metagRoot

F441751

General Info

Members	Datasets	Scaffolds	Average Seq Length
428	241	411	341

Family's Representative Sequence

Representative Sequence	3300048088\|Ga0495602_0210567\|Ga0495602_0210567_176_1396
Length	406
Sequence	MHDRPIFGFKAKAISLLDFYAYVARMRLGAARNNGMDSSSPAGSRRTAHDCRCVRPVNEEEPEMDMIRVGIDLAKNVFQMHGVDRSEKAIWRRKLTRVEWLDVLQRTVPLHAVIGMEACGSAHHWARRLQAIGYTVKLIAPQFVKPYVKSNKNDANDAEAICEAMSRPGMRFVAVKTVEQQDVQAVHRVRAGLMEQRNAKANQIGGLTSEYGIVAPREILQLRRAVPVWLEDVNSGLSDRFRRLLTGLWEDLRSLDDRIRELDREIAAIAASDPVARRLQQLRGVGPMVATALIATVGNARQFSNGRQMAASLGLTPRQNSSGGKERLLGISKRGDAYVRCLLIHGARAMIQMARRRTDALSLWVMRIAGSRHPNIAAVALANKTARIAWAMITRETDYQPELAAH

Samples

	Sample ID	Description	Type	Environment
1	2508501114	Microvirga lotononidis WSM3557	Isolate	Nodule
2	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
3	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
4	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
5	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
6	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
7	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
8	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
9	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
10	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
11	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
12	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
13	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
14	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
15	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
16	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
17	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
18	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
19	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
20	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
21	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
24	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
25	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
26	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
27	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
28	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
29	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
30	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
31	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
32	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
33	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
34	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
35	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
36	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
37	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
38	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
39	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
40	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
41	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
42	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
43	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
48	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
49	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
50	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
51	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
52	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
53	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
54	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
55	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
56	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
57	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
58	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
59	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
60	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
62	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
63	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
64	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
65	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
66	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
67	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
68	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
69	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
70	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
71	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
72	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
73	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
74	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
75	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
76	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
77	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
78	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
79	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
80	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
81	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
82	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
83	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
84	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
112	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
114	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
115	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
116	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
117	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
118	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
119	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
120	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
121	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
122	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
123	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
124	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
125	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
126	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
127	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
128	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
129	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
130	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
131	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
132	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
133	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
134	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
135	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
136	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
137	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
138	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
139	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
140	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
141	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
142	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
143	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
144	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
145	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
146	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
147	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
148	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
149	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
150	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
151	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
152	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
153	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
154	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
155	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
156	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
157	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
158	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
159	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
160	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
161	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
162	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
163	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
164	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
165	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
166	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
167	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
168	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
169	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
170	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
171	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
172	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
173	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
174	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
175	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
176	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
177	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
178	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
179	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
180	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
181	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
182	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
183	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
184	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
185	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
186	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
187	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
188	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
189	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
190	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
191	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
192	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
193	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
194	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
195	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
196	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
197	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
198	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
199	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
200	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
201	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
202	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
203	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
204	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
205	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
206	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
207	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
208	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
209	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
210	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
211	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
212	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
213	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
214	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
215	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
216	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
217	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
218	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
219	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
220	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
221	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
222	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
223	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
224	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
225	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
226	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
227	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
228	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
229	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
230	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
231	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
232	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
233	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
234	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
235	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
236	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
237	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
238	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
239	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
240	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
241	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.03
Metatranscriptomes	0
Isolates	3.97

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.97
Nodule	1.17
Rhizoplane	2.34
Rhizosphere	88.08
Stem	0
Stem Tuber	0
Unclassified	4.44

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJNas_1005104	3300000546	Bacteria	1440
2	JGI24735J21928_10004004	3300002067	Bacteria	4985
3	JGI25162J39368_1004530	3300002737	Bacteria	3172
4	JGI25162J39368_1006429	3300002737	Bacteria	2035
5	JGI25162J39368_1008197	3300002737	Bacteria	1525
6	JGI25165J46597_1007823	3300003214	Bacteria	1736
7	rootH2_10132043	3300003320	Bacteria	2903
8	rootL2_10366593	3300003322	Bacteria	1488
9	JGI25407J50210_10029929	3300003373	Bacteria	1411
10	Ga0055533_1000541	3300003756	Bacteria	13451
11	Ga0055542_1005107	3300003762	Bacteria	3027
12	Ga0055536_1019069	3300003781	Bacteria	2171
13	Ga0070676_10136323	3300005328	Bacteria	1557
14	Ga0070666_10089286	3300005335	Bacteria	2115
15	Ga0068868_100284149	3300005338	Bacteria	1401
16	Ga0070668_100242294	3300005347	Bacteria	1494
17	Ga0070669_100273562	3300005353	Bacteria	1351
18	Ga0070675_100200549	3300005354	Bacteria	1732
19	Ga0070675_100216493	3300005354	Bacteria	1667
20	Ga0070671_100271620	3300005355	Bacteria	1441
21	Ga0070674_100255535	3300005356	Bacteria	1378
22	Ga0070673_100182105	3300005364	Bacteria	1799
23	Ga0070688_100106568	3300005365	Bacteria	1856
24	Ga0070659_100254183	3300005366	Bacteria	1457
25	Ga0070667_100158096	3300005367	Bacteria	1995
26	Ga0070714_100367060	3300005435	Bacteria	1355
27	Ga0070705_100075565	3300005440	Bacteria	2051
28	Ga0070700_100113776	3300005441	Bacteria	1803
29	Ga0070694_100109439	3300005444	Bacteria	1967
30	Ga0070708_100094215	3300005445	Bacteria	2731
31	Ga0070663_100252719	3300005455	Bacteria	1395
32	Ga0070678_100214934	3300005456	Bacteria	1595
33	Ga0070662_100189049	3300005457	Bacteria	1627
34	Ga0070662_100239682	3300005457	Bacteria	1454
35	Ga0068867_100113682	3300005459	Bacteria	2083
36	Ga0068867_100176571	3300005459	Bacteria	1695
37	Ga0070698_100286042	3300005471	Bacteria	1580
38	Ga0070699_100256009	3300005518	Bacteria	1565
39	Ga0070697_100027575	3300005536	Bacteria	4545
40	Ga0068853_100230349	3300005539	Bacteria	1695
41	Ga0070672_100140216	3300005543	Bacteria	1993
42	Ga0070695_100122916	3300005545	Bacteria	1778
43	Ga0070695_100123007	3300005545	Bacteria	1778
44	Ga0070696_100008474	3300005546	Bacteria	6881
45	Ga0070704_100175960	3300005549	Bacteria	1707
46	Ga0068852_100022690	3300005616	Bacteria	5039
47	Ga0068859_100373842	3300005617	Bacteria	1521
48	Ga0068858_100090749	3300005842	Bacteria	2844
49	Ga0081538_10059326	3300005981	Bacteria	2211
50	Ga0075432_10061081	3300006058	Bacteria	1342
51	Ga0070712_100185503	3300006175	Bacteria	1624
52	Ga0097621_100276264	3300006237	Bacteria	1478
53	Ga0068871_100269626	3300006358	Bacteria	1487
54	Ga0075434_100339669	3300006871	Bacteria	1523
55	Ga0068865_100228983	3300006881	Bacteria	1457
56	Ga0075436_100044274	3300006914	Bacteria	3068
57	Ga0075436_100128413	3300006914	Bacteria	1777
58	Ga0075436_100134921	3300006914	Bacteria	1732
59	Ga0097620_100373864	3300006931	Bacteria	1521
60	Ga0075435_100348052	3300007076	Bacteria	1270
61	Ga0105240_10015051	3300009093	Bacteria	10529
62	Ga0105248_10243818	3300009177	Bacteria	2023
63	Ga0105237_10007576	3300009545	Bacteria	11868
64	Ga0105238_10267741	3300009551	Bacteria	1689
65	Ga0157373_10053752	3300013100	Bacteria	2863
66	Ga0157373_10159153	3300013100	Bacteria	1589
67	Ga0157369_10324536	3300013105	Bacteria	1600
68	Ga0157378_10185278	3300013297	Bacteria	1960
69	Ga0163162_10025949	3300013306	Bacteria	5791
70	Ga0163162_10248133	3300013306	Bacteria	1912
71	Ga0157375_10212122	3300013308	Bacteria	2094
72	Ga0182008_10000499	3300014497	Bacteria	29592
73	Ga0182008_10043008	3300014497	Bacteria	2250
74	Ga0157376_10273515	3300014969	Bacteria	1588
75	Ga0182006_1067940	3300015261	Bacteria	1329
76	Ga0182007_10036418	3300015262	Bacteria	1655
77	Ga0182007_10041420	3300015262	Bacteria	1535
78	Ga0182007_10057418	3300015262	Bacteria	1277
79	Ga0182005_1000214	3300015265	Bacteria	38331
80	Ga0182005_1014199	3300015265	Bacteria	2232
81	Ga0182005_1039879	3300015265	Bacteria	1277
82	Ga0163161_10159090	3300017792	Bacteria	1722
83	Ga0163161_10216731	3300017792	Bacteria	1481
84	Ga0213872_10032056	3300021361	Bacteria	2408
85	Ga0213872_10084385	3300021361	Bacteria	1424
86	Ga0213872_10110444	3300021361	Bacteria	1221
87	Ga0209674_100130	3300025226	Bacteria	119638
88	Ga0209437_101423	3300025233	Bacteria	5921
89	Ga0209437_112578	3300025233	Bacteria	1231
90	Ga0209148_1002881	3300025254	Bacteria	5272
91	Ga0209233_1005945	3300025261	Bacteria	3993
92	Ga0209676_1001239	3300025292	Bacteria	26880
93	Ga0209676_1012376	3300025292	Bacteria	3357
94	Ga0209025_1054480	3300025294	Bacteria	1557
95	Ga0207696_1018526	3300025711	Bacteria	2283
96	Ga0207713_1000293	3300025735	Bacteria	57670
97	Ga0207680_10168065	3300025903	Bacteria	1475
98	Ga0207699_10178037	3300025906	Bacteria	1428
99	Ga0207707_10253733	3300025912	Bacteria	1527
100	Ga0207695_10001196	3300025913	Bacteria	44626
101	Ga0207671_10006002	3300025914	Bacteria	10984
102	Ga0207694_10076767	3300025924	Bacteria	2617
103	Ga0207650_10202033	3300025925	Bacteria	1593
104	Ga0207650_10310035	3300025925	Bacteria	1291
105	Ga0207659_10165300	3300025926	Bacteria	1741
106	Ga0207659_10256000	3300025926	Bacteria	1422
107	Ga0207664_10348861	3300025929	Bacteria	1310
108	Ga0207644_10246804	3300025931	Bacteria	1423
109	Ga0207706_10191607	3300025933	Bacteria	1794
110	Ga0207706_10324571	3300025933	Bacteria	1340
111	Ga0207706_10376940	3300025933	Bacteria	1231
112	Ga0207669_10077581	3300025937	Bacteria	2113
113	Ga0207669_10231200	3300025937	Bacteria	1364
114	Ga0207665_10131200	3300025939	Bacteria	1779
115	Ga0207691_10136499	3300025940	Bacteria	2163
116	Ga0207711_10210991	3300025941	Bacteria	1773
117	Ga0207667_10002218	3300025949	Bacteria	24400
118	Ga0207668_10125925	3300025972	Bacteria	1948
119	Ga0207658_10228158	3300025986	Bacteria	1570
120	Ga0207677_10206407	3300026023	Bacteria	1565
121	Ga0207639_10353553	3300026041	Bacteria	1313
122	Ga0207708_10244380	3300026075	Bacteria	1444
123	Ga0207648_10062851	3300026089	Bacteria	3236
124	Ga0207648_10128952	3300026089	Bacteria	2226
125	Ga0207675_100066212	3300026118	Bacteria	3376
126	Ga0207675_100345504	3300026118	Bacteria	1457
127	Ga0207683_10261481	3300026121	Bacteria	1580
128	Ga0207698_10027142	3300026142	Bacteria	4061
129	Ga0207428_10010701	3300027907	Bacteria	8182
130	Ga0207428_10231829	3300027907	Bacteria	1382
131	Ga0268265_10234957	3300028380	Bacteria	1614
132	Ga0265327_10086931	3300031251	Bacteria	1532
133	Ga0316575_10046939	3300031665	Bacteria	1716
134	Ga0316575_10059026	3300031665	Bacteria	1530
135	Ga0316579_10023859	3300031691	Bacteria	2749
136	Ga0316579_10090328	3300031691	Bacteria	1462
137	Ga0316579_10103321	3300031691	Bacteria	1365
138	Ga0316576_10142322	3300031727	Bacteria	1806
139	Ga0316576_10153981	3300031727	Bacteria	1732
140	Ga0316576_10181707	3300031727	Bacteria	1586
141	Ga0316576_10222265	3300031727	Bacteria	1420
142	Ga0316578_10060601	3300031728	Bacteria	2227
143	Ga0316578_10064519	3300031728	Bacteria	2161
144	Ga0316578_10098731	3300031728	Bacteria	1749
145	Ga0316578_10114987	3300031728	Bacteria	1616
146	Ga0316578_10138370	3300031728	Bacteria	1466
147	Ga0316577_10043610	3300031733	Bacteria	2509
148	Ga0316577_10051083	3300031733	Bacteria	2307
149	Ga0316577_10095487	3300031733	Bacteria	1665
150	Ga0307411_10136760	3300032005	Bacteria	1800
151	Ga0316583_10023960	3300032133	Bacteria	2179
152	Ga0316583_10055556	3300032133	Bacteria	1392
153	Ga0316585_10014847	3300032137	Bacteria	2331
154	Ga0316585_10016097	3300032137	Bacteria	2249
155	Ga0316585_10024697	3300032137	Bacteria	1860
156	Ga0316580_10017922	3300032139	Bacteria	2178
157	Ga0316580_10034782	3300032139	Bacteria	1559
158	Ga0316580_10039051	3300032139	Bacteria	1467
159	Ga0316580_10043390	3300032139	Bacteria	1387
160	Ga0316580_10045402	3300032139	Bacteria	1355
161	Ga0373939_0042065	3300035114	Bacteria	1380
162	Ga0373957_0073214	3300035120	Bacteria	1343
163	Ga0316574_0031631	3300035398	Bacteria	3210
164	Ga0316574_0124168	3300035398	Bacteria	1658
165	Ga0316574_0144743	3300035398	Bacteria	1531
166	Ga0316574_0209901	3300035398	Bacteria	1250
167	Ga0373935_0162021	3300035692	Bacteria	1525
168	Ga0316582_0014338	3300036647	Bacteria	4494
169	Ga0316582_0099492	3300036647	Bacteria	1924
170	Ga0316582_0112276	3300036647	Bacteria	1815
171	Ga0316582_0185903	3300036647	Bacteria	1414
172	Ga0316584_0103657	3300036712	Bacteria	2129
173	Ga0316584_0156310	3300036712	Bacteria	1695
174	Ga0316584_0161316	3300036712	Bacteria	1665
175	Ga0316584_0207229	3300036712	Bacteria	1444
176	Ga0395899_0002337	3300037312	Bacteria	15440
177	Ga0395899_0004477	3300037312	Bacteria	10891
178	Ga0395900_0003711	3300037418	Bacteria	16409
179	Ga0395900_0004701	3300037418	Bacteria	14396
180	Ga0395900_0096549	3300037418	Bacteria	3036
181	Ga0395898_0061560	3300037466	Bacteria	3646
182	Ga0395898_0074430	3300037466	Bacteria	3280
183	Ga0395898_0133955	3300037466	Bacteria	2372
184	Ga0395905_0040770	3300037471	Bacteria	4356
185	Ga0395905_0171266	3300037471	Bacteria	2039
186	Ga0316581_0040268	3300037588	Bacteria	1422
187	Ga0395901_0033837	3300038443	Bacteria	5277
188	Ga0436360_1166408	3300039438	Bacteria	1492
189	Ga0436361_0285595	3300039447	Bacteria	1107
190	Ga0436361_0321171	3300039447	Bacteria	2625
191	Ga0436361_0351898	3300039447	Bacteria	1780
192	Ga0439438_025206	3300041405	Bacteria	1622
193	Ga0439447_026065	3300041407	Bacteria	1501
194	Ga0439466_0044980	3300041411	Bacteria	1460
195	Ga0439465_0026006	3300041413	Bacteria	1849
196	Ga0451833_0445043	3300041491	Bacteria	1134
197	Ga0439441_016405	3300042001	Bacteria	1320
198	Ga0439449_0070379	3300042007	Bacteria	1289
199	Ga0439452_000462	3300042010	Bacteria	22759
200	Ga0439452_014375	3300042010	Bacteria	2201
201	Ga0439452_028219	3300042010	Bacteria	1402
202	Ga0439463_028440	3300042016	Bacteria	1408
203	Ga0439460_0029932	3300042461	Bacteria	1544
204	Ga0466972_0021152	3300044658	Bacteria	3246
205	Ga0466965_0007480	3300044683	Bacteria	5020
206	Ga0466964_0010505	3300044706	Bacteria	3492
207	Ga0466968_0003848	3300044735	Bacteria	5571
208	Ga0466970_0080091	3300044765	Bacteria	1764
209	Ga0466957_0050875	3300044842	Bacteria	2522
210	Ga0466959_0087002	3300045049	Bacteria	2248
211	Ga0466967_0332208	3300045976	Bacteria	1468
212	Ga0495617_000135	3300046452	Bacteria	49103
213	Ga0495617_042481	3300046452	Bacteria	1519
214	Ga0495627_036856	3300046453	Bacteria	1518
215	Ga0495627_042848	3300046453	Bacteria	1385
216	Ga0495590_0000016	3300046457	Bacteria	225874
217	Ga0495590_0000531	3300046457	Bacteria	18361
218	Ga0495591_001023	3300046458	Bacteria	18910
219	Ga0495591_034532	3300046458	Bacteria	1487
220	Ga0495638_0008420	3300046460	Bacteria	7316
221	Ga0495638_0026580	3300046460	Bacteria	3750
222	Ga0495638_0039674	3300046460	Bacteria	2988
223	Ga0495638_0109713	3300046460	Bacteria	1640
224	Ga0495580_0002542	3300046472	Bacteria	15890
225	Ga0495605_0007129	3300046474	Bacteria	6361
226	Ga0495605_0056750	3300046474	Bacteria	1887
227	Ga0495605_0099541	3300046474	Bacteria	1338
228	Ga0495605_0100250	3300046474	Bacteria	1332
229	Ga0495605_0101750	3300046474	Bacteria	1320
230	Ga0495605_0104104	3300046474	Bacteria	1301
231	Ga0495639_0021271	3300046475	Bacteria	2838
232	Ga0495584_0034298	3300046491	Bacteria	2568
233	Ga0495584_0048200	3300046491	Bacteria	2148
234	Ga0495584_0095924	3300046491	Bacteria	1497
235	Ga0495585_0000229	3300046492	Bacteria	57675
236	Ga0495585_0012303	3300046492	Bacteria	5040
237	Ga0495585_0020906	3300046492	Bacteria	3760
238	Ga0495585_0096260	3300046492	Bacteria	1588
239	Ga0495585_0105200	3300046492	Bacteria	1505
240	Ga0495585_0113595	3300046492	Bacteria	1438
241	Ga0495594_0049108	3300046499	Bacteria	2319
242	Ga0495596_0027062	3300046500	Bacteria	2308
243	Ga0495596_0059046	3300046500	Bacteria	1495
244	Ga0495607_0000584	3300046501	Bacteria	35513
245	Ga0495607_0074051	3300046501	Bacteria	1891
246	Ga0495607_0117071	3300046501	Bacteria	1404
247	Ga0495583_0002115	3300046506	Bacteria	17827
248	Ga0495583_0010193	3300046506	Bacteria	5512
249	Ga0495583_0028541	3300046506	Bacteria	2742
250	Ga0495606_0000048	3300046507	Bacteria	207840
251	Ga0495606_0001496	3300046507	Bacteria	31075
252	Ga0495610_0031365	3300046512	Bacteria	2773
253	Ga0495610_0056985	3300046512	Bacteria	1876
254	Ga0495610_0089286	3300046512	Bacteria	1399
255	Ga0495616_0000798	3300046513	Bacteria	23077
256	Ga0495616_0055697	3300046513	Bacteria	1956
257	Ga0495616_0086263	3300046513	Bacteria	1493
258	Ga0495616_0099017	3300046513	Bacteria	1369
259	Ga0495616_0118128	3300046513	Bacteria	1226
260	Ga0495631_0052661	3300046518	Bacteria	1777
261	Ga0495631_0078255	3300046518	Bacteria	1427
262	Ga0495632_0056404	3300046519	Bacteria	1920
263	Ga0495637_0043432	3300046520	Bacteria	1918
264	Ga0495637_0052126	3300046520	Bacteria	1709
265	Ga0495637_0091998	3300046520	Bacteria	1195
266	Ga0495643_0035196	3300046522	Bacteria	2759
267	Ga0495643_0054708	3300046522	Bacteria	2135
268	Ga0495643_0075669	3300046522	Bacteria	1761
269	Ga0495644_0042601	3300046523	Bacteria	1709
270	Ga0495644_0046368	3300046523	Bacteria	1633
271	Ga0495648_0000001	3300046524	Bacteria	696872
272	Ga0495648_0000495	3300046524	Bacteria	42433
273	Ga0495648_0008262	3300046524	Bacteria	8210
274	Ga0495648_0114202	3300046524	Bacteria	1463
275	Ga0495642_0058792	3300046528	Bacteria	1592
276	Ga0495642_0063279	3300046528	Bacteria	1537
277	Ga0495642_0066131	3300046528	Bacteria	1506
278	Ga0495654_0010271	3300046530	Bacteria	5096
279	Ga0495654_0105401	3300046530	Bacteria	1292
280	Ga0495586_0137202	3300046535	Bacteria	1371
281	Ga0495587_0143114	3300046536	Bacteria	1364
282	Ga0495609_0000310	3300046538	Bacteria	43799
283	Ga0495609_0007386	3300046538	Bacteria	5493
284	Ga0495609_0027279	3300046538	Bacteria	2610
285	Ga0495609_0033813	3300046538	Bacteria	2319
286	Ga0495609_0081174	3300046538	Bacteria	1417
287	Ga0495597_0009453	3300046542	Bacteria	4814
288	Ga0495597_0066660	3300046542	Bacteria	1559
289	Ga0495597_0076780	3300046542	Bacteria	1432
290	Ga0495622_0000024	3300046557	Bacteria	154056
291	Ga0495622_0000198	3300046557	Bacteria	47918
292	Ga0495622_0002799	3300046557	Bacteria	8328
293	Ga0495622_0061443	3300046557	Bacteria	1739
294	Ga0495633_0000106	3300046558	Bacteria	113381
295	Ga0495656_0061788	3300046615	Bacteria	1637
296	Ga0495656_0093241	3300046615	Bacteria	1380
297	Ga0495668_0000288	3300046616	Bacteria	69253
298	Ga0495668_0000686	3300046616	Bacteria	40735
299	Ga0495668_0003746	3300046616	Bacteria	11160
300	Ga0495668_0025134	3300046616	Bacteria	3386
301	Ga0495668_0037867	3300046616	Bacteria	2697
302	Ga0495668_0119424	3300046616	Bacteria	1442
303	Ga0495668_0195185	3300046616	Bacteria	1109
304	Ga0495611_0004791	3300046648	Bacteria	5816
305	Ga0495611_0060365	3300046648	Bacteria	1722
306	Ga0495611_0073725	3300046648	Bacteria	1562
307	Ga0495625_0000035	3300046660	Bacteria	224323
308	Ga0495625_0001176	3300046660	Bacteria	33628
309	Ga0495625_0008166	3300046660	Bacteria	8967
310	Ga0495625_0062600	3300046660	Bacteria	2629
311	Ga0495625_0109425	3300046660	Bacteria	1890
312	Ga0495625_0111919	3300046660	Bacteria	1865
313	Ga0495625_0182645	3300046660	Bacteria	1393
314	Ga0495635_0155733	3300046663	Bacteria	1555
315	Ga0495659_0107919	3300046664	Bacteria	1084
316	Ga0495661_0024423	3300046665	Bacteria	3912
317	Ga0495661_0041604	3300046665	Bacteria	2841
318	Ga0495661_0067048	3300046665	Bacteria	2109
319	Ga0495661_0089199	3300046665	Bacteria	1758
320	Ga0495661_0120530	3300046665	Bacteria	1449
321	Ga0495661_0165770	3300046665	Bacteria	1182
322	Ga0495646_0025108	3300046680	Bacteria	3749
323	Ga0495669_0118654	3300046684	Bacteria	1239
324	Ga0495670_0046987	3300046691	Bacteria	2157
325	Ga0495671_0000091	3300046692	Bacteria	85332
326	Ga0495671_0003161	3300046692	Bacteria	10232
327	Ga0495671_0090117	3300046692	Bacteria	1501
328	Ga0495649_0076982	3300046694	Bacteria	1785
329	Ga0495649_0082711	3300046694	Bacteria	1715
330	Ga0495589_0010950	3300046794	Bacteria	4708
331	Ga0495589_0058344	3300046794	Bacteria	1897
332	Ga0495589_0129681	3300046794	Bacteria	1211
333	Ga0495660_0000118	3300046810	Bacteria	85202
334	Ga0495660_0004005	3300046810	Bacteria	8991
335	Ga0495660_0049825	3300046810	Bacteria	2284
336	Ga0495660_0055846	3300046810	Bacteria	2136
337	Ga0495660_0088286	3300046810	Bacteria	1615
338	Ga0495660_0103163	3300046810	Bacteria	1465
339	Ga0495604_0034014	3300047317	Bacteria	4033
340	Ga0495636_0000366	3300047318	Bacteria	17077
341	Ga0495674_0152222	3300047319	Bacteria	1939
342	Ga0495672_0030558	3300047320	Bacteria	3376
343	Ga0495672_0037440	3300047320	Bacteria	2968
344	Ga0495672_0090265	3300047320	Bacteria	1684
345	Ga0495680_0004824	3300047322	Bacteria	12795
346	Ga0495680_0221387	3300047322	Bacteria	1351
347	Ga0495683_0003267	3300047323	Bacteria	9475
348	Ga0495683_0011138	3300047323	Bacteria	4741
349	Ga0495683_0042805	3300047323	Bacteria	2282
350	Ga0495683_0077356	3300047323	Bacteria	1626
351	Ga0495683_0077766	3300047323	Bacteria	1622
352	Ga0495687_000095	3300047443	Bacteria	134456
353	Ga0495687_017727	3300047443	Bacteria	3540
354	Ga0495687_025527	3300047443	Bacteria	2791
355	Ga0495675_0038253	3300047444	Bacteria	3054
356	Ga0495677_0039568	3300047445	Bacteria	1724
357	Ga0495677_0085179	3300047445	Bacteria	1187
358	Ga0495679_006407	3300047446	Bacteria	5071
359	Ga0495679_029415	3300047446	Bacteria	1792
360	Ga0495685_045848	3300047447	Bacteria	1488
361	Ga0495673_0003516	3300047469	Bacteria	10310
362	Ga0495673_0023317	3300047469	Bacteria	3013
363	Ga0495673_0078398	3300047469	Bacteria	1373
364	Ga0495681_0022458	3300047470	Bacteria	3375
365	Ga0495686_0002934	3300047472	Bacteria	15272
366	Ga0495686_0068749	3300047472	Unclassified	2185
367	Ga0495686_0107527	3300047472	Bacteria	1676
368	Ga0495602_0210567	3300048088	Bacteria	1476
369	Ga0495614_0001351	3300048089	Bacteria	10587
370	Ga0495614_0064309	3300048089	Bacteria	1577
371	Ga0495626_0000031	3300048091	Bacteria	197930
372	Ga0495626_0000033	3300048091	Bacteria	184008
373	Ga0495626_0003670	3300048091	Bacteria	9732
374	Ga0495626_0004280	3300048091	Bacteria	8811
375	Ga0495626_0011729	3300048091	Bacteria	4623
376	Ga0495626_0028833	3300048091	Bacteria	2688
377	Ga0495626_0053260	3300048091	Bacteria	1863
378	Ga0495626_0055641	3300048091	Bacteria	1812
379	Ga0495626_0075017	3300048091	Bacteria	1512
380	Ga0496100_0261477	3300048903	Bacteria	1284
381	Ga0496102_0330608	3300048905	Bacteria	1435
382	Ga0496103_0001817	3300048906	Bacteria	13889
383	Ga0496110_0233971	3300048913	Bacteria	1671
384	Ga0496110_0358081	3300048913	Bacteria	1329
385	Ga0496111_0061605	3300048914	Bacteria	2720
386	Ga0496112_0269803	3300048915	Bacteria	1650
387	Ga0496113_0070764	3300048916	Bacteria	2652
388	Ga0496115_0001986	3300048918	Bacteria	14606
389	Ga0496115_0079275	3300048918	Bacteria	2673
390	Ga0496116_0023256	3300048919	Bacteria	4620
391	Ga0496117_0017323	3300048920	Bacteria	6023
392	Ga0496118_0001676	3300048921	Bacteria	32475
393	Ga0496122_0078508	3300048925	Bacteria	2312
394	Ga0496122_0092406	3300048925	Bacteria	2057
395	Ga0496123_0091454	3300048926	Bacteria	1804
396	Ga0496126_0072669	3300048929	Bacteria	3059
397	Ga0495678_001383	3300049459	Bacteria	19337
398	Ga0495678_059684	3300049459	Bacteria	1437
399	Ga0495682_0058533	3300049460	Bacteria	1393
400	Ga0495682_0058813	3300049460	Bacteria	1389
401	Ga0501227_001703	3300049665	Bacteria	4876
402	nmdc:mga06r32_437132_c1	3300050510	Bacteria	1289
403	nmdc:mga0n895_330840_c1	3300050512	Bacteria	1544
404	nmdc:mga0rr50_190315_c1	3300050513	Bacteria	1681
405	nmdc:mga08x19_118552_c1	3300050514	Bacteria	1772
406	nmdc:mga08x19_171508_c1	3300050514	Bacteria	1478
407	nmdc:mga08x19_193083_c1	3300050514	Bacteria	1394
408	nmdc:mga08x19_44493_c1	3300050514	Bacteria	2835
409	Ga0495601_0077037	3300053077	Bacteria	2135
410	Ga0500562_012101	3300053108	Bacteria	2192
411	Ga0500586_011877	3300053145	Bacteria	2512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013308	Ga0157375_10212122	Ga0157375_102121222	280
2	iso_pu_bacteria	2508501114	2509074654	306
3	3300046528	Ga0495642_0066131	Ga0495642_0066131_110_1093	313
4	3300031665	Ga0316575_10046939	Ga0316575_100469392	315
5	3300035120	Ga0373957_0073214	Ga0373957_0073214_267_1298	315
6	3300047322	Ga0495680_0221387	Ga0495680_0221387_166_1197	315
7	3300045049	Ga0466959_0087002	Ga0466959_0087002_1044_2069	317
8	3300046458	Ga0495591_034532	Ga0495591_034532_132_1157	317
9	3300046460	Ga0495638_0026580	Ga0495638_0026580_760_1785	317
10	3300046474	Ga0495605_0099541	Ga0495605_0099541_60_1085	317
11	3300046500	Ga0495596_0059046	Ga0495596_0059046_398_1423	317
12	3300046501	Ga0495607_0074051	Ga0495607_0074051_311_1336	317
13	3300046501	Ga0495607_0117071	Ga0495607_0117071_293_1318	317
14	3300046513	Ga0495616_0099017	Ga0495616_0099017_305_1330	317
15	3300046518	Ga0495631_0078255	Ga0495631_0078255_345_1370	317
16	3300046519	Ga0495632_0056404	Ga0495632_0056404_827_1852	317
17	3300046523	Ga0495644_0042601	Ga0495644_0042601_494_1519	317
18	3300046524	Ga0495648_0114202	Ga0495648_0114202_54_1079	317
19	3300046528	Ga0495642_0058792	Ga0495642_0058792_397_1422	317
20	3300046538	Ga0495609_0033813	Ga0495609_0033813_114_1139	317
21	3300046648	Ga0495611_0060365	Ga0495611_0060365_92_1117	317
22	3300046665	Ga0495661_0089199	Ga0495661_0089199_451_1476	317
23	3300046810	Ga0495660_0088286	Ga0495660_0088286_398_1423	317
24	3300046810	Ga0495660_0103163	Ga0495660_0103163_96_1121	317
25	3300047320	Ga0495672_0090265	Ga0495672_0090265_614_1639	317
26	3300047323	Ga0495683_0077356	Ga0495683_0077356_214_1239	317
27	3300047446	Ga0495679_006407	Ga0495679_006407_2023_3048	317
28	3300047446	Ga0495679_029415	Ga0495679_029415_735_1760	317
29	3300047447	Ga0495685_045848	Ga0495685_045848_348_1373	317
30	3300048091	Ga0495626_0028833	Ga0495626_0028833_1493_2518	317
31	3300046474	Ga0495605_0104104	Ga0495605_0104104_13_1011	318
32	3300046520	Ga0495637_0091998	Ga0495637_0091998_171_1169	318
33	3300048091	Ga0495626_0055641	Ga0495626_0055641_393_1418	318
34	3300005354	Ga0070675_100216493	Ga0070675_1002164932	319
35	3300005457	Ga0070662_100239682	Ga0070662_1002396821	319
36	3300025926	Ga0207659_10256000	Ga0207659_102560001	319
37	3300025933	Ga0207706_10376940	Ga0207706_103769401	319
38	3300046492	Ga0495585_0020906	Ga0495585_0020906_1699_2724	319
39	3300003373	JGI25407J50210_10029929	JGI25407J50210_100299291	320
40	3300005981	Ga0081538_10059326	Ga0081538_100593262	320
41	3300006914	Ga0075436_100134921	Ga0075436_1001349212	320
42	3300007076	Ga0075435_100348052	Ga0075435_1003480521	320
43	3300046499	Ga0495594_0049108	Ga0495594_0049108_1057_2082	320
44	3300050514	nmdc:mga08x19_171508_c1	nmdc:mga08x19_171508_c1_333_1352	320
45	3300050514	nmdc:mga08x19_193083_c1	nmdc:mga08x19_193083_c1_114_1139	320
46	3300021361	Ga0213872_10110444	Ga0213872_101104441	321
47	3300039447	Ga0436361_0321171	Ga0436361_0321171_1262_2317	321
48	3300046522	Ga0495643_0075669	Ga0495643_0075669_459_1484	322
49	3300046665	Ga0495661_0067048	Ga0495661_0067048_854_1879	322
50	3300046794	Ga0495589_0129681	Ga0495589_0129681_37_1062	324
51	3300048091	Ga0495626_0011729	Ga0495626_0011729_398_1423	324
52	3300050510	nmdc:mga06r32_437132_c1	nmdc:mga06r32_437132_c1_69_1085	324
53	3300025912	Ga0207707_10253733	Ga0207707_102537331	325
54	iso_pu_bacteria	2511231017	2511331195	325
55	iso_pu_bacteria	2808606377	2808933513	325
56	iso_pu_bacteria	2808606381	2808955635	325
57	iso_pu_bacteria	2904483920	2904489925	325
58	iso_pu_bacteria	2919697872	2919704039	325
59	iso_pu_bacteria	8019775933	8019778160	325
60	3300005356	Ga0070674_100255535	Ga0070674_1002555351	326
61	3300005459	Ga0068867_100113682	Ga0068867_1001136822	326
62	3300013105	Ga0157369_10324536	Ga0157369_103245362	326
63	3300025937	Ga0207669_10231200	Ga0207669_102312002	326
64	3300026089	Ga0207648_10128952	Ga0207648_101289523	326
65	3300028380	Ga0268265_10234957	Ga0268265_102349572	326
66	3300041491	Ga0451833_0445043	Ga0451833_0445043_58_1074	326
67	3300042010	Ga0439452_028219	Ga0439452_028219_285_1307	326
68	3300042016	Ga0439463_028440	Ga0439463_028440_52_1074	326
69	3300046452	Ga0495617_000135	Ga0495617_000135_46214_47236	326
70	3300046474	Ga0495605_0056750	Ga0495605_0056750_454_1476	326
71	3300046501	Ga0495607_0000584	Ga0495607_0000584_20351_21373	326
72	3300046522	Ga0495643_0054708	Ga0495643_0054708_412_1434	326
73	3300046538	Ga0495609_0027279	Ga0495609_0027279_496_1518	326
74	3300046648	Ga0495611_0004791	Ga0495611_0004791_456_1478	326
75	3300046664	Ga0495659_0107919	Ga0495659_0107919_48_1070	326
76	3300046794	Ga0495589_0058344	Ga0495589_0058344_472_1494	326
77	3300047318	Ga0495636_0000366	Ga0495636_0000366_15560_16582	326
78	3300047320	Ga0495672_0030558	Ga0495672_0030558_1093_2115	326
79	3300047469	Ga0495673_0003516	Ga0495673_0003516_8793_9815	326
80	3300048091	Ga0495626_0000033	Ga0495626_0000033_145681_146703	326
81	iso_pu_bacteria	2835312727	2835316248	326
82	3300003762	Ga0055542_1005107	Ga0055542_10051075	327
83	3300005435	Ga0070714_100367060	Ga0070714_1003670601	327
84	3300005440	Ga0070705_100075565	Ga0070705_1000755652	327
85	3300005444	Ga0070694_100109439	Ga0070694_1001094392	327
86	3300005445	Ga0070708_100094215	Ga0070708_1000942153	327
87	3300005518	Ga0070699_100256009	Ga0070699_1002560092	327
88	3300005536	Ga0070697_100027575	Ga0070697_1000275757	327
89	3300005545	Ga0070695_100122916	Ga0070695_1001229161	327
90	3300005546	Ga0070696_100008474	Ga0070696_1000084747	327
91	3300006914	Ga0075436_100044274	Ga0075436_1000442742	327
92	3300006914	Ga0075436_100128413	Ga0075436_1001284132	327
93	3300025254	Ga0209148_1002881	Ga0209148_10028817	327
94	3300025906	Ga0207699_10178037	Ga0207699_101780371	327
95	3300025929	Ga0207664_10348861	Ga0207664_103488612	327
96	3300025939	Ga0207665_10131200	Ga0207665_101312002	327
97	3300035114	Ga0373939_0042065	Ga0373939_0042065_307_1332	327
98	3300037312	Ga0395899_0002337	Ga0395899_0002337_4283_5308	327
99	3300037312	Ga0395899_0004477	Ga0395899_0004477_7876_8901	327
100	3300037418	Ga0395900_0003711	Ga0395900_0003711_4215_5240	327
101	3300037418	Ga0395900_0004701	Ga0395900_0004701_4080_5105	327
102	3300037418	Ga0395900_0096549	Ga0395900_0096549_1926_2951	327
103	3300037466	Ga0395898_0061560	Ga0395898_0061560_960_1985	327
104	3300037466	Ga0395898_0074430	Ga0395898_0074430_277_1302	327
105	3300037466	Ga0395898_0133955	Ga0395898_0133955_320_1345	327
106	3300037471	Ga0395905_0040770	Ga0395905_0040770_1914_2939	327
107	3300037471	Ga0395905_0171266	Ga0395905_0171266_123_1148	327
108	3300038443	Ga0395901_0033837	Ga0395901_0033837_2093_3118	327
109	3300044658	Ga0466972_0021152	Ga0466972_0021152_827_1852	327
110	3300044683	Ga0466965_0007480	Ga0466965_0007480_1989_3014	327
111	3300044706	Ga0466964_0010505	Ga0466964_0010505_99_1124	327
112	3300044735	Ga0466968_0003848	Ga0466968_0003848_4333_5358	327
113	3300044765	Ga0466970_0080091	Ga0466970_0080091_460_1485	327
114	3300044842	Ga0466957_0050875	Ga0466957_0050875_879_1904	327
115	3300045976	Ga0466967_0332208	Ga0466967_0332208_331_1356	327
116	3300046474	Ga0495605_0100250	Ga0495605_0100250_162_1187	327
117	3300046474	Ga0495605_0101750	Ga0495605_0101750_197_1222	327
118	3300046491	Ga0495584_0048200	Ga0495584_0048200_172_1197	327
119	3300046491	Ga0495584_0095924	Ga0495584_0095924_171_1196	327
120	3300046492	Ga0495585_0012303	Ga0495585_0012303_364_1389	327
121	3300046492	Ga0495585_0105200	Ga0495585_0105200_401_1426	327
122	3300046500	Ga0495596_0027062	Ga0495596_0027062_996_2021	327
123	3300046506	Ga0495583_0002115	Ga0495583_0002115_6175_7200	327
124	3300046506	Ga0495583_0010193	Ga0495583_0010193_1528_2553	327
125	3300046506	Ga0495583_0028541	Ga0495583_0028541_1665_2690	327
126	3300046513	Ga0495616_0086263	Ga0495616_0086263_179_1204	327
127	3300046513	Ga0495616_0118128	Ga0495616_0118128_109_1134	327
128	3300046518	Ga0495631_0052661	Ga0495631_0052661_167_1192	327
129	3300046520	Ga0495637_0043432	Ga0495637_0043432_242_1267	327
130	3300046520	Ga0495637_0052126	Ga0495637_0052126_65_1090	327
131	3300046522	Ga0495643_0035196	Ga0495643_0035196_1366_2391	327
132	3300046528	Ga0495642_0063279	Ga0495642_0063279_393_1418	327
133	3300046530	Ga0495654_0105401	Ga0495654_0105401_145_1170	327
134	3300046538	Ga0495609_0081174	Ga0495609_0081174_279_1304	327
135	3300046542	Ga0495597_0009453	Ga0495597_0009453_139_1164	327
136	3300046542	Ga0495597_0076780	Ga0495597_0076780_246_1271	327
137	3300046616	Ga0495668_0003746	Ga0495668_0003746_6295_7320	327
138	3300046616	Ga0495668_0037867	Ga0495668_0037867_845_1870	327
139	3300046616	Ga0495668_0119424	Ga0495668_0119424_360_1385	327
140	3300046616	Ga0495668_0195185	Ga0495668_0195185_64_1089	327
141	3300046648	Ga0495611_0073725	Ga0495611_0073725_166_1191	327
142	3300046663	Ga0495635_0155733	Ga0495635_0155733_346_1371	327
143	3300046665	Ga0495661_0024423	Ga0495661_0024423_1795_2820	327
144	3300046665	Ga0495661_0120530	Ga0495661_0120530_145_1170	327
145	3300046665	Ga0495661_0165770	Ga0495661_0165770_94_1119	327
146	3300046692	Ga0495671_0000091	Ga0495671_0000091_69827_70852	327
147	3300046694	Ga0495649_0082711	Ga0495649_0082711_589_1614	327
148	3300046794	Ga0495589_0010950	Ga0495589_0010950_3604_4629	327
149	3300046810	Ga0495660_0049825	Ga0495660_0049825_1094_2119	327
150	3300046810	Ga0495660_0055846	Ga0495660_0055846_820_1845	327
151	3300047317	Ga0495604_0034014	Ga0495604_0034014_931_1956	327
152	3300047322	Ga0495680_0004824	Ga0495680_0004824_8394_9419	327
153	3300047323	Ga0495683_0011138	Ga0495683_0011138_3652_4677	327
154	3300047323	Ga0495683_0077766	Ga0495683_0077766_214_1239	327
155	3300047443	Ga0495687_000095	Ga0495687_000095_53465_54490	327
156	3300047443	Ga0495687_017727	Ga0495687_017727_1699_2724	327
157	3300047445	Ga0495677_0085179	Ga0495677_0085179_110_1135	327
158	3300047470	Ga0495681_0022458	Ga0495681_0022458_922_1947	327
159	3300048089	Ga0495614_0001351	Ga0495614_0001351_1118_2143	327
160	3300048089	Ga0495614_0064309	Ga0495614_0064309_190_1215	327
161	3300048091	Ga0495626_0004280	Ga0495626_0004280_2241_3266	327
162	3300048091	Ga0495626_0053260	Ga0495626_0053260_133_1158	327
163	3300048091	Ga0495626_0075017	Ga0495626_0075017_342_1367	327
164	3300048903	Ga0496100_0261477	Ga0496100_0261477_207_1232	327
165	3300048905	Ga0496102_0330608	Ga0496102_0330608_102_1127	327
166	3300048913	Ga0496110_0358081	Ga0496110_0358081_273_1298	327
167	3300048925	Ga0496122_0078508	Ga0496122_0078508_273_1298	327
168	3300048926	Ga0496123_0091454	Ga0496123_0091454_490_1515	327
169	3300050514	nmdc:mga08x19_118552_c1	nmdc:mga08x19_118552_c1_116_1141	327
170	3300050514	nmdc:mga08x19_44493_c1	nmdc:mga08x19_44493_c1_158_1183	327
171	iso_pu_bacteria	2508501114	2509076275	327
172	iso_pu_bacteria	2508501114	2509076526	327
173	iso_pu_bacteria	2775506901	2776262921	327
174	iso_pu_bacteria	2775506901	2776263098	327
175	iso_pu_bacteria	2775506901	2776263447	327
176	iso_pu_bacteria	2775506901	2776265462	327
177	iso_pu_bacteria	2775506901	2776265693	327
178	iso_pu_bacteria	2775506901	2776266709	327
179	iso_pu_bacteria	2775506902	2776267023	327
180	3300005355	Ga0070671_100271620	Ga0070671_1002716201	328
181	3300025931	Ga0207644_10246804	Ga0207644_102468042	328
182	3300002067	JGI24735J21928_10004004	JGI24735J21928_100040041	329
183	3300002737	JGI25162J39368_1004530	JGI25162J39368_10045302	329
184	3300002737	JGI25162J39368_1006429	JGI25162J39368_10064291	329
185	3300002737	JGI25162J39368_1008197	JGI25162J39368_10081971	329
186	3300003214	JGI25165J46597_1007823	JGI25165J46597_10078232	329
187	3300003320	rootH2_10132043	rootH2_101320432	329
188	3300003322	rootL2_10366593	rootL2_103665931	329
189	3300003756	Ga0055533_1000541	Ga0055533_100054116	329
190	3300005328	Ga0070676_10136323	Ga0070676_101363232	329
191	3300005335	Ga0070666_10089286	Ga0070666_100892862	329
192	3300005338	Ga0068868_100284149	Ga0068868_1002841492	329
193	3300005347	Ga0070668_100242294	Ga0070668_1002422941	329
194	3300005353	Ga0070669_100273562	Ga0070669_1002735621	329
195	3300005354	Ga0070675_100200549	Ga0070675_1002005491	329
196	3300005364	Ga0070673_100182105	Ga0070673_1001821051	329
197	3300005365	Ga0070688_100106568	Ga0070688_1001065683	329
198	3300005367	Ga0070667_100158096	Ga0070667_1001580961	329
199	3300005456	Ga0070678_100214934	Ga0070678_1002149342	329
200	3300005457	Ga0070662_100189049	Ga0070662_1001890492	329
201	3300005459	Ga0068867_100176571	Ga0068867_1001765712	329
202	3300005471	Ga0070698_100286042	Ga0070698_1002860422	329
203	3300005539	Ga0068853_100230349	Ga0068853_1002303493	329
204	3300005543	Ga0070672_100140216	Ga0070672_1001402162	329
205	3300005616	Ga0068852_100022690	Ga0068852_1000226906	329
206	3300005617	Ga0068859_100373842	Ga0068859_1003738421	329
207	3300005842	Ga0068858_100090749	Ga0068858_1000907495	329
208	3300006237	Ga0097621_100276264	Ga0097621_1002762642	329
209	3300006358	Ga0068871_100269626	Ga0068871_1002696261	329
210	3300006871	Ga0075434_100339669	Ga0075434_1003396692	329
211	3300006881	Ga0068865_100228983	Ga0068865_1002289831	329
212	3300006931	Ga0097620_100373864	Ga0097620_1003738642	329
213	3300009093	Ga0105240_10015051	Ga0105240_100150518	329
214	3300009177	Ga0105248_10243818	Ga0105248_102438181	329
215	3300009545	Ga0105237_10007576	Ga0105237_100075767	329
216	3300009551	Ga0105238_10267741	Ga0105238_102677411	329
217	3300013100	Ga0157373_10053752	Ga0157373_100537524	329
218	3300013100	Ga0157373_10159153	Ga0157373_101591531	329
219	3300013297	Ga0157378_10185278	Ga0157378_101852781	329
220	3300013306	Ga0163162_10248133	Ga0163162_102481332	329
221	3300014497	Ga0182008_10000499	Ga0182008_100004993	329
222	3300014497	Ga0182008_10043008	Ga0182008_100430081	329
223	3300014969	Ga0157376_10273515	Ga0157376_102735152	329
224	3300015261	Ga0182006_1067940	Ga0182006_10679401	329
225	3300015262	Ga0182007_10036418	Ga0182007_100364181	329
226	3300015262	Ga0182007_10041420	Ga0182007_100414201	329
227	3300015262	Ga0182007_10057418	Ga0182007_100574182	329
228	3300015265	Ga0182005_1000214	Ga0182005_100021410	329
229	3300015265	Ga0182005_1014199	Ga0182005_10141991	329
230	3300015265	Ga0182005_1039879	Ga0182005_10398792	329
231	3300017792	Ga0163161_10216731	Ga0163161_102167311	329
232	3300021361	Ga0213872_10084385	Ga0213872_100843851	329
233	3300025226	Ga0209674_100130	Ga0209674_10013023	329
234	3300025233	Ga0209437_101423	Ga0209437_1014237	329
235	3300025233	Ga0209437_112578	Ga0209437_1125781	329
236	3300025261	Ga0209233_1005945	Ga0209233_10059457	329
237	3300025292	Ga0209676_1001239	Ga0209676_10012393	329
238	3300025711	Ga0207696_1018526	Ga0207696_10185263	329
239	3300025735	Ga0207713_1000293	Ga0207713_100029315	329
240	3300025903	Ga0207680_10168065	Ga0207680_101680651	329
241	3300025913	Ga0207695_10001196	Ga0207695_100011969	329
242	3300025914	Ga0207671_10006002	Ga0207671_100060027	329
243	3300025924	Ga0207694_10076767	Ga0207694_100767673	329
244	3300025926	Ga0207659_10165300	Ga0207659_101653001	329
245	3300025933	Ga0207706_10191607	Ga0207706_101916071	329
246	3300025937	Ga0207669_10077581	Ga0207669_100775812	329
247	3300025940	Ga0207691_10136499	Ga0207691_101364992	329
248	3300025941	Ga0207711_10210991	Ga0207711_102109912	329
249	3300025949	Ga0207667_10002218	Ga0207667_1000221822	329
250	3300025972	Ga0207668_10125925	Ga0207668_101259252	329
251	3300025986	Ga0207658_10228158	Ga0207658_102281581	329
252	3300026041	Ga0207639_10353553	Ga0207639_103535531	329
253	3300026089	Ga0207648_10062851	Ga0207648_100628512	329
254	3300026118	Ga0207675_100066212	Ga0207675_1000662122	329
255	3300026121	Ga0207683_10261481	Ga0207683_102614811	329
256	3300026142	Ga0207698_10027142	Ga0207698_100271423	329
257	3300027907	Ga0207428_10010701	Ga0207428_100107015	329
258	3300027907	Ga0207428_10231829	Ga0207428_102318291	329
259	3300031251	Ga0265327_10086931	Ga0265327_100869311	329
260	3300031691	Ga0316579_10090328	Ga0316579_100903281	329
261	3300031727	Ga0316576_10222265	Ga0316576_102222651	329
262	3300031728	Ga0316578_10060601	Ga0316578_100606011	329
263	3300031728	Ga0316578_10098731	Ga0316578_100987312	329
264	3300031733	Ga0316577_10043610	Ga0316577_100436101	329
265	3300032005	Ga0307411_10136760	Ga0307411_101367603	329
266	3300032133	Ga0316583_10023960	Ga0316583_100239601	329
267	3300032137	Ga0316585_10014847	Ga0316585_100148471	329
268	3300032139	Ga0316580_10017922	Ga0316580_100179222	329
269	3300032139	Ga0316580_10039051	Ga0316580_100390512	329
270	3300032139	Ga0316580_10045402	Ga0316580_100454021	329
271	3300035398	Ga0316574_0031631	Ga0316574_0031631_111_1142	329
272	3300035398	Ga0316574_0124168	Ga0316574_0124168_161_1192	329
273	3300035398	Ga0316574_0209901	Ga0316574_0209901_199_1230	329
274	3300035692	Ga0373935_0162021	Ga0373935_0162021_197_1228	329
275	3300036647	Ga0316582_0112276	Ga0316582_0112276_185_1216	329
276	3300036647	Ga0316582_0185903	Ga0316582_0185903_153_1184	329
277	3300036712	Ga0316584_0161316	Ga0316584_0161316_395_1426	329
278	3300036712	Ga0316584_0207229	Ga0316584_0207229_302_1333	329
279	3300037588	Ga0316581_0040268	Ga0316581_0040268_119_1150	329
280	3300039438	Ga0436360_1166408	Ga0436360_1166408_311_1342	329
281	3300039447	Ga0436361_0351898	Ga0436361_0351898_409_1440	329
282	3300041405	Ga0439438_025206	Ga0439438_025206_384_1415	329
283	3300041407	Ga0439447_026065	Ga0439447_026065_185_1216	329
284	3300041411	Ga0439466_0044980	Ga0439466_0044980_303_1334	329
285	3300042010	Ga0439452_000462	Ga0439452_000462_5871_6902	329
286	3300046452	Ga0495617_042481	Ga0495617_042481_275_1306	329
287	3300046453	Ga0495627_036856	Ga0495627_036856_327_1358	329
288	3300046453	Ga0495627_042848	Ga0495627_042848_245_1276	329
289	3300046457	Ga0495590_0000016	Ga0495590_0000016_80970_82001	329
290	3300046457	Ga0495590_0000531	Ga0495590_0000531_90_1121	329
291	3300046458	Ga0495591_001023	Ga0495591_001023_249_1280	329
292	3300046460	Ga0495638_0008420	Ga0495638_0008420_4076_5107	329
293	3300046460	Ga0495638_0039674	Ga0495638_0039674_1588_2619	329
294	3300046460	Ga0495638_0109713	Ga0495638_0109713_491_1522	329
295	3300046472	Ga0495580_0002542	Ga0495580_0002542_304_1335	329
296	3300046474	Ga0495605_0007129	Ga0495605_0007129_3080_4111	329
297	3300046475	Ga0495639_0021271	Ga0495639_0021271_1168_2199	329
298	3300046491	Ga0495584_0034298	Ga0495584_0034298_453_1484	329
299	3300046492	Ga0495585_0000229	Ga0495585_0000229_24765_25796	329
300	3300046492	Ga0495585_0096260	Ga0495585_0096260_234_1265	329
301	3300046492	Ga0495585_0113595	Ga0495585_0113595_282_1313	329
302	3300046507	Ga0495606_0000048	Ga0495606_0000048_13191_14222	329
303	3300046507	Ga0495606_0001496	Ga0495606_0001496_29955_30986	329
304	3300046512	Ga0495610_0031365	Ga0495610_0031365_1106_2137	329
305	3300046512	Ga0495610_0056985	Ga0495610_0056985_781_1812	329
306	3300046512	Ga0495610_0089286	Ga0495610_0089286_275_1306	329
307	3300046513	Ga0495616_0055697	Ga0495616_0055697_352_1383	329
308	3300046523	Ga0495644_0046368	Ga0495644_0046368_399_1430	329
309	3300046524	Ga0495648_0000001	Ga0495648_0000001_695123_696154	329
310	3300046524	Ga0495648_0000495	Ga0495648_0000495_249_1280	329
311	3300046524	Ga0495648_0008262	Ga0495648_0008262_6967_7998	329
312	3300046530	Ga0495654_0010271	Ga0495654_0010271_3643_4674	329
313	3300046535	Ga0495586_0137202	Ga0495586_0137202_23_1054	329
314	3300046536	Ga0495587_0143114	Ga0495587_0143114_232_1263	329
315	3300046538	Ga0495609_0000310	Ga0495609_0000310_1499_2530	329
316	3300046538	Ga0495609_0007386	Ga0495609_0007386_4237_5268	329
317	3300046542	Ga0495597_0066660	Ga0495597_0066660_131_1162	329
318	3300046557	Ga0495622_0000024	Ga0495622_0000024_66639_67670	329
319	3300046557	Ga0495622_0002799	Ga0495622_0002799_7205_8236	329
320	3300046557	Ga0495622_0061443	Ga0495622_0061443_396_1427	329
321	3300046558	Ga0495633_0000106	Ga0495633_0000106_55508_56539	329
322	3300046615	Ga0495656_0061788	Ga0495656_0061788_19_1050	329
323	3300046616	Ga0495668_0000288	Ga0495668_0000288_30544_31575	329
324	3300046616	Ga0495668_0000686	Ga0495668_0000686_271_1302	329
325	3300046616	Ga0495668_0025134	Ga0495668_0025134_857_1888	329
326	3300046660	Ga0495625_0000035	Ga0495625_0000035_156685_157716	329
327	3300046660	Ga0495625_0001176	Ga0495625_0001176_14099_15130	329
328	3300046660	Ga0495625_0008166	Ga0495625_0008166_749_1780	329
329	3300046660	Ga0495625_0062600	Ga0495625_0062600_32_1063	329
330	3300046660	Ga0495625_0109425	Ga0495625_0109425_50_1081	329
331	3300046660	Ga0495625_0111919	Ga0495625_0111919_287_1318	329
332	3300046660	Ga0495625_0182645	Ga0495625_0182645_273_1304	329
333	3300046665	Ga0495661_0041604	Ga0495661_0041604_660_1691	329
334	3300046680	Ga0495646_0025108	Ga0495646_0025108_2150_3181	329
335	3300046684	Ga0495669_0118654	Ga0495669_0118654_129_1160	329
336	3300046691	Ga0495670_0046987	Ga0495670_0046987_113_1144	329
337	3300046692	Ga0495671_0003161	Ga0495671_0003161_8633_9664	329
338	3300046692	Ga0495671_0090117	Ga0495671_0090117_123_1154	329
339	3300046694	Ga0495649_0076982	Ga0495649_0076982_406_1437	329
340	3300046810	Ga0495660_0000118	Ga0495660_0000118_82613_83644	329
341	3300046810	Ga0495660_0004005	Ga0495660_0004005_4172_5203	329
342	3300047319	Ga0495674_0152222	Ga0495674_0152222_312_1343	329
343	3300047320	Ga0495672_0037440	Ga0495672_0037440_314_1345	329
344	3300047323	Ga0495683_0003267	Ga0495683_0003267_2113_3222	329
345	3300047323	Ga0495683_0042805	Ga0495683_0042805_1038_2069	329
346	3300047443	Ga0495687_025527	Ga0495687_025527_725_1756	329
347	3300047444	Ga0495675_0038253	Ga0495675_0038253_1921_2952	329
348	3300047445	Ga0495677_0039568	Ga0495677_0039568_305_1336	329
349	3300047469	Ga0495673_0023317	Ga0495673_0023317_312_1343	329
350	3300047469	Ga0495673_0078398	Ga0495673_0078398_295_1326	329
351	3300047472	Ga0495686_0002934	Ga0495686_0002934_687_1718	329
352	3300047472	Ga0495686_0068749	Ga0495686_0068749_372_1403	329
353	3300047472	Ga0495686_0107527	Ga0495686_0107527_326_1357	329
354	3300048088	Ga0495602_0210567	Ga0495602_0210567_176_1396	329
355	3300048091	Ga0495626_0000031	Ga0495626_0000031_136483_137514	329
356	3300048091	Ga0495626_0003670	Ga0495626_0003670_5481_6512	329
357	3300048906	Ga0496103_0001817	Ga0496103_0001817_3016_4047	329
358	3300048913	Ga0496110_0233971	Ga0496110_0233971_436_1467	329
359	3300048914	Ga0496111_0061605	Ga0496111_0061605_1398_2429	329
360	3300048915	Ga0496112_0269803	Ga0496112_0269803_60_1091	329
361	3300048916	Ga0496113_0070764	Ga0496113_0070764_1003_2034	329
362	3300048918	Ga0496115_0001986	Ga0496115_0001986_556_1587	329
363	3300048918	Ga0496115_0079275	Ga0496115_0079275_365_1396	329
364	3300048920	Ga0496117_0017323	Ga0496117_0017323_1582_2613	329
365	3300048921	Ga0496118_0001676	Ga0496118_0001676_3467_4498	329
366	3300048925	Ga0496122_0092406	Ga0496122_0092406_715_1746	329
367	3300048929	Ga0496126_0072669	Ga0496126_0072669_618_1649	329
368	3300049459	Ga0495678_001383	Ga0495678_001383_12260_13291	329
369	3300049459	Ga0495678_059684	Ga0495678_059684_134_1165	329
370	3300049460	Ga0495682_0058533	Ga0495682_0058533_92_1123	329
371	3300049460	Ga0495682_0058813	Ga0495682_0058813_88_1119	329
372	3300049665	Ga0501227_001703	Ga0501227_001703_2752_3783	329
373	3300050512	nmdc:mga0n895_330840_c1	nmdc:mga0n895_330840_c1_209_1240	329
374	3300050513	nmdc:mga0rr50_190315_c1	nmdc:mga0rr50_190315_c1_596_1627	329
375	3300053077	Ga0495601_0077037	Ga0495601_0077037_96_1127	329
376	3300053108	Ga0500562_012101	Ga0500562_012101_690_1721	329
377	3300053145	Ga0500586_011877	Ga0500586_011877_95_1126	329
378	3300003781	Ga0055536_1019069	Ga0055536_10190691	330
379	3300005441	Ga0070700_100113776	Ga0070700_1001137762	330
380	3300005545	Ga0070695_100123007	Ga0070695_1001230072	330
381	3300017792	Ga0163161_10159090	Ga0163161_101590901	330
382	3300021361	Ga0213872_10032056	Ga0213872_100320564	330
383	3300025292	Ga0209676_1012376	Ga0209676_10123762	330
384	3300025294	Ga0209025_1054480	Ga0209025_10544801	330
385	3300025925	Ga0207650_10310035	Ga0207650_103100352	330
386	3300026075	Ga0207708_10244380	Ga0207708_102443801	330
387	3300031665	Ga0316575_10059026	Ga0316575_100590262	330
388	3300031691	Ga0316579_10023859	Ga0316579_100238591	330
389	3300031691	Ga0316579_10103321	Ga0316579_101033211	330
390	3300031727	Ga0316576_10142322	Ga0316576_101423221	330
391	3300031727	Ga0316576_10153981	Ga0316576_101539811	330
392	3300031727	Ga0316576_10181707	Ga0316576_101817071	330
393	3300031728	Ga0316578_10064519	Ga0316578_100645191	330
394	3300031728	Ga0316578_10114987	Ga0316578_101149872	330
395	3300031728	Ga0316578_10138370	Ga0316578_101383701	330
396	3300031733	Ga0316577_10051083	Ga0316577_100510832	330
397	3300031733	Ga0316577_10095487	Ga0316577_100954871	330
398	3300032133	Ga0316583_10055556	Ga0316583_100555561	330
399	3300032137	Ga0316585_10016097	Ga0316585_100160971	330
400	3300032137	Ga0316585_10024697	Ga0316585_100246972	330
401	3300032139	Ga0316580_10034782	Ga0316580_100347822	330
402	3300032139	Ga0316580_10043390	Ga0316580_100433901	330
403	3300035398	Ga0316574_0144743	Ga0316574_0144743_101_1135	330
404	3300036647	Ga0316582_0014338	Ga0316582_0014338_1215_2249	330
405	3300036647	Ga0316582_0099492	Ga0316582_0099492_305_1339	330
406	3300036712	Ga0316584_0103657	Ga0316584_0103657_135_1169	330
407	3300036712	Ga0316584_0156310	Ga0316584_0156310_350_1384	330
408	3300039447	Ga0436361_0285595	Ga0436361_0285595_16_1053	330
409	3300041413	Ga0439465_0026006	Ga0439465_0026006_551_1585	330
410	3300042001	Ga0439441_016405	Ga0439441_016405_162_1196	330
411	3300042007	Ga0439449_0070379	Ga0439449_0070379_208_1242	330
412	3300042010	Ga0439452_014375	Ga0439452_014375_1112_2146	330
413	3300042461	Ga0439460_0029932	Ga0439460_0029932_117_1151	330
414	3300046513	Ga0495616_0000798	Ga0495616_0000798_667_1773	330
415	3300046615	Ga0495656_0093241	Ga0495656_0093241_15_1124	330
416	3300000546	LJNas_1005104	LJNas_10051041	331
417	3300005366	Ga0070659_100254183	Ga0070659_1002541831	331
418	3300005455	Ga0070663_100252719	Ga0070663_1002527191	331
419	3300005549	Ga0070704_100175960	Ga0070704_1001759602	331
420	3300006058	Ga0075432_10061081	Ga0075432_100610811	331
421	3300006175	Ga0070712_100185503	Ga0070712_1001855031	331
422	3300013306	Ga0163162_10025949	Ga0163162_100259499	331
423	3300025925	Ga0207650_10202033	Ga0207650_102020331	331
424	3300025933	Ga0207706_10324571	Ga0207706_103245711	331
425	3300026023	Ga0207677_10206407	Ga0207677_102064072	331
426	3300026118	Ga0207675_100345504	Ga0207675_1003455041	331
427	3300046557	Ga0495622_0000198	Ga0495622_0000198_37021_38076	331
428	3300048919	Ga0496116_0023256	Ga0496116_0023256_1151_2185	331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

276

362

0.93 PF01548

DEDD_Tnp_IS110

Transposase

69

212

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4g4j-assembly1.cif.gz_A	crystal structure of glucuronoyl esterase s213a mutant from sporotrichum thermophile in complex with methyl 4-o-methyl-beta-d-glucopyranuronate determined at 2.35 a resolution	0.7806	1	32
7krj-assembly1.cif.gz_C	the gr-maturation complex: glucocorticoid receptor in complex with hsp90 and co-chaperone p23	0.7404	2	34
7us3-assembly1.cif.gz_B	structure of putrescine n-hydroxylase involved complexed with nadp+	0.7004	9	33
6xu6-assembly1.cif.gz_Ck	drosophila melanogaster testis 80s ribosome	0.6956	1	50
7oyc-assembly1.cif.gz_k1	cryo-em structure of the xenopus egg 80s ribosome	0.6912	1	52

ID	Description	Score	Start	End	Superfamily
2awoD03	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.8358	9	34	2.40.50.140
af_Q5PQL9_1_114_2.60.40.790	Mainly Beta;Sandwich;Immunoglobulin-like;	0.807	7	34	2.60.40.790
af_O44771_122_233_2.170.16.10	Mainly Beta;Beta Complex;Endonuclease - Pi-scei; Chain A, domain 1;Hedgehog/Intein (Hint) domain	0.7895	9	34	2.170.16.10
1ejfB00	Mainly Beta;Sandwich;Immunoglobulin-like;	0.7781	7	34	2.60.40.790
af_P0A9G8_108_183_2.40.50.100	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain	0.7777	9	38	2.40.50.100

ID	Description	Score	Start	End	GO Terms
AF-A0A4Q2ZQ18-F1-model_v4	Transposase	0.9785	4	114	GO:0003677 GO:0004803 GO:0006313
AF-A0A4Q7FBF0-F1-model_v4	IS110 family transposase	0.9746	31	107
AF-A0A512E3M6-F1-model_v4	Transposase IS110-like N-terminal domain-containing protein	0.968	3	118	GO:0003677 GO:0004803 GO:0006313
AF-A0A372ET60-F1-model_v4	Transposase	0.9658	3	108
AF-A0A7X0DIE4-F1-model_v4	Transposase	0.9654	6	72

Feature Viewer

pLDDT	pTM	Quality
85.08	0.81	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F441751

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

276

362

0.93

PF01548

DEDD_Tnp_IS110

Transposase

69

212

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map