
302 Ga0495633_0002652 3300046558 Bacteria 12452
303 Ga0495667_0024120 3300046559 Bacteria 4097
304 Ga0495667_0029298 3300046559 Bacteria 3705
305 Ga0495667_0088929 3300046559 Bacteria 2002
306 Ga0495635_0014348 3300046663 Bacteria 5542
307 Ga0495659_0026784 3300046664 Bacteria 1984
308 Ga0495661_0169522 3300046665 Bacteria 1165
309 Ga0495588_0122918 3300046674 Bacteria 1368
310 Ga0495657_0046055 3300046675 Bacteria 2956
311 Ga0495599_0164619 3300046678 Bacteria 1370
312 Ga0495599_0208676 3300046678 Bacteria 1198
313 Ga0495646_0123031 3300046680 Bacteria 1466
314 Ga0495647_0009424 3300046681 Bacteria 3308
315 Ga0495647_0024115 3300046681 Bacteria 2212
316 Ga0495658_0006386 3300046683 Bacteria 5791
317 Ga0495658_0020154 3300046683 Bacteria 3495
318 Ga0495658_0054801 3300046683 Bacteria 2269
319 Ga0495669_0187839 3300046684 Unclassified 986
320 Ga0495613_0014073 3300046689 Bacteria 5937
321 Ga0495613_0191896 3300046689 Bacteria 1443
322 Ga0495624_0053942 3300046690 Bacteria 2536
323 Ga0495670_0010119 3300046691 Bacteria 4640
324 Ga0495589_0052958 3300046794 Bacteria 2004
325 Ga0495600_0048601 3300046809 Bacteria 2767
326 Ga0495581_0014878 3300047315 Bacteria 4513
327 Ga0495581_0057888 3300047315 Bacteria 2237
328 Ga0495604_0021498 3300047317 Bacteria 5150
329 Ga0495604_0025948 3300047317 Bacteria 4667
330 Ga0495674_0079861 3300047319 Bacteria 2808
331 Ga0495672_0098053 3300047320 Bacteria 1595
332 Ga0495676_0123641 3300047321 Bacteria 1878
333 Ga0495680_0045744 3300047322 Bacteria 3455
334 Ga0495680_0084895 3300047322 Bacteria 2385
335 Ga0495680_0203709 3300047322 Bacteria 1418
336 Ga0495675_0123956 3300047444 Bacteria 1608
337 Ga0495675_0184299 3300047444 Bacteria 1277
338 Ga0495684_0010102 3300047471 Bacteria 7299
339 Ga0495684_0104593 3300047471 Bacteria 2139
340 Ga0495593_0017106 3300047673 Bacteria 4081
341 Ga0495593_0042047 3300047673 Bacteria 2454
342 Ga0495602_0021227 3300048088 Bacteria 6399
343 Ga0495614_0052748 3300048089 Bacteria 1743
344 Ga0495614_0098049 3300048089 Bacteria 1279
345 Ga0496100_0090689 3300048903 Bacteria 2084
346 Ga0496101_0032508 3300048904 Bacteria 3673
347 Ga0496102_0009166 3300048905 Bacteria 8490
348 Ga0496102_0057309 3300048905 Bacteria 3557
349 Ga0496103_0006282 3300048906 Bacteria 7105
350 Ga0496104_0032399 3300048907 Bacteria 4863
351 Ga0496105_0000273 3300048908 Bacteria 34154
352 Ga0496106_0003237 3300048909 Bacteria 12179
353 Ga0496106_0199710 3300048909 Bacteria 1591
354 Ga0496108_0004160 3300048911 Bacteria 11644
355 Ga0496108_0030008 3300048911 Bacteria 4506
356 Ga0496108_0169592 3300048911 Bacteria 1888
357 Ga0496108_0194258 3300048911 Bacteria 1760
358 Ga0496109_0037927 3300048912 Bacteria 4355
359 Ga0496109_0454401 3300048912 Bacteria 1210
360 Ga0496110_0023381 3300048913 Bacteria 5255
361 Ga0496110_0025810 3300048913 Bacteria 5023
362 Ga0496110_0413532 3300048913 Bacteria 1230
363 Ga0496110_0416162 3300048913 Bacteria 1225
364 Ga0496111_0033398 3300048914 Bacteria 3669
365 Ga0496111_0241099 3300048914 Unclassified 1343
366 Ga0496112_0129405 3300048915 Bacteria 2495
367 Ga0496114_0002383 3300048917 Bacteria 14295
368 Ga0496115_0030762 3300048918 Bacteria 4225
369 Ga0501031_0025836 3300049568 Bacteria 3831
370 Ga0501034_0031045 3300049571 Bacteria 5430
371 Ga0501034_0125111 3300049571 Bacteria 2556
372 Ga0501037_0146791 3300049573 Bacteria 1687
373 Ga0501040_0135933 3300049576 Bacteria 1731
374 Ga0501041_0243729 3300049577 Bacteria 1130
375 Ga0501043_0278395 3300049579 Bacteria 1283
376 Ga0501046_0198646 3300049580 Bacteria 1493
377 Ga0501048_0098314 3300049582 Bacteria 2065
378 Ga0501069_0127900 3300049585 Bacteria 1454
379 Ga0501070_0126790 3300049586 Bacteria 2109
380 Ga0501071_0043511 3300049587 Bacteria 3220
381 Ga0501072_0022242 3300049588 Bacteria 4919
382 Ga0501075_0053040 3300049591 Bacteria 3049
383 Ga0501076_0128724 3300049592 Bacteria 2052
384 Ga0501079_0031368 3300049741 Bacteria 4084
385 Ga0501079_0213626 3300049741 Bacteria 1507
386 Ga0501080_0163044 3300049742 Bacteria 2058
387 Ga0501083_0016271 3300049744 Bacteria 5208
388 nmdc:mga03683_7614_c1 3300050489 Bacteria 3768
389 nmdc:mga03n38_65567_c1 3300050490 Bacteria 1666
390 nmdc:mga00v17_155243_c1 3300050491 Bacteria 1472
391 nmdc:mga00v17_83067_c1 3300050491 Bacteria 2003
392 nmdc:mga0yw44_22963_c1 3300050492 Bacteria 3508
393 nmdc:mga0k408_27479_c1 3300050493 Bacteria 3231
394 nmdc:mga0k408_8543_c1 3300050493 Bacteria 5501
395 nmdc:mga06z11_17923_c1 3300050494 Bacteria 3225
396 nmdc:mga05p37_110526_c1 3300050507 Bacteria 3381
397 nmdc:mga09592_116559_c1 3300050508 Bacteria 2292
398 nmdc:mga09592_233932_c1 3300050508 Bacteria 1592
399 nmdc:mga0qj67_20671_c1 3300050509 Bacteria 5042
400 nmdc:mga0qj67_75504_c1 3300050509 Bacteria 2694
401 nmdc:mga06r32_3769_c1 3300050510 Bacteria 13556
402 nmdc:mga06r32_47526_c1 3300050510 Bacteria 4099
403 nmdc:mga08y16_1374_c1 3300050511 Bacteria 24321
404 nmdc:mga08y16_20573_c1 3300050511 Bacteria 6966
405 nmdc:mga08y16_332241_c1 3300050511 Bacteria 1563
406 nmdc:mga0n895_27254_c1 3300050512 Bacteria 5426
407 nmdc:mga0n895_39699_c1 3300050512 Bacteria 4569
408 nmdc:mga0n895_50774_c1 3300050512 Bacteria 4067
409 nmdc:mga0rr50_4570_c1 3300050513 Bacteria 8146
410 nmdc:mga08x19_60760_c1 3300050514 Bacteria 2448
411 nmdc:mga0a205_1626_c1 3300050515 Bacteria 19318
412 nmdc:mga0sz30_25307_c1 3300050516 Bacteria 2427
413 Ga0495601_0002091 3300053077 Bacteria 11219
414 Ga0495601_0004000 3300053077 Bacteria 8485
415 Ga0495601_0044778 3300053077 Bacteria 2781
416 Ga0495612_0087303 3300053078 Bacteria 1316
417 Ga0495595_0000789 3300053084 Bacteria 12046
418 Ga0495595_0002304 3300053084 Bacteria 7440
419 Ga0495595_0108788 3300053084 Bacteria 1342
420 Ga0495619_0000105 3300053085 Bacteria 62599
421 Ga0495619_0011261 3300053085 Bacteria 5625
422 Ga0495619_0017872 3300053085 Bacteria 4494
423 Ga0500641_0013260 3300053096 Bacteria 3026
424 Ga0500641_0030710 3300053096 Bacteria 2114
425 Ga0500604_0006621 3300053151 Bacteria 3063
426 Ga0501082_0085455 3300060353 Bacteria 2721
427 Ga0501082_0156110 3300060353 Bacteria 1983
428 Ga0530510_0057151 3300061734 Bacteria 2819
429 nmdc:mga05p37_169642_c1
430 ARSoilYngRDRAFT_c00285
431 ARSoilOldRDRAFT_c000264
432 ARCol0oldRDRAFT_c00257
433 ARCol0yngRDRAFT_1000034
434 JGI24737J22298_10006975
435 JGI25153J46596_10017951
436 JGI25405J52794_10009486
437 Ga0065712_10119657
438 Ga0065712_10147479
439 Ga0070658_10171637
440 Ga0070683_100150753
441 Ga0070670_100060496
442 Ga0070670_100069449
443 Ga0068869_100090317
444 Ga0070666_10069023
445 Ga0070682_100131093
446 Ga0068868_100016130
447 Ga0068868_100018747
448 Ga0070689_100100233
449 Ga0070689_100122745
450 Ga0070689_100130699
451 Ga0070689_100182635
452 Ga0070691_10068386
453 Ga0070687_100020324
454 Ga0070661_100057734
455 Ga0070668_100098185
456 Ga0070668_100120161
457 Ga0070669_100062445
458 Ga0070675_100005893
459 Ga0070675_100321264
460 Ga0070671_100020376
461 Ga0070671_100028755
462 Ga0070674_100019468
463 Ga0070673_100051440
464 Ga0070673_100213120
465 Ga0070673_100346280
466 Ga0070688_100027545
467 Ga0070688_100134455
468 Ga0070659_100013416
469 Ga0070667_100142143
470 Ga0070709_10227679
471 Ga0070714_100017605
472 Ga0070713_100013256
473 Ga0070701_10003764
474 Ga0070711_100032052
475 Ga0070705_100093428
476 Ga0070700_100072489
477 Ga0070694_100023686
478 Ga0070663_100051972
479 Ga0070663_100118789
480 Ga0070678_100029626
481 Ga0070678_100098242
482 Ga0070678_100233168
483 Ga0070662_100033115
484 Ga0070662_100036782
485 Ga0070681_10185725
486 Ga0068867_100099942
487 Ga0068867_100203119
488 Ga0070685_10102675
489 Ga0070698_100348680
490 Ga0070684_100073096
491 Ga0070684_100110312
492 Ga0070684_100115926
493 Ga0068853_100109769
494 Ga0070672_100033284
495 Ga0070672_100093386
496 Ga0070672_100215919
497 Ga0070686_100052086
498 Ga0070695_100054286
499 Ga0070696_100027672
500 Ga0070693_100005990
501 Ga0068855_100234512
502 Ga0068854_100012380
503 Ga0068852_100016330
504 Ga0068852_100084344
505 Ga0068852_100220692
506 Ga0068859_100032685
507 Ga0068859_100267766
508 Ga0068864_100009619
509 Ga0068851_10041029
510 Ga0068863_100017555
511 Ga0068860_100125617
512 Ga0068862_100004105
513 Ga0068862_100364750
514 Ga0081455_10000237
515 Ga0081455_10001351
516 Ga0081455_10052290
517 Ga0081455_10247152
518 Ga0081540_1020893
519 Ga0070717_10005794
520 Ga0075368_10020575
521 Ga0075368_10038160
522 Ga0075363_100206481
523 Ga0075432_10010154
524 Ga0070716_100021457
525 Ga0070712_100228021
526 Ga0075362_10040763
527 Ga0075367_10133343
528 Ga0075369_10006562
529 Ga0075366_10004543
530 Ga0075366_10035135
531 Ga0075366_10161833
532 Ga0097621_100043576
533 Ga0097621_100212909
534 Ga0075370_10085911
535 Ga0068871_100042547
536 Ga0068871_100117265
537 Ga0075428_100110485
538 Ga0075430_100012390
539 Ga0075430_100035210
540 Ga0075431_100000867
541 Ga0075433_10002474
542 Ga0075429_100104020
543 Ga0068865_100259282
544 Ga0075436_100049476
545 Ga0097620_100032683
546 Ga0097620_100267761
547 Ga0075435_100001554
548 Ga0075435_100228023
549 Ga0111539_10000527
550 Ga0111539_10041599
551 Ga0111539_10500503
552 Ga0105243_10024175
553 Ga0105243_10154188
554 Ga0105242_10047936
555 Ga0105248_10198202
556 Ga0105248_10305877
557 Ga0105238_10178760
558 Ga0157338_1000667
559 Ga0157371_10225769
560 Ga0157370_10172442
561 Ga0157378_10017615
562 Ga0163162_10290417
563 Ga0163162_10353784
564 Ga0157372_10259898
565 Ga0157375_10014198
566 Ga0157375_10285895
567 Ga0157375_10288650
568 Ga0157377_10114453
569 Ga0157376_10041195
570 Ga0157376_10057688
571 Ga0157376_10284898
572 Ga0157376_10304884
573 Ga0209758_1001345
574 Ga0207697_10003964
575 Ga0207697_10028758
576 Ga0207682_10002501
577 Ga0207642_10059976
578 Ga0207647_10007434
579 Ga0207645_10085090
580 Ga0207705_10015442
581 Ga0207705_10156684
582 Ga0207671_10141723
583 Ga0207693_10003392
584 Ga0207693_10027650
585 Ga0207693_10222523
586 Ga0207663_10236937
587 Ga0207662_10014496
588 Ga0207662_10029325
589 Ga0207657_10117781
590 Ga0207657_10160835
591 Ga0207649_10037611
592 Ga0207681_10055188
593 Ga0207694_10033312
594 Ga0207650_10009804
595 Ga0207700_10014221
596 Ga0207644_10322917
597 Ga0207706_10028808
598 Ga0207706_10129460
599 Ga0207709_10017396
600 Ga0207709_10191470
601 Ga0207670_10111499
602 Ga0207670_10120148
603 Ga0207669_10099760
604 Ga0207669_10202451
605 Ga0207704_10038754
606 Ga0207704_10177718
607 Ga0207665_10037188
608 Ga0207691_10051305
609 Ga0207691_10059595
610 Ga0207689_10052597
611 Ga0207661_10261020
612 Ga0207667_10030324
613 Ga0207651_10033358
614 Ga0207712_10034551
615 Ga0207668_10051772
616 Ga0207658_10222154
617 Ga0207703_10195159
618 Ga0207639_10280403
619 Ga0207678_10071677
620 Ga0207678_10350902
621 Ga0207708_10007296
622 Ga0207708_10025604
623 Ga0207708_10073052
624 Ga0207641_10022095
625 Ga0207648_10006078
626 Ga0207648_10042645
627 Ga0207676_10002995
628 Ga0207676_10335171
629 Ga0207674_10452450
630 Ga0207675_100056402
631 Ga0207675_100238279
632 Ga0207683_10017584
633 Ga0207683_10035623
634 Ga0207683_10196996
635 Ga0207698_10036923
636 Ga0207698_10204185
637 Ga0209966_1004215
638 Ga0209813_10051551
639 Ga0207428_10000124
640 Ga0207428_10051858
641 Ga0207428_10155601
642 Ga0268266_10035045
643 Ga0268265_10092111
644 Ga0268264_10061242
645 Ga0265318_10026005
646 Ga0265338_10068636
647 Ga0265328_10000361
648 Ga0265325_10031859
649 Ga0265329_10005351
650 Ga0265340_10106185
651 Ga0265339_10095748
652 Ga0265331_10001401
653 Ga0265314_10000660
654 Ga0265314_10011017
655 Ga0265342_10028016
656 Ga0307405_10061516
657 Ga0307410_10108980
658 Ga0307411_10261548
659 Ga0373948_0000067
660 Ga0373950_0003655
661 Ga0373958_0007611
662 Ga0373938_0008272
663 Ga0373938_0039911
664 Ga0373940_0032519
665 Ga0373940_0043313
666 Ga0373949_0002305
667 Ga0373951_0012281
668 Ga0373952_0002130
669 Ga0373939_0002156
670 Ga0373939_0003364
671 Ga0373945_0066499
672 Ga0373953_0014761
673 Ga0373956_0035272
674 Ga0373943_0049713
675 Ga0373946_0022178
676 Ga0373946_0132874
677 Ga0373955_0003754
678 Ga0373955_0049079
679 Ga0373955_0276675
680 Ga0373942_0008186
681 Ga0373961_0013511
682 Ga0373962_0053270
683 Ga0373924_0020807
684 Ga0373924_0025460
685 Ga0373931_0010301
686 Ga0373927_0033939
687 Ga0373933_0005164
688 Ga0373947_0008683
689 Ga0373947_0066480
690 Ga0373937_0003541
691 Ga0373925_0047557
692 Ga0373925_0069120
693 Ga0395901_0204857
694 Ga0436365_0539632
695 Ga0466963_0168532
696 Ga0466963_0202525
697 Ga0453684_0124335
698 Ga0451576_0169118
699 Ga0466967_0303391
700 Ga0495592_0044311
701 Ga0495629_0002798
702 Ga0495641_0041398
703 Ga0495653_0020398
704 Ga0495653_0125194
705 Ga0495653_0278359
706 Ga0495580_0018697
707 Ga0495580_0033333
708 Ga0495582_0004712
709 Ga0495582_0008539
710 Ga0495605_0084226
711 Ga0495639_0009233
712 Ga0495662_0080825
713 Ga0495664_0095002
714 Ga0495664_0174849
715 Ga0495584_0035673
716 Ga0495585_0102042
717 Ga0495594_0078828
718 Ga0495607_0016993
719 Ga0495608_0050938
720 Ga0495608_0094991
721 Ga0495608_0235416
722 Ga0495618_0027620
723 Ga0495644_0002123
724 Ga0495666_0121947
725 Ga0495652_0098495
726 Ga0495665_0038182
727 Ga0495586_0029557
728 Ga0495587_0041786
729 Ga0495609_0045393
730 Ga0495633_0002652
731 Ga0495667_0024120
732 Ga0495667_0029298
733 Ga0495667_0088929
734 Ga0495635_0014348
735 Ga0495659_0026784
736 Ga0495661_0169522
737 Ga0495588_0122918
738 Ga0495657_0046055
739 Ga0495599_0164619
740 Ga0495599_0208676
741 Ga0495646_0123031
742 Ga0495647_0009424
743 Ga0495647_0024115
744 Ga0495658_0006386
745 Ga0495658_0020154
746 Ga0495658_0054801
747 Ga0495669_0187839
748 Ga0495613_0014073
749 Ga0495613_0191896
750 Ga0495624_0053942
751 Ga0495670_0010119
752 Ga0495589_0052958
753 Ga0495600_0048601
754 Ga0495581_0014878
755 Ga0495581_0057888
756 Ga0495604_0021498
757 Ga0495604_0025948
758 Ga0495674_0079861
759 Ga0495672_0098053
760 Ga0495676_0123641
761 Ga0495680_0045744
762 Ga0495680_0084895
763 Ga0495680_0203709
764 Ga0495675_0123956
765 Ga0495675_0184299
766 Ga0495684_0010102
767 Ga0495684_0104593
768 Ga0495593_0017106
769 Ga0495593_0042047
770 Ga0495602_0021227
771 Ga0495614_0052748
772 Ga0495614_0098049
773 Ga0496100_0090689
774 Ga0496101_0032508
775 Ga0496102_0009166
776 Ga0496102_0057309
777 Ga0496103_0006282
778 Ga0496104_0032399
779 Ga0496105_0000273
780 Ga0496106_0003237
781 Ga0496106_0199710
782 Ga0496108_0004160
783 Ga0496108_0030008
784 Ga0496108_0169592
785 Ga0496108_0194258
786 Ga0496109_0037927
787 Ga0496109_0454401
788 Ga0496110_0023381
789 Ga0496110_0025810
790 Ga0496110_0413532
791 Ga0496110_0416162
792 Ga0496111_0033398
793 Ga0496111_0241099
794 Ga0496112_0129405
795 Ga0496114_0002383
796 Ga0496115_0030762
797 Ga0501031_0025836
798 Ga0501034_0031045
799 Ga0501034_0125111
800 Ga0501037_0146791
801 Ga0501040_0135933
802 Ga0501041_0243729
803 Ga0501043_0278395
804 Ga0501046_0198646
805 Ga0501048_0098314
806 Ga0501069_0127900
807 Ga0501070_0126790
808 Ga0501071_0043511
809 Ga0501072_0022242
810 Ga0501075_0053040
811 Ga0501076_0128724
812 Ga0501079_0031368
813 Ga0501079_0213626
814 Ga0501080_0163044
815 Ga0501083_0016271
816 nmdc:mga03683_7614_c1
817 nmdc:mga03n38_65567_c1
818 nmdc:mga00v17_155243_c1
819 nmdc:mga00v17_83067_c1
820 nmdc:mga0yw44_22963_c1
821 nmdc:mga0k408_27479_c1
822 nmdc:mga0k408_8543_c1
823 nmdc:mga06z11_17923_c1
824 nmdc:mga05p37_110526_c1
825 nmdc:mga09592_116559_c1
826 nmdc:mga09592_233932_c1
827 nmdc:mga0qj67_20671_c1
828 nmdc:mga0qj67_75504_c1
829 nmdc:mga06r32_3769_c1
830 nmdc:mga06r32_47526_c1
831 nmdc:mga08y16_1374_c1
832 nmdc:mga08y16_20573_c1
833 nmdc:mga08y16_332241_c1
834 nmdc:mga0n895_27254_c1
835 nmdc:mga0n895_39699_c1
836 nmdc:mga0n895_50774_c1
837 nmdc:mga0rr50_4570_c1
838 nmdc:mga08x19_60760_c1
839 nmdc:mga0a205_1626_c1
840 nmdc:mga0sz30_25307_c1
841 Ga0495601_0002091
842 Ga0495601_0004000
843 Ga0495601_0044778
844 Ga0495612_0087303
845 Ga0495595_0000789
846 Ga0495595_0002304
847 Ga0495595_0108788
848 Ga0495619_0000105
849 Ga0495619_0011261
850 Ga0495619_0017872
851 Ga0500641_0013260
852 Ga0500641_0030710
853 Ga0500604_0006621
854 Ga0501082_0085455
855 Ga0501082_0156110
856 Ga0530510_0057151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

71

347

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9551 31 328
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9479 29 328
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9457 31 328
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9416 29 328
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9398 32 326
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9249 130 244 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9159 29 328 3.40.190.150
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9133 130 254 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9102 29 328 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9056 29 328 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A3A3FMR4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9661 47 328
AF-A0A536SFT4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9654 57 328
AF-A0A853GVT4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9649 38 328
AF-A0A536SS29-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9649 37 328
AF-A0A2L1CQM3-F1-model_v4 deleted 0.9624 57 328

Map