F441767

General Info

Members Datasets Scaffolds Average Seq Length
428 261 856 165

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0220074|Ga0501034_0220074_834_1337
Length 167
Sequence MIEMISNGAARDAVLIGVGATALLDLYGVTRGWLTGAAMPDYGPVGRWLLHMPRGQFFHDAISRSAPVTGERAIGWGAHYLIGIGFATVLLAVWPDFARAPALIPALIVGIGSVAAPFLLMQPGMGAGFFASRTPNPRAARLRSLTTHTVFGLGLYAAGWLLRAFAF

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
163 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
230 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
231 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
232 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
233 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
234 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
235 2643221618 Ensifer sp. Root231 Isolate Unclassified
236 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
237 2643221626 Ensifer sp. Root31 Isolate Unclassified
238 2643221655 Ensifer sp. Root1252 Isolate Unclassified
239 2643221659 Ensifer sp. Root127 Isolate Unclassified
240 2643221698 Ensifer sp. Root142 Isolate Unclassified
241 2643221712 Ensifer sp. Root258 Isolate Unclassified
242 2844163670 Ensifer sp. 1H6 Isolate Unclassified
243 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
244 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
245 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
246 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
247 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
248 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
249 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
250 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
251 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
252 2929520902 Variovorax beijingensis 502 Isolate Unclassified
253 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
254 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
255 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
256 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
257 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
258 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
259 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
260 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
261 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.29
Metatranscriptomes 0
Isolates 7.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 4.21
Rhizoplane 4.21
Rhizosphere 85.98
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0220074 3300049571 Bacteria 1851
2 MRS1b_contig_1080631 2162886011 Unclassified 1228
3 Ga0070676_10068313 3300005328 Bacteria 2127
4 Ga0070676_10093865 3300005328 Bacteria 1843
5 Ga0070683_100966506 3300005329 Bacteria 817
6 Ga0070690_100007037 3300005330 Bacteria 6415
7 Ga0070690_100191645 3300005330 Bacteria 1417
8 Ga0070690_100244327 3300005330 Bacteria 1267
9 Ga0070670_100080420 3300005331 Bacteria 2801
10 Ga0068869_100006244 3300005334 Bacteria 7546
11 Ga0068869_100102495 3300005334 Bacteria 2167
12 Ga0070666_10193381 3300005335 Bacteria 1430
13 Ga0070680_100065123 3300005336 Bacteria 2987
14 Ga0070689_100003381 3300005340 Bacteria 10603
15 Ga0070689_100071380 3300005340 Bacteria 2712
16 Ga0070689_100097224 3300005340 Bacteria 2328
17 Ga0070687_100021236 3300005343 Bacteria 3047
18 Ga0070661_100001889 3300005344 Bacteria 14506
19 Ga0070692_10176161 3300005345 Bacteria 1236
20 Ga0070692_10303588 3300005345 Bacteria 975
21 Ga0070668_100214983 3300005347 Bacteria 1583
22 Ga0070669_100004210 3300005353 Bacteria 10406
23 Ga0070669_100026374 3300005353 Bacteria 4181
24 Ga0070669_100136103 3300005353 Bacteria 1890
25 Ga0070669_100232801 3300005353 Bacteria 1461
26 Ga0070669_100784435 3300005353 Bacteria 809
27 Ga0070675_100000538 3300005354 Bacteria 25937
28 Ga0070675_100016707 3300005354 Bacteria 5825
29 Ga0070675_100470162 3300005354 Bacteria 1130
30 Ga0070671_100001013 3300005355 Bacteria 20643
31 Ga0070674_100092901 3300005356 Bacteria 2182
32 Ga0070673_100004928 3300005364 Bacteria 8501
33 Ga0070673_100056677 3300005364 Bacteria 3093
34 Ga0070673_100119371 3300005364 Bacteria 2197
35 Ga0070688_100002650 3300005365 Bacteria 9079
36 Ga0070688_100084579 3300005365 Bacteria 2061
37 Ga0070659_100044737 3300005366 Bacteria 3467
38 Ga0070667_100244839 3300005367 Bacteria 1602
39 Ga0070714_100143320 3300005435 Bacteria 2147
40 Ga0070701_10015880 3300005438 Bacteria 3488
41 Ga0070701_10559928 3300005438 Bacteria 751
42 Ga0070701_11017714 3300005438 Bacteria 579
43 Ga0070705_100179181 3300005440 Bacteria 1434
44 Ga0070700_100002123 3300005441 Bacteria 10059
45 Ga0070700_100028968 3300005441 Bacteria 3298
46 Ga0070700_100048937 3300005441 Bacteria 2622
47 Ga0070700_100695200 3300005441 Bacteria 808
48 Ga0070700_101074723 3300005441 Bacteria 666
49 Ga0070678_100045232 3300005456 Bacteria 3148
50 Ga0070678_100463688 3300005456 Bacteria 1112
51 Ga0070678_101311728 3300005456 Bacteria 674
52 Ga0070662_100000213 3300005457 Bacteria 33995
53 Ga0070662_100189845 3300005457 Bacteria 1624
54 Ga0070681_10076846 3300005458 Bacteria 3297
55 Ga0068867_100002614 3300005459 Bacteria 12702
56 Ga0068867_100003902 3300005459 Bacteria 10493
57 Ga0070685_10119323 3300005466 Bacteria 1636
58 Ga0070679_100207228 3300005530 Bacteria 1925
59 Ga0070684_101286023 3300005535 Bacteria 688
60 Ga0068853_100015192 3300005539 Bacteria 6330
61 Ga0068853_101497713 3300005539 Bacteria 653
62 Ga0070672_100032262 3300005543 Bacteria 3951
63 Ga0070672_100035448 3300005543 Bacteria 3793
64 Ga0070686_100024085 3300005544 Bacteria 3646
65 Ga0070686_101218896 3300005544 Bacteria 626
66 Ga0070696_100044522 3300005546 Bacteria 3073
67 Ga0070696_100162122 3300005546 Bacteria 1648
68 Ga0070693_100242167 3300005547 Bacteria 1192
69 Ga0070665_100425432 3300005548 Bacteria 1337
70 Ga0070704_100087951 3300005549 Bacteria 2307
71 Ga0068855_100000606 3300005563 Bacteria 43933
72 Ga0070664_100002489 3300005564 Bacteria 14844
73 Ga0070664_100063116 3300005564 Bacteria 3159
74 Ga0068857_100032535 3300005577 Bacteria 4612
75 Ga0068857_100080553 3300005577 Bacteria 2907
76 Ga0068857_100999810 3300005577 Bacteria 805
77 Ga0068854_100520002 3300005578 Bacteria 1005
78 Ga0070702_100000591 3300005615 Bacteria 13287
79 Ga0070702_100052632 3300005615 Bacteria 2335
80 Ga0070702_100799817 3300005615 Bacteria 729
81 Ga0068852_100014245 3300005616 Bacteria 6112
82 Ga0068852_100034033 3300005616 Bacteria 4238
83 Ga0068859_100002228 3300005617 Bacteria 19655
84 Ga0068859_100208522 3300005617 Bacteria 2040
85 Ga0068859_101828685 3300005617 Bacteria 671
86 Ga0068864_100005162 3300005618 Bacteria 10698
87 Ga0068864_100045567 3300005618 Bacteria 3762
88 Ga0068866_10025147 3300005718 Bacteria 2796
89 Ga0068861_100004297 3300005719 Bacteria 9557
90 Ga0068861_100123846 3300005719 Bacteria 2089
91 Ga0068861_100228649 3300005719 Bacteria 1576
92 Ga0068861_100254836 3300005719 Bacteria 1499
93 Ga0068870_10046266 3300005840 Bacteria 2281
94 Ga0068870_10051076 3300005840 Bacteria 2188
95 Ga0068870_10470191 3300005840 Bacteria 832
96 Ga0068863_100003541 3300005841 Bacteria 15409
97 Ga0068858_100027705 3300005842 Bacteria 5265
98 Ga0068858_100119726 3300005842 Bacteria 2461
99 Ga0068858_100298262 3300005842 Bacteria 1537
100 Ga0068860_100008758 3300005843 Bacteria 10078
101 Ga0068862_100004600 3300005844 Bacteria 11628
102 Ga0068862_100005105 3300005844 Bacteria 11036
103 Ga0068862_100109847 3300005844 Bacteria 2419
104 Ga0081540_1000273 3300005983 Bacteria 53925
105 Ga0070715_10077305 3300006163 Bacteria 1502
106 Ga0070712_100032765 3300006175 Bacteria 3511
107 Ga0075367_10107942 3300006178 Bacteria 1706
108 Ga0097621_100234026 3300006237 Bacteria 1604
109 Ga0097621_100234958 3300006237 Bacteria 1601
110 Ga0075370_10280027 3300006353 Bacteria 990
111 Ga0068871_100009293 3300006358 Bacteria 7114
112 Ga0068871_100055263 3300006358 Bacteria 3223
113 Ga0075430_100269581 3300006846 Bacteria 1409
114 Ga0075431_100188491 3300006847 Bacteria 2114
115 Ga0075433_10014216 3300006852 Bacteria 6498
116 Ga0075434_100012325 3300006871 Bacteria 8100
117 Ga0068865_100001819 3300006881 Bacteria 12528
118 Ga0068865_100010575 3300006881 Bacteria 5749
119 Ga0075436_100002901 3300006914 Bacteria 11763
120 Ga0097620_100002228 3300006931 Bacteria 19655
121 Ga0097620_100208521 3300006931 Bacteria 2040
122 Ga0097620_101828789 3300006931 Bacteria 671
123 Ga0075435_100001479 3300007076 Bacteria 15094
124 Ga0111539_10043548 3300009094 Bacteria 5380
125 Ga0111539_10091205 3300009094 Bacteria 3580
126 Ga0111539_10589080 3300009094 Bacteria 1295
127 Ga0111539_10834493 3300009094 Bacteria 1072
128 Ga0105243_10002935 3300009148 Bacteria 14105
129 Ga0105241_10278022 3300009174 Bacteria 1429
130 Ga0105248_10002042 3300009177 Bacteria 22370
131 Ga0105248_10227693 3300009177 Bacteria 2099
132 Ga0105237_11566860 3300009545 Bacteria 666
133 Ga0105249_10004816 3300009553 Bacteria 11645
134 Ga0105249_10028823 3300009553 Bacteria 5011
135 Ga0105239_10014618 3300010375 Bacteria 8709
136 Ga0157373_10004556 3300013100 Bacteria 10421
137 Ga0157371_10001833 3300013102 Bacteria 21422
138 Ga0157371_10796442 3300013102 Bacteria 712
139 Ga0157370_10241525 3300013104 Bacteria 1671
140 Ga0157369_10098596 3300013105 Bacteria 3115
141 Ga0157374_10346495 3300013296 Bacteria 1475
142 Ga0157378_10019378 3300013297 Bacteria 5981
143 Ga0157378_10904245 3300013297 Bacteria 914
144 Ga0163162_10005810 3300013306 Bacteria 11939
145 Ga0163162_10645176 3300013306 Bacteria 1183
146 Ga0157372_10017245 3300013307 Bacteria 7751
147 Ga0157372_11477807 3300013307 Bacteria 783
148 Ga0157375_10026603 3300013308 Bacteria 5395
149 Ga0157375_10080009 3300013308 Bacteria 3305
150 Ga0157375_10434538 3300013308 Bacteria 1479
151 Ga0163163_10004627 3300014325 Bacteria 11753
152 Ga0157380_10222452 3300014326 Bacteria 1690
153 Ga0157380_11718233 3300014326 Bacteria 685
154 Ga0157377_10001488 3300014745 Bacteria 10142
155 Ga0157377_10038948 3300014745 Bacteria 2628
156 Ga0157379_10436920 3300014968 Bacteria 1207
157 Ga0157379_10447535 3300014968 Bacteria 1192
158 Ga0157376_10224213 3300014969 Bacteria 1743
159 Ga0207682_10231107 3300025893 Bacteria 857
160 Ga0207642_10061476 3300025899 Bacteria 1747
161 Ga0207680_10226897 3300025903 Bacteria 1282
162 Ga0207685_10105961 3300025905 Bacteria 1210
163 Ga0207643_10014208 3300025908 Bacteria 4323
164 Ga0207643_10016202 3300025908 Bacteria 4064
165 Ga0207643_10044964 3300025908 Bacteria 2493
166 Ga0207643_10489495 3300025908 Bacteria 786
167 Ga0207693_10122599 3300025915 Bacteria 2042
168 Ga0207660_10098938 3300025917 Bacteria 2176
169 Ga0207662_10026221 3300025918 Bacteria 3360
170 Ga0207662_10052334 3300025918 Bacteria 2430
171 Ga0207657_10001097 3300025919 Bacteria 28742
172 Ga0207649_10004492 3300025920 Bacteria 7566
173 Ga0207649_10293983 3300025920 Bacteria 1185
174 Ga0207652_10429814 3300025921 Unclassified 1191
175 Ga0207681_10001355 3300025923 Bacteria 15822
176 Ga0207681_10046814 3300025923 Bacteria 2910
177 Ga0207681_10254963 3300025923 Bacteria 1371
178 Ga0207681_10412823 3300025923 Bacteria 1092
179 Ga0207650_10082254 3300025925 Bacteria 2444
180 Ga0207659_10023733 3300025926 Bacteria 4098
181 Ga0207659_10400390 3300025926 Bacteria 1148
182 Ga0207644_10011865 3300025931 Bacteria 5774
183 Ga0207644_10074617 3300025931 Bacteria 2490
184 Ga0207690_10000661 3300025932 Bacteria 22057
185 Ga0207690_10717687 3300025932 Unclassified 823
186 Ga0207706_10000040 3300025933 Bacteria 132285
187 Ga0207706_10323197 3300025933 Bacteria 1343
188 Ga0207709_10689494 3300025935 Bacteria 816
189 Ga0207670_10013203 3300025936 Bacteria 4861
190 Ga0207670_10017224 3300025936 Bacteria 4364
191 Ga0207670_10031787 3300025936 Bacteria 3387
192 Ga0207704_10006461 3300025938 Bacteria 5469
193 Ga0207704_10604334 3300025938 Bacteria 898
194 Ga0207691_10050439 3300025940 Bacteria 3810
195 Ga0207691_10093912 3300025940 Bacteria 2685
196 Ga0207711_10012838 3300025941 Bacteria 6960
197 Ga0207711_10334998 3300025941 Bacteria 1400
198 Ga0207689_10009555 3300025942 Bacteria 8366
199 Ga0207689_10024726 3300025942 Bacteria 5035
200 Ga0207679_10001464 3300025945 Bacteria 14787
201 Ga0207667_10001503 3300025949 Bacteria 29251
202 Ga0207667_10129408 3300025949 Bacteria 2600
203 Ga0207651_10007042 3300025960 Bacteria 5963
204 Ga0207651_10013724 3300025960 Bacteria 4649
205 Ga0207651_10104667 3300025960 Bacteria 2109
206 Ga0207651_10553298 3300025960 Bacteria 1001
207 Ga0207712_10005328 3300025961 Bacteria 8122
208 Ga0207668_10205775 3300025972 Bacteria 1570
209 Ga0207640_10199479 3300025981 Bacteria 1515
210 Ga0207658_10404876 3300025986 Bacteria 1200
211 Ga0207677_10047872 3300026023 Bacteria 2874
212 Ga0207677_10075905 3300026023 Bacteria 2391
213 Ga0207703_10752957 3300026035 Bacteria 928
214 Ga0207639_10059923 3300026041 Bacteria 2935
215 Ga0207678_10001877 3300026067 Bacteria 19182
216 Ga0207708_10001370 3300026075 Bacteria 18328
217 Ga0207708_10071325 3300026075 Bacteria 2661
218 Ga0207702_10068648 3300026078 Bacteria 3045
219 Ga0207641_10017484 3300026088 Bacteria 5870
220 Ga0207641_10686986 3300026088 Bacteria 1007
221 Ga0207648_10004639 3300026089 Bacteria 14070
222 Ga0207648_10006874 3300026089 Bacteria 11280
223 Ga0207676_10011294 3300026095 Bacteria 6382
224 Ga0207676_10039849 3300026095 Bacteria 3597
225 Ga0207674_10027638 3300026116 Bacteria 5998
226 Ga0207674_10092480 3300026116 Bacteria 3014
227 Ga0207674_10342319 3300026116 Bacteria 1446
228 Ga0207674_10642143 3300026116 Bacteria 1025
229 Ga0207675_100002718 3300026118 Bacteria 17433
230 Ga0207675_100014215 3300026118 Bacteria 7423
231 Ga0207675_100111066 3300026118 Bacteria 2586
232 Ga0207675_100279004 3300026118 Bacteria 1623
233 Ga0207683_10035489 3300026121 Bacteria 4337
234 Ga0207683_10090374 3300026121 Bacteria 2727
235 Ga0207698_10002849 3300026142 Bacteria 10342
236 Ga0207698_10007527 3300026142 Bacteria 6824
237 Ga0207428_10021199 3300027907 Bacteria 5504
238 Ga0268266_10535979 3300028379 Bacteria 1120
239 Ga0268265_10010433 3300028380 Bacteria 6273
240 Ga0268265_10034910 3300028380 Bacteria 3669
241 Ga0268265_10101202 3300028380 Bacteria 2328
242 Ga0268264_10020674 3300028381 Bacteria 5377
243 Ga0307515_10296885 3300028794 Bacteria 1305
244 Ga0307513_10002163 3300031456 Bacteria 27483
245 Ga0307513_10095985 3300031456 Bacteria 3004
246 Ga0307513_10165909 3300031456 Bacteria 2093
247 Ga0307408_100020784 3300031548 Bacteria 4435
248 Ga0307405_10011334 3300031731 Bacteria 4666
249 Ga0307405_10225848 3300031731 Bacteria 1377
250 Ga0307413_10167773 3300031824 Bacteria 1550
251 Ga0307413_10291106 3300031824 Bacteria 1234
252 Ga0307410_10005157 3300031852 Bacteria 6875
253 Ga0307410_10022798 3300031852 Bacteria 3878
254 Ga0307410_10264074 3300031852 Bacteria 1344
255 Ga0307410_11070703 3300031852 Bacteria 698
256 Ga0307406_10003008 3300031901 Bacteria 9174
257 Ga0307407_10049888 3300031903 Bacteria 2391
258 Ga0307412_10077305 3300031911 Bacteria 2289
259 Ga0307409_100044521 3300031995 Bacteria 3343
260 Ga0307409_100368810 3300031995 Bacteria 1361
261 Ga0307416_100659912 3300032002 Bacteria 1131
262 Ga0307416_102935616 3300032002 Bacteria 570
263 Ga0307414_10002895 3300032004 Bacteria 9071
264 Ga0307414_10037599 3300032004 Bacteria 3243
265 Ga0307414_10336001 3300032004 Bacteria 1291
266 Ga0307414_10541781 3300032004 Bacteria 1036
267 Ga0307414_10672415 3300032004 Bacteria 935
268 Ga0307411_10153078 3300032005 Bacteria 1716
269 Ga0307411_10427379 3300032005 Unclassified 1102
270 Ga0307415_100970202 3300032126 Unclassified 788
271 Ga0373940_0086071 3300035088 Bacteria 936
272 Ga0373949_0070017 3300035090 Bacteria 917
273 Ga0373932_0166536 3300035112 Bacteria 765
274 Ga0373941_0116075 3300035115 Bacteria 949
275 Ga0373961_0075588 3300035241 Bacteria 1050
276 Ga0373961_0096332 3300035241 Bacteria 952
277 Ga0373961_0187566 3300035241 Bacteria 723
278 Ga0373931_0019397 3300035691 Bacteria 3394
279 Ga0373931_0328915 3300035691 Bacteria 951
280 Ga0439465_0134747 3300041413 Bacteria 874
281 Ga0451791_0293457 3300041451 Bacteria 9021
282 Ga0451802_1969864 3300041460 Bacteria 512
283 Ga0451802_2042774 3300041460 Bacteria 1382
284 Ga0451839_1087313 3300041496 Bacteria 608
285 Ga0451849_0852939 3300041505 Unclassified 874
286 Ga0451853_2122264 3300041512 Bacteria 2311
287 Ga0439432_004159 3300042006 Bacteria 5292
288 Ga0450906_023709 3300042145 Bacteria 1092
289 Ga0451577_0251547 3300042876 Bacteria 1600
290 Ga0466965_0090657 3300044683 Bacteria 1555
291 Ga0466964_0170804 3300044706 Bacteria 1024
292 Ga0466960_0067970 3300044901 Bacteria 1767
293 Ga0451576_0112049 3300045051 Bacteria 2839
294 Ga0496100_0182555 3300048903 Bacteria 1518
295 Ga0496102_0032632 3300048905 Bacteria 4678
296 Ga0496103_0061183 3300048906 Bacteria 2341
297 Ga0496105_0295682 3300048908 Unclassified 1303
298 Ga0496106_0001392 3300048909 Bacteria 18135
299 Ga0496106_0240562 3300048909 Unclassified 1446
300 Ga0496107_0009563 3300048910 Bacteria 6724
301 Ga0496107_0221714 3300048910 Bacteria 1407
302 Ga0496109_0882227 3300048912 Bacteria 832
303 Ga0496110_0065462 3300048913 Bacteria 3213
304 Ga0496111_0414405 3300048914 Bacteria 995
305 Ga0496113_0072772 3300048916 Bacteria 2617
306 Ga0501031_0355991 3300049568 Bacteria 947
307 Ga0501032_0041062 3300049569 Bacteria 3143
308 Ga0501032_0045853 3300049569 Bacteria 2955
309 Ga0501033_0095112 3300049570 Bacteria 2177
310 Ga0501033_0736007 3300049570 Bacteria 669
311 Ga0501034_0000119 3300049571 Bacteria 144440
312 Ga0501034_0079783 3300049571 Bacteria 3276
313 Ga0501034_0890350 3300049571 Bacteria 778
314 Ga0501036_0223548 3300049572 Bacteria 1581
315 Ga0501036_0262282 3300049572 Bacteria 1447
316 Ga0501036_0328645 3300049572 Bacteria 1277
317 Ga0501038_0109450 3300049574 Bacteria 2289
318 Ga0501039_0184540 3300049575 Bacteria 1640
319 Ga0501039_1229953 3300049575 Bacteria 579
320 Ga0501040_0214709 3300049576 Bacteria 1368
321 Ga0501041_0164192 3300049577 Bacteria 1389
322 Ga0501041_0165848 3300049577 Bacteria 1382
323 Ga0501042_0225699 3300049578 Bacteria 1351
324 Ga0501043_0083666 3300049579 Bacteria 2508
325 Ga0501043_0317823 3300049579 Bacteria 1187
326 Ga0501043_0389173 3300049579 Bacteria 1055
327 Ga0501046_0868094 3300049580 Unclassified 630
328 Ga0501047_0122690 3300049581 Bacteria 2479
329 Ga0501047_0186619 3300049581 Bacteria 1939
330 Ga0501047_0197367 3300049581 Bacteria 1874
331 Ga0501048_0330505 3300049582 Bacteria 1086
332 Ga0501068_0061016 3300049584 Bacteria 2290
333 Ga0501069_0246242 3300049585 Bacteria 1042
334 Ga0501070_0092523 3300049586 Bacteria 2502
335 Ga0501070_0097417 3300049586 Bacteria 2433
336 Ga0501070_0315303 3300049586 Bacteria 1272
337 Ga0501070_0892142 3300049586 Bacteria 694
338 Ga0501070_1120131 3300049586 Bacteria 606
339 Ga0501070_1387588 3300049586 Bacteria 534
340 Ga0501071_0023929 3300049587 Bacteria 4269
341 Ga0501071_0356626 3300049587 Bacteria 1113
342 Ga0501071_1169328 3300049587 Bacteria 594
343 Ga0501072_0023818 3300049588 Bacteria 4757
344 Ga0501072_0093150 3300049588 Bacteria 2393
345 Ga0501072_0298652 3300049588 Bacteria 1280
346 Ga0501073_0005198 3300049589 Bacteria 9758
347 Ga0501073_0215585 3300049589 Bacteria 1326
348 Ga0501073_0431658 3300049589 Bacteria 910
349 Ga0501074_0136531 3300049590 Bacteria 1754
350 Ga0501074_0934718 3300049590 Bacteria 610
351 Ga0501075_0338176 3300049591 Bacteria 1147
352 Ga0501076_0789814 3300049592 Bacteria 783
353 Ga0501223_020480 3300049663 Bacteria 1296
354 Ga0501225_0156170 3300049705 Unclassified 699
355 Ga0501079_0274873 3300049741 Bacteria 1317
356 Ga0501079_0475040 3300049741 Bacteria 982
357 Ga0501079_1368581 3300049741 Bacteria 557
358 Ga0501080_0054731 3300049742 Bacteria 3715
359 Ga0501080_0148347 3300049742 Bacteria 2168
360 Ga0501080_0547680 3300049742 Bacteria 1031
361 Ga0501081_0048201 3300049743 Bacteria 2932
362 Ga0501081_0703971 3300049743 Bacteria 758
363 Ga0501083_0280347 3300049744 Bacteria 1084
364 Ga0501083_0356771 3300049744 Bacteria 951
365 Ga0501035_0049127 3300049822 Bacteria 3781
366 Ga0501035_0493121 3300049822 Bacteria 1009
367 Ga0501044_0082482 3300049823 Bacteria 3253
368 Ga0501044_0100270 3300049823 Bacteria 2914
369 Ga0501044_0142735 3300049823 Bacteria 2382
370 Ga0501044_0151902 3300049823 Bacteria 2297
371 Ga0501044_0399858 3300049823 Bacteria 1286
372 Ga0501045_0033052 3300049824 Bacteria 3751
373 Ga0501045_0472836 3300049824 Bacteria 931
374 Ga0501045_0486039 3300049824 Bacteria 917
375 Ga0501045_1260988 3300049824 Bacteria 538
376 nmdc:mga06z11_85674_c1 3300050494 Bacteria 1700
377 nmdc:mga0qj67_228934_c1 3300050509 Bacteria 1508
378 nmdc:mga0qj67_839083_c1 3300050509 Bacteria 726
379 nmdc:mga06r32_120922_c1 3300050510 Bacteria 2583
380 nmdc:mga08y16_12031_c2 3300050511 Bacteria 6431
381 nmdc:mga08y16_461937_c1 3300050511 Bacteria 1294
382 nmdc:mga08y16_485652_c1 3300050511 Bacteria 1256
383 nmdc:mga0n895_12187_c1 3300050512 Bacteria 7700
384 nmdc:mga0rr50_5024_c1 3300050513 Bacteria 7839
385 nmdc:mga08x19_2586_c1 3300050514 Bacteria 10995
386 nmdc:mga0a205_764_c1 3300050515 Bacteria 26001
387 Ga0500651_0017531 3300053093 Bacteria 4420
388 Ga0500555_030196 3300053103 Bacteria 1539
389 Ga0500568_0007326 3300053139 Bacteria 5424
390 Ga0500604_0039221 3300053151 Bacteria 1424
391 Ga0501084_0129291 3300054114 Bacteria 2126
392 Ga0590077_006982 3300059426 Bacteria 2313
393 Ga0501082_0543180 3300060353 Bacteria 1016
394 Ga0530510_0090014 3300061734 Bacteria 2238
395 Ga0530510_0246429 3300061734 Bacteria 1331
396 2513694913 2513237101 Bacteria 7952346
397 2515625874 2515154112 Bacteria 8294334
398 2599625566 2599185214 Bacteria 8209958
399 2599673579 2599185226 Bacteria 8233575
400 2599683249 2599185227 Bacteria 8246414
401 2599695263 2599185229 Bacteria 8216126
402 2644103082 2643221618 Bacteria 7717186
403 2644125856 2643221622 Bacteria 4212502
404 2644151989 2643221626 Bacteria 8069654
405 2644306009 2643221655 Bacteria 7722067
406 2644330317 2643221659 Bacteria 7890716
407 2644542936 2643221698 Bacteria 7756764
408 2644619040 2643221712 Bacteria 7729434
409 2844170644 2844163670 Bacteria 7266046
410 2874596827 2874590934 Bacteria 8299676
411 2874610348 2874604998 Bacteria 7834745
412 2874648632 2874645413 Bacteria 8214782
413 2876777291 2876771140 Bacteria 8287509
414 2876825373 2876818435 Bacteria 8274608
415 2879077622 2879074833 Bacteria 8279565
416 2879130765 2879127579 Bacteria 8294491
417 2879146075 2879142872 Bacteria 8267021
418 2922363321 2922361189 Bacteria 7436256
419 2929525190 2929520902 Bacteria 6765052
420 2935977916 2935975950 Bacteria 8347125
421 2941500615 2941499720 Bacteria 7599444
422 8007000258 8006994254 Bacteria 8309700
423 8019622547 8019619141 Bacteria 9218857
424 8019630568 8019629233 Bacteria 8687553
425 8019640046 8019638758 Bacteria 9062356
426 8019667393 8019659431 Bacteria 8577854
427 8019677166 8019668869 Bacteria 8791617
428 8054359652 8054357960 Bacteria 2867777
429 Ga0501034_0220074
430 MRS1b_contig_1080631
431 Ga0070676_10068313
432 Ga0070676_10093865
433 Ga0070683_100966506
434 Ga0070690_100007037
435 Ga0070690_100191645
436 Ga0070690_100244327
437 Ga0070670_100080420
438 Ga0068869_100006244
439 Ga0068869_100102495
440 Ga0070666_10193381
441 Ga0070680_100065123
442 Ga0070689_100003381
443 Ga0070689_100071380
444 Ga0070689_100097224
445 Ga0070687_100021236
446 Ga0070661_100001889
447 Ga0070692_10176161
448 Ga0070692_10303588
449 Ga0070668_100214983
450 Ga0070669_100004210
451 Ga0070669_100026374
452 Ga0070669_100136103
453 Ga0070669_100232801
454 Ga0070669_100784435
455 Ga0070675_100000538
456 Ga0070675_100016707
457 Ga0070675_100470162
458 Ga0070671_100001013
459 Ga0070674_100092901
460 Ga0070673_100004928
461 Ga0070673_100056677
462 Ga0070673_100119371
463 Ga0070688_100002650
464 Ga0070688_100084579
465 Ga0070659_100044737
466 Ga0070667_100244839
467 Ga0070714_100143320
468 Ga0070701_10015880
469 Ga0070701_10559928
470 Ga0070701_11017714
471 Ga0070705_100179181
472 Ga0070700_100002123
473 Ga0070700_100028968
474 Ga0070700_100048937
475 Ga0070700_100695200
476 Ga0070700_101074723
477 Ga0070678_100045232
478 Ga0070678_100463688
479 Ga0070678_101311728
480 Ga0070662_100000213
481 Ga0070662_100189845
482 Ga0070681_10076846
483 Ga0068867_100002614
484 Ga0068867_100003902
485 Ga0070685_10119323
486 Ga0070679_100207228
487 Ga0070684_101286023
488 Ga0068853_100015192
489 Ga0068853_101497713
490 Ga0070672_100032262
491 Ga0070672_100035448
492 Ga0070686_100024085
493 Ga0070686_101218896
494 Ga0070696_100044522
495 Ga0070696_100162122
496 Ga0070693_100242167
497 Ga0070665_100425432
498 Ga0070704_100087951
499 Ga0068855_100000606
500 Ga0070664_100002489
501 Ga0070664_100063116
502 Ga0068857_100032535
503 Ga0068857_100080553
504 Ga0068857_100999810
505 Ga0068854_100520002
506 Ga0070702_100000591
507 Ga0070702_100052632
508 Ga0070702_100799817
509 Ga0068852_100014245
510 Ga0068852_100034033
511 Ga0068859_100002228
512 Ga0068859_100208522
513 Ga0068859_101828685
514 Ga0068864_100005162
515 Ga0068864_100045567
516 Ga0068866_10025147
517 Ga0068861_100004297
518 Ga0068861_100123846
519 Ga0068861_100228649
520 Ga0068861_100254836
521 Ga0068870_10046266
522 Ga0068870_10051076
523 Ga0068870_10470191
524 Ga0068863_100003541
525 Ga0068858_100027705
526 Ga0068858_100119726
527 Ga0068858_100298262
528 Ga0068860_100008758
529 Ga0068862_100004600
530 Ga0068862_100005105
531 Ga0068862_100109847
532 Ga0081540_1000273
533 Ga0070715_10077305
534 Ga0070712_100032765
535 Ga0075367_10107942
536 Ga0097621_100234026
537 Ga0097621_100234958
538 Ga0075370_10280027
539 Ga0068871_100009293
540 Ga0068871_100055263
541 Ga0075430_100269581
542 Ga0075431_100188491
543 Ga0075433_10014216
544 Ga0075434_100012325
545 Ga0068865_100001819
546 Ga0068865_100010575
547 Ga0075436_100002901
548 Ga0097620_100002228
549 Ga0097620_100208521
550 Ga0097620_101828789
551 Ga0075435_100001479
552 Ga0111539_10043548
553 Ga0111539_10091205
554 Ga0111539_10589080
555 Ga0111539_10834493
556 Ga0105243_10002935
557 Ga0105241_10278022
558 Ga0105248_10002042
559 Ga0105248_10227693
560 Ga0105237_11566860
561 Ga0105249_10004816
562 Ga0105249_10028823
563 Ga0105239_10014618
564 Ga0157373_10004556
565 Ga0157371_10001833
566 Ga0157371_10796442
567 Ga0157370_10241525
568 Ga0157369_10098596
569 Ga0157374_10346495
570 Ga0157378_10019378
571 Ga0157378_10904245
572 Ga0163162_10005810
573 Ga0163162_10645176
574 Ga0157372_10017245
575 Ga0157372_11477807
576 Ga0157375_10026603
577 Ga0157375_10080009
578 Ga0157375_10434538
579 Ga0163163_10004627
580 Ga0157380_10222452
581 Ga0157380_11718233
582 Ga0157377_10001488
583 Ga0157377_10038948
584 Ga0157379_10436920
585 Ga0157379_10447535
586 Ga0157376_10224213
587 Ga0207682_10231107
588 Ga0207642_10061476
589 Ga0207680_10226897
590 Ga0207685_10105961
591 Ga0207643_10014208
592 Ga0207643_10016202
593 Ga0207643_10044964
594 Ga0207643_10489495
595 Ga0207693_10122599
596 Ga0207660_10098938
597 Ga0207662_10026221
598 Ga0207662_10052334
599 Ga0207657_10001097
600 Ga0207649_10004492
601 Ga0207649_10293983
602 Ga0207652_10429814
603 Ga0207681_10001355
604 Ga0207681_10046814
605 Ga0207681_10254963
606 Ga0207681_10412823
607 Ga0207650_10082254
608 Ga0207659_10023733
609 Ga0207659_10400390
610 Ga0207644_10011865
611 Ga0207644_10074617
612 Ga0207690_10000661
613 Ga0207690_10717687
614 Ga0207706_10000040
615 Ga0207706_10323197
616 Ga0207709_10689494
617 Ga0207670_10013203
618 Ga0207670_10017224
619 Ga0207670_10031787
620 Ga0207704_10006461
621 Ga0207704_10604334
622 Ga0207691_10050439
623 Ga0207691_10093912
624 Ga0207711_10012838
625 Ga0207711_10334998
626 Ga0207689_10009555
627 Ga0207689_10024726
628 Ga0207679_10001464
629 Ga0207667_10001503
630 Ga0207667_10129408
631 Ga0207651_10007042
632 Ga0207651_10013724
633 Ga0207651_10104667
634 Ga0207651_10553298
635 Ga0207712_10005328
636 Ga0207668_10205775
637 Ga0207640_10199479
638 Ga0207658_10404876
639 Ga0207677_10047872
640 Ga0207677_10075905
641 Ga0207703_10752957
642 Ga0207639_10059923
643 Ga0207678_10001877
644 Ga0207708_10001370
645 Ga0207708_10071325
646 Ga0207702_10068648
647 Ga0207641_10017484
648 Ga0207641_10686986
649 Ga0207648_10004639
650 Ga0207648_10006874
651 Ga0207676_10011294
652 Ga0207676_10039849
653 Ga0207674_10027638
654 Ga0207674_10092480
655 Ga0207674_10342319
656 Ga0207674_10642143
657 Ga0207675_100002718
658 Ga0207675_100014215
659 Ga0207675_100111066
660 Ga0207675_100279004
661 Ga0207683_10035489
662 Ga0207683_10090374
663 Ga0207698_10002849
664 Ga0207698_10007527
665 Ga0207428_10021199
666 Ga0268266_10535979
667 Ga0268265_10010433
668 Ga0268265_10034910
669 Ga0268265_10101202
670 Ga0268264_10020674
671 Ga0307515_10296885
672 Ga0307513_10002163
673 Ga0307513_10095985
674 Ga0307513_10165909
675 Ga0307408_100020784
676 Ga0307405_10011334
677 Ga0307405_10225848
678 Ga0307413_10167773
679 Ga0307413_10291106
680 Ga0307410_10005157
681 Ga0307410_10022798
682 Ga0307410_10264074
683 Ga0307410_11070703
684 Ga0307406_10003008
685 Ga0307407_10049888
686 Ga0307412_10077305
687 Ga0307409_100044521
688 Ga0307409_100368810
689 Ga0307416_100659912
690 Ga0307416_102935616
691 Ga0307414_10002895
692 Ga0307414_10037599
693 Ga0307414_10336001
694 Ga0307414_10541781
695 Ga0307414_10672415
696 Ga0307411_10153078
697 Ga0307411_10427379
698 Ga0307415_100970202
699 Ga0373940_0086071
700 Ga0373949_0070017
701 Ga0373932_0166536
702 Ga0373941_0116075
703 Ga0373961_0075588
704 Ga0373961_0096332
705 Ga0373961_0187566
706 Ga0373931_0019397
707 Ga0373931_0328915
708 Ga0439465_0134747
709 Ga0451791_0293457
710 Ga0451802_1969864
711 Ga0451802_2042774
712 Ga0451839_1087313
713 Ga0451849_0852939
714 Ga0451853_2122264
715 Ga0439432_004159
716 Ga0450906_023709
717 Ga0451577_0251547
718 Ga0466965_0090657
719 Ga0466964_0170804
720 Ga0466960_0067970
721 Ga0451576_0112049
722 Ga0496100_0182555
723 Ga0496102_0032632
724 Ga0496103_0061183
725 Ga0496105_0295682
726 Ga0496106_0001392
727 Ga0496106_0240562
728 Ga0496107_0009563
729 Ga0496107_0221714
730 Ga0496109_0882227
731 Ga0496110_0065462
732 Ga0496111_0414405
733 Ga0496113_0072772
734 Ga0501031_0355991
735 Ga0501032_0041062
736 Ga0501032_0045853
737 Ga0501033_0095112
738 Ga0501033_0736007
739 Ga0501034_0000119
740 Ga0501034_0079783
741 Ga0501034_0890350
742 Ga0501036_0223548
743 Ga0501036_0262282
744 Ga0501036_0328645
745 Ga0501038_0109450
746 Ga0501039_0184540
747 Ga0501039_1229953
748 Ga0501040_0214709
749 Ga0501041_0164192
750 Ga0501041_0165848
751 Ga0501042_0225699
752 Ga0501043_0083666
753 Ga0501043_0317823
754 Ga0501043_0389173
755 Ga0501046_0868094
756 Ga0501047_0122690
757 Ga0501047_0186619
758 Ga0501047_0197367
759 Ga0501048_0330505
760 Ga0501068_0061016
761 Ga0501069_0246242
762 Ga0501070_0092523
763 Ga0501070_0097417
764 Ga0501070_0315303
765 Ga0501070_0892142
766 Ga0501070_1120131
767 Ga0501070_1387588
768 Ga0501071_0023929
769 Ga0501071_0356626
770 Ga0501071_1169328
771 Ga0501072_0023818
772 Ga0501072_0093150
773 Ga0501072_0298652
774 Ga0501073_0005198
775 Ga0501073_0215585
776 Ga0501073_0431658
777 Ga0501074_0136531
778 Ga0501074_0934718
779 Ga0501075_0338176
780 Ga0501076_0789814
781 Ga0501223_020480
782 Ga0501225_0156170
783 Ga0501079_0274873
784 Ga0501079_0475040
785 Ga0501079_1368581
786 Ga0501080_0054731
787 Ga0501080_0148347
788 Ga0501080_0547680
789 Ga0501081_0048201
790 Ga0501081_0703971
791 Ga0501083_0280347
792 Ga0501083_0356771
793 Ga0501035_0049127
794 Ga0501035_0493121
795 Ga0501044_0082482
796 Ga0501044_0100270
797 Ga0501044_0142735
798 Ga0501044_0151902
799 Ga0501044_0399858
800 Ga0501045_0033052
801 Ga0501045_0472836
802 Ga0501045_0486039
803 Ga0501045_1260988
804 nmdc:mga06z11_85674_c1
805 nmdc:mga0qj67_228934_c1
806 nmdc:mga0qj67_839083_c1
807 nmdc:mga06r32_120922_c1
808 nmdc:mga08y16_12031_c2
809 nmdc:mga08y16_461937_c1
810 nmdc:mga08y16_485652_c1
811 nmdc:mga0n895_12187_c1
812 nmdc:mga0rr50_5024_c1
813 nmdc:mga08x19_2586_c1
814 nmdc:mga0a205_764_c1
815 Ga0500651_0017531
816 Ga0500555_030196
817 Ga0500568_0007326
818 Ga0500604_0039221
819 Ga0501084_0129291
820 Ga0590077_006982
821 Ga0501082_0543180
822 Ga0530510_0090014
823 Ga0530510_0246429
824 2513694913
825 2515625874
826 2599625566
827 2599673579
828 2599683249
829 2599695263
830 2644103082
831 2644125856
832 2644151989
833 2644306009
834 2644330317
835 2644542936
836 2644619040
837 2844170644
838 2874596827
839 2874610348
840 2874648632
841 2876777291
842 2876825373
843 2879077622
844 2879130765
845 2879146075
846 2922363321
847 2929525190
848 2935977916
849 2941500615
850 8007000258
851 8019622547
852 8019630568
853 8019640046
854 8019667393
855 8019677166
856 8054359652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11158

DUF2938

Protein of unknown function (DUF2938)

14

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5edl-assembly1.cif.gz_A crystal structure of an s-component of ecf transporter 0.3587 1 165
5edl-assembly1.cif.gz_A crystal structure of an s-component of ecf transporter 0.355 1 165
2pgh-assembly1.cif.gz_B structure determination of aquomet porcine hemoglobin at 2.8 angstrom resolution 0.3321 36 151
3szk-assembly1.cif.gz_E crystal structure of human methaemoglobin complexed with the first neat domain of isdh from staphylococcus aureus 0.3297 36 151
7k4m-assembly1.cif.gz_D crystal structure of metap2 modified hemoglobin s 0.3282 36 152
ID Description Score Start End Superfamily
af_Q8IUX1_51_228_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4027 1 165 1.10.287.1260
af_Q58247_43_183_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.385 11 167 1.10.3210.10
af_Q8IUX1_51_228_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.383 1 165 1.10.287.1260
2or0B03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.3623 4 92 1.20.140.10
af_I1LMQ8_37_182_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3579 38 165 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A656SJF7-F1-model_v4 deleted 0.9796 5 81
AF-A0A355YAJ2-F1-model_v4 DUF2938 domain-containing protein 0.9751 5 84 GO:0016020
AF-A0A2J5Q0T6-F1-model_v4 DUF2938 domain-containing protein 0.9679 5 88 GO:0016020
AF-A0A0A0CWJ6-F1-model_v4 Membrane protein 0.9677 6 77
AF-A0A528A3C2-F1-model_v4 DUF2938 domain-containing protein 0.9621 2 103 GO:0016020

Map