F441726
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 428 | 262 | 410 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0000019|Ga0466972_0000019_147102_148235 |
| Length | 377 |
| Sequence | VWWLVSEKRFWCAFREDVGLFYTSRCFGIIFKHGMSVILICMLNGIKEKKRLRIFTWHIHGSYLYYLSQGNYDIYIPVNAEKTEGYYGRGTTFPFGPNVIEVPAAEVRNLSFDCILFQTARNFLTDQYELLSEEQRQLPRVYLEHDPPTKHPTEMRHVMDDPEVCLVHVTHFNKLMWLSDVPKVRVIDHGVMPPPAVYTGELEKGIVVVNNLHKRGRRLGPDVFEEVSRQVPLDLVGMGTAEFGGLGEVLHPDLPAFIARYRFFFNPIRYTSLGLAVLEAMMQGIPVVALASTEYTTVIRDGESGFIHTDIDYLVKQMHVLLENRDLAFRLGQAGKRTAEERFNIRRFVNDWEQLFHWTIHNSNNTETYEKKNSLYQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 2 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 3 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 4 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 5 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 6 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 7 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 8 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 9 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 10 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 11 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 12 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 13 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 14 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 15 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 16 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 17 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 26 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 146 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 158 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 159 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 160 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 161 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 162 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 163 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 168 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 169 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 170 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 171 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 172 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 235 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 236 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 237 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 245 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 246 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 247 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 248 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 249 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 252 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 253 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 254 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 257 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 258 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 259 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 260 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 261 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 262 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.16 |
| Metatranscriptomes | 1.4 |
| Isolates | 4.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.64 |
| Nodule | 1.87 |
| Rhizoplane | 1.64 |
| Rhizosphere | 78.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000245 | 3300001915 | Bacteria | 16148 |
| 2 | JGI24740J21852_10000057 | 3300001979 | Bacteria | 35487 |
| 3 | JGI24740J21852_10026559 | 3300001979 | Bacteria | 1938 |
| 4 | JGI24735J21928_10059275 | 3300002067 | Bacteria | 1100 |
| 5 | JGI25156J39149_1005017 | 3300002705 | Bacteria | 3908 |
| 6 | rootH2_10004104 | 3300003320 | Bacteria | 2963 |
| 7 | rootH2_10085773 | 3300003320 | Bacteria | 7516 |
| 8 | rootL2_10006832 | 3300003322 | Unclassified | 3943 |
| 9 | rootL2_10045368 | 3300003322 | Bacteria | 2119 |
| 10 | rootL2_10066415 | 3300003322 | Unclassified | 3537 |
| 11 | rootL2_10080456 | 3300003322 | Bacteria | 10017 |
| 12 | rootL2_10181898 | 3300003322 | Bacteria | 4281 |
| 13 | rootL2_10264817 | 3300003322 | Bacteria | 1465 |
| 14 | rootH1_10002268 | 3300003316 | Bacteria | 14703 |
| 15 | rootH1_10002268 | 3300003323 | Bacteria | 96736 |
| 16 | rootH1_10053766 | 3300003323 | Bacteria | 2714 |
| 17 | rootH1_10066961 | 3300003323 | Bacteria | 7488 |
| 18 | rootH1_10069593 | 3300003323 | Unclassified | 4483 |
| 19 | rootH1_10071396 | 3300003323 | Bacteria | 2280 |
| 20 | rootH1_10071397 | 3300003323 | Bacteria | 4069 |
| 21 | JGI25160J50197_1007970 | 3300003354 | Bacteria | 4078 |
| 22 | Ga0006562J51391_1172264 | 3300003578 | Bacteria | 3170 |
| 23 | Ga0006562J51391_1172265 | 3300003578 | Bacteria | 2880 |
| 24 | Ga0055538_1003988 | 3300003751 | Bacteria | 1754 |
| 25 | Ga0055539_1000168 | 3300003752 | Bacteria | 58108 |
| 26 | Ga0055532_1000033 | 3300003758 | Bacteria | 214652 |
| 27 | Ga0055525_1000264 | 3300003759 | Bacteria | 49985 |
| 28 | Ga0055527_1000464 | 3300003760 | Bacteria | 15635 |
| 29 | Ga0055527_1003195 | 3300003760 | Bacteria | 2502 |
| 30 | Ga0055535_1000024 | 3300003761 | Bacteria | 214652 |
| 31 | Ga0055529_1000044 | 3300003763 | Bacteria | 214652 |
| 32 | Ga0055526_1009925 | 3300003771 | Bacteria | 4505 |
| 33 | Ga0055528_1001249 | 3300003790 | Bacteria | 16142 |
| 34 | Ga0055541_1003465 | 3300003841 | Bacteria | 2964 |
| 35 | Ga0055541_1007868 | 3300003841 | Bacteria | 1727 |
| 36 | Ga0065165_1000056 | 3300005262 | Bacteria | 186730 |
| 37 | Ga0070658_10215235 | 3300005327 | Bacteria | 1624 |
| 38 | Ga0070683_100178981 | 3300005329 | Bacteria | 2013 |
| 39 | Ga0070683_100423276 | 3300005329 | Bacteria | 1270 |
| 40 | Ga0070670_100004367 | 3300005331 | Bacteria | 11835 |
| 41 | Ga0070670_100031302 | 3300005331 | Bacteria | 4581 |
| 42 | Ga0070670_100049080 | 3300005331 | Bacteria | 3630 |
| 43 | Ga0070670_100050606 | 3300005331 | Bacteria | 3569 |
| 44 | Ga0070677_10018237 | 3300005333 | Bacteria | 2525 |
| 45 | Ga0070666_10014800 | 3300005335 | Unclassified | 4972 |
| 46 | Ga0070666_10065036 | 3300005335 | Bacteria | 2474 |
| 47 | Ga0070680_100000801 | 3300005336 | Bacteria | 22167 |
| 48 | Ga0068868_100001671 | 3300005338 | Bacteria | 15159 |
| 49 | Ga0068868_100471233 | 3300005338 | Bacteria | 1095 |
| 50 | Ga0070660_100082117 | 3300005339 | Bacteria | 2530 |
| 51 | Ga0070660_100094583 | 3300005339 | Bacteria | 2361 |
| 52 | Ga0070661_100000027 | 3300005344 | Bacteria | 117972 |
| 53 | Ga0070675_100001354 | 3300005354 | Bacteria | 17922 |
| 54 | Ga0070675_100010623 | 3300005354 | Bacteria | 7196 |
| 55 | Ga0070671_100000812 | 3300005355 | Bacteria | 22612 |
| 56 | Ga0070673_100006283 | 3300005364 | Bacteria | 7708 |
| 57 | Ga0070673_100021066 | 3300005364 | Bacteria | 4716 |
| 58 | Ga0070673_100045781 | 3300005364 | Bacteria | 3395 |
| 59 | Ga0070667_100027353 | 3300005367 | Bacteria | 4744 |
| 60 | Ga0070714_100114237 | 3300005435 | Unclassified | 2395 |
| 61 | Ga0070663_100000004 | 3300005455 | Bacteria | 254839 |
| 62 | Ga0070663_100066855 | 3300005455 | Bacteria | 2605 |
| 63 | Ga0070678_100000748 | 3300005456 | Bacteria | 16259 |
| 64 | Ga0070681_10001223 | 3300005458 | Bacteria | 22355 |
| 65 | Ga0070681_10046958 | 3300005458 | Bacteria | 4317 |
| 66 | Ga0068867_100071791 | 3300005459 | Bacteria | 2590 |
| 67 | Ga0070679_100000103 | 3300005530 | Bacteria | 66004 |
| 68 | Ga0070679_100242667 | 3300005530 | Bacteria | 1759 |
| 69 | Ga0070679_100267001 | 3300005530 | Bacteria | 1666 |
| 70 | Ga0070684_100044152 | 3300005535 | Bacteria | 3853 |
| 71 | Ga0068853_100016590 | 3300005539 | Bacteria | 6065 |
| 72 | Ga0068853_100088130 | 3300005539 | Unclassified | 2724 |
| 73 | Ga0070672_100000880 | 3300005543 | Bacteria | 17997 |
| 74 | Ga0070693_100038087 | 3300005547 | Bacteria | 2685 |
| 75 | Ga0068855_100000145 | 3300005563 | Bacteria | 91452 |
| 76 | Ga0068855_100127787 | 3300005563 | Bacteria | 2905 |
| 77 | Ga0068855_100565059 | 3300005563 | Bacteria | 1230 |
| 78 | Ga0070664_100000041 | 3300005564 | Bacteria | 78215 |
| 79 | Ga0070664_100006755 | 3300005564 | Bacteria | 9251 |
| 80 | Ga0068857_100000360 | 3300005577 | Bacteria | 31775 |
| 81 | Ga0068854_100013300 | 3300005578 | Bacteria | 5397 |
| 82 | Ga0068854_100032258 | 3300005578 | Bacteria | 3643 |
| 83 | Ga0068854_100131590 | 3300005578 | Bacteria | 1911 |
| 84 | Ga0068856_100000004 | 3300005614 | Bacteria | 233761 |
| 85 | Ga0068856_100234523 | 3300005614 | Bacteria | 1850 |
| 86 | Ga0068852_100000427 | 3300005616 | Bacteria | 28012 |
| 87 | Ga0068852_100049168 | 3300005616 | Bacteria | 3606 |
| 88 | Ga0068852_100170616 | 3300005616 | Bacteria | 2039 |
| 89 | Ga0068852_100374144 | 3300005616 | Bacteria | 1396 |
| 90 | Ga0068864_100002867 | 3300005618 | Bacteria | 14245 |
| 91 | Ga0068851_10005120 | 3300005834 | Bacteria | 5944 |
| 92 | Ga0068851_10014458 | 3300005834 | Bacteria | 3747 |
| 93 | Ga0068870_10140292 | 3300005840 | Bacteria | 1413 |
| 94 | Ga0070717_10007143 | 3300006028 | Bacteria | 8276 |
| 95 | Ga0097621_100001319 | 3300006237 | Bacteria | 17077 |
| 96 | Ga0068871_100000793 | 3300006358 | Bacteria | 21236 |
| 97 | Ga0097620_100758129 | 3300006931 | Bacteria | 1059 |
| 98 | Ga0105240_10000950 | 3300009093 | Bacteria | 51619 |
| 99 | Ga0105240_10107911 | 3300009093 | Bacteria | 3374 |
| 100 | Ga0105240_10143216 | 3300009093 | Bacteria | 2856 |
| 101 | Ga0105240_10204570 | 3300009093 | Bacteria | 2312 |
| 102 | Ga0111539_10628492 | 3300009094 | Bacteria | 1250 |
| 103 | Ga0105245_10200299 | 3300009098 | Bacteria | 1917 |
| 104 | Ga0105241_10003363 | 3300009174 | Bacteria | 11912 |
| 105 | Ga0105241_10097145 | 3300009174 | Bacteria | 2335 |
| 106 | Ga0105248_10083942 | 3300009177 | Bacteria | 3583 |
| 107 | Ga0105248_10326356 | 3300009177 | Bacteria | 1729 |
| 108 | Ga0105237_10090904 | 3300009545 | Bacteria | 3042 |
| 109 | Ga0105238_10003851 | 3300009551 | Bacteria | 14899 |
| 110 | Ga0105238_10008429 | 3300009551 | Bacteria | 10319 |
| 111 | Ga0105238_10039827 | 3300009551 | Bacteria | 4764 |
| 112 | Ga0105239_10072218 | 3300010375 | Bacteria | 3793 |
| 113 | Ga0157373_10001236 | 3300013100 | Bacteria | 19545 |
| 114 | Ga0157373_10036359 | 3300013100 | Bacteria | 3535 |
| 115 | Ga0157373_10065298 | 3300013100 | Unclassified | 2575 |
| 116 | Ga0157371_10000028 | 3300013102 | Bacteria | 254964 |
| 117 | Ga0157371_10003005 | 3300013102 | Bacteria | 15665 |
| 118 | Ga0157371_10014215 | 3300013102 | Bacteria | 6017 |
| 119 | Ga0157370_10000002 | 3300013104 | Bacteria | 431400 |
| 120 | Ga0157370_10003373 | 3300013104 | Bacteria | 18784 |
| 121 | Ga0157370_10003659 | 3300013104 | Bacteria | 17970 |
| 122 | Ga0157370_10005278 | 3300013104 | Bacteria | 14516 |
| 123 | Ga0157370_10129956 | 3300013104 | Bacteria | 2350 |
| 124 | Ga0157369_10011153 | 3300013105 | Bacteria | 10216 |
| 125 | Ga0157369_10172064 | 3300013105 | Bacteria | 2282 |
| 126 | Ga0157374_10002290 | 3300013296 | Bacteria | 16117 |
| 127 | Ga0157374_10093626 | 3300013296 | Bacteria | 2869 |
| 128 | Ga0157374_10232548 | 3300013296 | Bacteria | 1811 |
| 129 | Ga0157378_10032133 | 3300013297 | Bacteria | 4636 |
| 130 | Ga0163162_10006681 | 3300013306 | Bacteria | 11190 |
| 131 | Ga0163162_10485636 | 3300013306 | Bacteria | 1366 |
| 132 | Ga0157372_10000065 | 3300013307 | Bacteria | 114576 |
| 133 | Ga0157372_10001086 | 3300013307 | Bacteria | 29610 |
| 134 | Ga0157372_10009931 | 3300013307 | Bacteria | 10124 |
| 135 | Ga0157372_10010097 | 3300013307 | Bacteria | 10030 |
| 136 | Ga0157372_10012311 | 3300013307 | Bacteria | 9116 |
| 137 | Ga0157372_10218190 | 3300013307 | Bacteria | 2211 |
| 138 | Ga0157375_10002016 | 3300013308 | Bacteria | 17524 |
| 139 | Ga0157375_10043126 | 3300013308 | Bacteria | 4373 |
| 140 | Ga0157375_10101573 | 3300013308 | Bacteria | 2959 |
| 141 | Ga0157376_10061113 | 3300014969 | Bacteria | 3166 |
| 142 | Ga0157376_10081728 | 3300014969 | Bacteria | 2775 |
| 143 | Ga0157376_10113906 | 3300014969 | Bacteria | 2385 |
| 144 | Ga0182006_1001420 | 3300015261 | Bacteria | 14485 |
| 145 | Ga0182006_1024091 | 3300015261 | Bacteria | 2513 |
| 146 | Ga0183361_10005 | 3300016635 | Bacteria | 413599 |
| 147 | Ga0197907_10996652 | 3300020069 | Bacteria | 1133 |
| 148 | Ga0197907_11202477 | 3300020069 | Bacteria | 1240 |
| 149 | Ga0154015_1036957 | 3300020610 | Bacteria | 1975 |
| 150 | Ga0224712_10001993 | 3300022467 | Bacteria | 4943 |
| 151 | Ga0209784_100024 | 3300025224 | Bacteria | 394613 |
| 152 | Ga0209784_102339 | 3300025224 | Bacteria | 1965 |
| 153 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 154 | Ga0209566_100725 | 3300025225 | Bacteria | 18620 |
| 155 | Ga0209674_100046 | 3300025226 | Bacteria | 357920 |
| 156 | Ga0209674_104647 | 3300025226 | Bacteria | 2190 |
| 157 | Ga0209672_100138 | 3300025228 | Bacteria | 70350 |
| 158 | Ga0209672_100179 | 3300025228 | Bacteria | 52004 |
| 159 | Ga0209672_100284 | 3300025228 | Bacteria | 36000 |
| 160 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 161 | Ga0209563_100039 | 3300025230 | Bacteria | 409717 |
| 162 | Ga0209563_100090 | 3300025230 | Bacteria | 169322 |
| 163 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 164 | Ga0209677_100024 | 3300025253 | Bacteria | 406035 |
| 165 | Ga0209759_1001093 | 3300025256 | Bacteria | 17598 |
| 166 | Ga0209759_1023777 | 3300025256 | Bacteria | 1340 |
| 167 | Ga0209455_1000042 | 3300025272 | Bacteria | 419638 |
| 168 | Ga0209673_1000014 | 3300025273 | Bacteria | 537082 |
| 169 | Ga0209673_1000018 | 3300025273 | Bacteria | 458281 |
| 170 | Ga0209758_1003372 | 3300025297 | Bacteria | 14629 |
| 171 | Ga0209758_1006043 | 3300025297 | Bacteria | 8929 |
| 172 | Ga0209050_1000539 | 3300025298 | Bacteria | 62759 |
| 173 | Ga0209257_1001417 | 3300025304 | Bacteria | 28547 |
| 174 | Ga0207656_10005505 | 3300025321 | Bacteria | 4480 |
| 175 | Ga0207656_10049860 | 3300025321 | Bacteria | 1806 |
| 176 | Ga0207682_10012501 | 3300025893 | Bacteria | 3312 |
| 177 | Ga0207680_10043316 | 3300025903 | Unclassified | 2639 |
| 178 | Ga0207680_10246984 | 3300025903 | Bacteria | 1231 |
| 179 | Ga0207645_10029883 | 3300025907 | Bacteria | 3512 |
| 180 | Ga0207643_10059192 | 3300025908 | Bacteria | 2185 |
| 181 | Ga0207705_10004703 | 3300025909 | Bacteria | 10294 |
| 182 | Ga0207705_10019022 | 3300025909 | Bacteria | 4913 |
| 183 | Ga0207705_10112255 | 3300025909 | Bacteria | 2015 |
| 184 | Ga0207707_10087284 | 3300025912 | Bacteria | 2726 |
| 185 | Ga0207695_10005156 | 3300025913 | Bacteria | 17498 |
| 186 | Ga0207695_10010294 | 3300025913 | Bacteria | 11450 |
| 187 | Ga0207695_10010513 | 3300025913 | Bacteria | 11320 |
| 188 | Ga0207695_10012734 | 3300025913 | Bacteria | 10070 |
| 189 | Ga0207695_10047815 | 3300025913 | Bacteria | 4523 |
| 190 | Ga0207671_10002522 | 3300025914 | Bacteria | 19505 |
| 191 | Ga0207660_10002419 | 3300025917 | Bacteria | 12260 |
| 192 | Ga0207649_10000685 | 3300025920 | Bacteria | 22462 |
| 193 | Ga0207649_10167351 | 3300025920 | Bacteria | 1528 |
| 194 | Ga0207652_10000098 | 3300025921 | Bacteria | 94858 |
| 195 | Ga0207652_10000187 | 3300025921 | Bacteria | 65282 |
| 196 | Ga0207652_10292202 | 3300025921 | Bacteria | 1470 |
| 197 | Ga0207652_10449467 | 3300025921 | Bacteria | 1162 |
| 198 | Ga0207694_10007359 | 3300025924 | Bacteria | 8350 |
| 199 | Ga0207694_10011325 | 3300025924 | Bacteria | 6732 |
| 200 | Ga0207694_10024624 | 3300025924 | Bacteria | 4572 |
| 201 | Ga0207650_10001544 | 3300025925 | Bacteria | 16496 |
| 202 | Ga0207650_10044292 | 3300025925 | Bacteria | 3269 |
| 203 | Ga0207650_10061177 | 3300025925 | Bacteria | 2811 |
| 204 | Ga0207659_10167308 | 3300025926 | Bacteria | 1731 |
| 205 | Ga0207659_10222135 | 3300025926 | Bacteria | 1519 |
| 206 | Ga0207644_10006588 | 3300025931 | Bacteria | 7565 |
| 207 | Ga0207691_10000467 | 3300025940 | Bacteria | 39953 |
| 208 | Ga0207691_10117960 | 3300025940 | Bacteria | 2354 |
| 209 | Ga0207711_10094518 | 3300025941 | Bacteria | 2635 |
| 210 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 211 | Ga0207679_10006057 | 3300025945 | Bacteria | 7625 |
| 212 | Ga0207667_10000508 | 3300025949 | Bacteria | 51422 |
| 213 | Ga0207667_10000519 | 3300025949 | Bacteria | 50770 |
| 214 | Ga0207667_10015756 | 3300025949 | Bacteria | 8572 |
| 215 | Ga0207667_10460562 | 3300025949 | Bacteria | 1291 |
| 216 | Ga0207651_10034239 | 3300025960 | Bacteria | 3287 |
| 217 | Ga0207651_10107147 | 3300025960 | Bacteria | 2088 |
| 218 | Ga0207651_10239527 | 3300025960 | Bacteria | 1478 |
| 219 | Ga0207640_10023955 | 3300025981 | Bacteria | 3676 |
| 220 | Ga0207658_10124606 | 3300025986 | Bacteria | 2060 |
| 221 | Ga0207658_10415376 | 3300025986 | Bacteria | 1185 |
| 222 | Ga0207639_10082657 | 3300026041 | Bacteria | 2547 |
| 223 | Ga0207639_10097491 | 3300026041 | Bacteria | 2368 |
| 224 | Ga0207678_10000005 | 3300026067 | Bacteria | 193984 |
| 225 | Ga0207678_10008198 | 3300026067 | Bacteria | 9212 |
| 226 | Ga0207678_10018345 | 3300026067 | Bacteria | 6146 |
| 227 | Ga0207702_10000276 | 3300026078 | Bacteria | 59069 |
| 228 | Ga0207702_10105391 | 3300026078 | Bacteria | 2497 |
| 229 | Ga0207641_10117672 | 3300026088 | Bacteria | 2366 |
| 230 | Ga0207648_10033070 | 3300026089 | Bacteria | 4562 |
| 231 | Ga0207648_10055894 | 3300026089 | Bacteria | 3445 |
| 232 | Ga0207676_10031075 | 3300026095 | Bacteria | 4014 |
| 233 | Ga0207674_10001621 | 3300026116 | Bacteria | 28946 |
| 234 | Ga0207674_10030001 | 3300026116 | Bacteria | 5721 |
| 235 | Ga0207674_10130734 | 3300026116 | Bacteria | 2474 |
| 236 | Ga0207674_10181156 | 3300026116 | Bacteria | 2058 |
| 237 | Ga0207675_100255870 | 3300026118 | Bacteria | 1696 |
| 238 | Ga0207683_10000732 | 3300026121 | Bacteria | 29840 |
| 239 | Ga0207683_10009735 | 3300026121 | Bacteria | 8194 |
| 240 | Ga0207698_10000821 | 3300026142 | Bacteria | 18035 |
| 241 | Ga0207698_10001833 | 3300026142 | Bacteria | 12414 |
| 242 | Ga0207698_10020985 | 3300026142 | Bacteria | 4510 |
| 243 | Ga0207698_10092151 | 3300026142 | Bacteria | 2483 |
| 244 | Ga0207698_10382851 | 3300026142 | Bacteria | 1339 |
| 245 | Ga0207698_10479316 | 3300026142 | Bacteria | 1206 |
| 246 | Ga0209371_1004820 | 3300027312 | Bacteria | 5664 |
| 247 | Ga0268266_10181626 | 3300028379 | Bacteria | 1916 |
| 248 | Ga0268266_10312022 | 3300028379 | Bacteria | 1470 |
| 249 | Ga0316182_1148082 | 3300030745 | Bacteria | 6466 |
| 250 | Ga0307508_10006802 | 3300031616 | Bacteria | 10698 |
| 251 | Ga0307405_10001731 | 3300031731 | Bacteria | 9319 |
| 252 | Ga0307409_100274132 | 3300031995 | Bacteria | 1555 |
| 253 | Ga0307416_100261978 | 3300032002 | Bacteria | 1690 |
| 254 | Ga0307414_10002676 | 3300032004 | Bacteria | 9366 |
| 255 | Ga0395899_0000964 | 3300037312 | Bacteria | 26679 |
| 256 | Ga0395899_0014152 | 3300037312 | Bacteria | 6088 |
| 257 | Ga0395899_0094988 | 3300037312 | Bacteria | 2157 |
| 258 | Ga0395900_0008936 | 3300037418 | Bacteria | 10273 |
| 259 | Ga0395900_0017540 | 3300037418 | Bacteria | 7305 |
| 260 | Ga0395900_0041237 | 3300037418 | Bacteria | 4759 |
| 261 | Ga0395898_0040178 | 3300037466 | Bacteria | 4627 |
| 262 | Ga0395905_0000706 | 3300037471 | Bacteria | 44318 |
| 263 | Ga0395905_0048188 | 3300037471 | Bacteria | 3994 |
| 264 | Ga0395905_0218582 | 3300037471 | Unclassified | 1784 |
| 265 | Ga0436364_1136242 | 3300037853 | Bacteria | 3508 |
| 266 | Ga0395901_0234373 | 3300038443 | Bacteria | 1916 |
| 267 | Ga0436360_0296168 | 3300039438 | Bacteria | 1287 |
| 268 | Ga0451853_2330983 | 3300041512 | Bacteria | 2003 |
| 269 | Ga0466986_0001695 | 3300044650 | Bacteria | 9962 |
| 270 | Ga0466969_0000258 | 3300044656 | Bacteria | 29040 |
| 271 | Ga0466969_0003868 | 3300044656 | Bacteria | 7946 |
| 272 | Ga0466969_0005656 | 3300044656 | Bacteria | 6648 |
| 273 | Ga0466972_0000019 | 3300044658 | Bacteria | 198523 |
| 274 | Ga0466972_0037628 | 3300044658 | Bacteria | 2365 |
| 275 | Ga0466977_0344158 | 3300044666 | Bacteria | 884 |
| 276 | Ga0466965_0000602 | 3300044683 | Bacteria | 13107 |
| 277 | Ga0466966_0000049 | 3300044684 | Bacteria | 89046 |
| 278 | Ga0466966_0081146 | 3300044684 | Bacteria | 2019 |
| 279 | Ga0466961_0000282 | 3300044693 | Bacteria | 33721 |
| 280 | Ga0466961_0119030 | 3300044693 | Bacteria | 1658 |
| 281 | Ga0466963_0001136 | 3300044694 | Bacteria | 13910 |
| 282 | Ga0466964_0037688 | 3300044706 | Bacteria | 1942 |
| 283 | Ga0466971_0011216 | 3300044719 | Bacteria | 3926 |
| 284 | Ga0466971_0107141 | 3300044719 | Bacteria | 1288 |
| 285 | Ga0466968_0005691 | 3300044735 | Bacteria | 4669 |
| 286 | Ga0466970_0000346 | 3300044765 | Bacteria | 22536 |
| 287 | Ga0466970_0010781 | 3300044765 | Bacteria | 4647 |
| 288 | Ga0466970_0047593 | 3300044765 | Bacteria | 2286 |
| 289 | Ga0466957_0076594 | 3300044842 | Bacteria | 2077 |
| 290 | Ga0466960_0005125 | 3300044901 | Bacteria | 5184 |
| 291 | Ga0466960_0010936 | 3300044901 | Unclassified | 3780 |
| 292 | Ga0466959_0000195 | 3300045049 | Bacteria | 39999 |
| 293 | Ga0466959_0000688 | 3300045049 | Bacteria | 19769 |
| 294 | Ga0466959_0004430 | 3300045049 | Bacteria | 9403 |
| 295 | Ga0451576_0433546 | 3300045051 | Bacteria | 1379 |
| 296 | Ga0466958_0083467 | 3300045836 | Bacteria | 1969 |
| 297 | Ga0466967_0011292 | 3300045976 | Bacteria | 6753 |
| 298 | Ga0466967_0506036 | 3300045976 | Bacteria | 1186 |
| 299 | Ga0495592_0051299 | 3300046454 | Bacteria | 3064 |
| 300 | Ga0495603_0000013 | 3300046455 | Bacteria | 69483 |
| 301 | Ga0495603_0059683 | 3300046455 | Bacteria | 2255 |
| 302 | Ga0495629_0000559 | 3300046459 | Bacteria | 30384 |
| 303 | Ga0495629_0094815 | 3300046459 | Bacteria | 2082 |
| 304 | Ga0495638_0002050 | 3300046460 | Bacteria | 17123 |
| 305 | Ga0495638_0041716 | 3300046460 | Bacteria | 2901 |
| 306 | Ga0495638_0042564 | 3300046460 | Bacteria | 2868 |
| 307 | Ga0495653_0000131 | 3300046463 | Bacteria | 61893 |
| 308 | Ga0495650_0001233 | 3300046471 | Bacteria | 26584 |
| 309 | Ga0495650_0001360 | 3300046471 | Bacteria | 24248 |
| 310 | Ga0495650_0013288 | 3300046471 | Bacteria | 4364 |
| 311 | Ga0495580_0000092 | 3300046472 | Bacteria | 58592 |
| 312 | Ga0495580_0000587 | 3300046472 | Bacteria | 30774 |
| 313 | Ga0495580_0003686 | 3300046472 | Bacteria | 12989 |
| 314 | Ga0495580_0004981 | 3300046472 | Bacteria | 11091 |
| 315 | Ga0495580_0005179 | 3300046472 | Bacteria | 10838 |
| 316 | Ga0495582_0000319 | 3300046473 | Bacteria | 26353 |
| 317 | Ga0495605_0003426 | 3300046474 | Bacteria | 9439 |
| 318 | Ga0495605_0004751 | 3300046474 | Bacteria | 7944 |
| 319 | Ga0495662_0072981 | 3300046476 | Bacteria | 1664 |
| 320 | Ga0495664_0000059 | 3300046477 | Bacteria | 54375 |
| 321 | Ga0495583_0001119 | 3300046506 | Bacteria | 29569 |
| 322 | Ga0495583_0026577 | 3300046506 | Bacteria | 2866 |
| 323 | Ga0495606_0001317 | 3300046507 | Bacteria | 33954 |
| 324 | Ga0495606_0028190 | 3300046507 | Bacteria | 3966 |
| 325 | Ga0495606_0133444 | 3300046507 | Bacteria | 1473 |
| 326 | Ga0495618_0001060 | 3300046514 | Bacteria | 18760 |
| 327 | Ga0495620_0043799 | 3300046515 | Bacteria | 1948 |
| 328 | Ga0495628_0000086 | 3300046516 | Bacteria | 73047 |
| 329 | Ga0495630_0000033 | 3300046517 | Bacteria | 130787 |
| 330 | Ga0495632_0141639 | 3300046519 | Bacteria | 1115 |
| 331 | Ga0495648_0002029 | 3300046524 | Bacteria | 19205 |
| 332 | Ga0495648_0002602 | 3300046524 | Bacteria | 16499 |
| 333 | Ga0495648_0008081 | 3300046524 | Bacteria | 8320 |
| 334 | Ga0495648_0025155 | 3300046524 | Bacteria | 4036 |
| 335 | Ga0495648_0054854 | 3300046524 | Bacteria | 2405 |
| 336 | Ga0495648_0114992 | 3300046524 | Bacteria | 1456 |
| 337 | Ga0495666_0000005 | 3300046526 | Bacteria | 114737 |
| 338 | Ga0495652_0002418 | 3300046529 | Bacteria | 19257 |
| 339 | Ga0495665_0000017 | 3300046531 | Bacteria | 63287 |
| 340 | Ga0495640_0021102 | 3300046533 | Bacteria | 4787 |
| 341 | Ga0495586_0000433 | 3300046535 | Bacteria | 25196 |
| 342 | Ga0495587_0000109 | 3300046536 | Bacteria | 62399 |
| 343 | Ga0495597_0072967 | 3300046542 | Bacteria | 1476 |
| 344 | Ga0495645_0000030 | 3300046543 | Bacteria | 112864 |
| 345 | Ga0495634_0000811 | 3300046642 | Bacteria | 30384 |
| 346 | Ga0495635_0013650 | 3300046663 | Bacteria | 5686 |
| 347 | Ga0495661_0000777 | 3300046665 | Bacteria | 30468 |
| 348 | Ga0495646_0000214 | 3300046680 | Bacteria | 28847 |
| 349 | Ga0495613_0000129 | 3300046689 | Bacteria | 74597 |
| 350 | Ga0495624_0000054 | 3300046690 | Bacteria | 73277 |
| 351 | Ga0495671_0007015 | 3300046692 | Bacteria | 6457 |
| 352 | Ga0495649_0049150 | 3300046694 | Bacteria | 2291 |
| 353 | Ga0495581_0000158 | 3300047315 | Bacteria | 30364 |
| 354 | Ga0495604_0003450 | 3300047317 | Bacteria | 12603 |
| 355 | Ga0495674_0000119 | 3300047319 | Bacteria | 59827 |
| 356 | Ga0495672_0038939 | 3300047320 | Bacteria | 2896 |
| 357 | Ga0495672_0119922 | 3300047320 | Bacteria | 1399 |
| 358 | Ga0495676_0000148 | 3300047321 | Bacteria | 53859 |
| 359 | Ga0495676_0046158 | 3300047321 | Bacteria | 3539 |
| 360 | Ga0495680_0001057 | 3300047322 | Bacteria | 30484 |
| 361 | Ga0495683_0002503 | 3300047323 | Bacteria | 11057 |
| 362 | Ga0495687_001243 | 3300047443 | Bacteria | 24283 |
| 363 | Ga0495675_0047787 | 3300047444 | Bacteria | 2722 |
| 364 | Ga0495679_000443 | 3300047446 | Bacteria | 30551 |
| 365 | Ga0495679_000908 | 3300047446 | Bacteria | 18551 |
| 366 | Ga0495673_0017521 | 3300047469 | Bacteria | 3632 |
| 367 | Ga0495673_0019302 | 3300047469 | Bacteria | 3417 |
| 368 | Ga0495673_0042616 | 3300047469 | Bacteria | 2036 |
| 369 | Ga0495684_0034656 | 3300047471 | Bacteria | 3872 |
| 370 | Ga0495686_0184867 | 3300047472 | Bacteria | 1205 |
| 371 | Ga0495593_0000613 | 3300047673 | Bacteria | 20382 |
| 372 | Ga0495602_0000044 | 3300048088 | Bacteria | 119477 |
| 373 | Ga0495614_0000002 | 3300048089 | Bacteria | 106059 |
| 374 | Ga0496100_0127889 | 3300048903 | Bacteria | 1786 |
| 375 | Ga0496106_0311137 | 3300048909 | Bacteria | 1264 |
| 376 | Ga0496108_0112115 | 3300048911 | Bacteria | 2333 |
| 377 | Ga0496110_0011343 | 3300048913 | Bacteria | 7290 |
| 378 | Ga0496111_0020101 | 3300048914 | Bacteria | 4645 |
| 379 | Ga0496112_0168663 | 3300048915 | Bacteria | 2155 |
| 380 | Ga0496116_0000905 | 3300048919 | Bacteria | 36721 |
| 381 | Ga0496117_0095668 | 3300048920 | Bacteria | 1897 |
| 382 | Ga0496118_0032459 | 3300048921 | Bacteria | 4300 |
| 383 | Ga0496121_0015585 | 3300048924 | Bacteria | 7942 |
| 384 | Ga0496124_0000079 | 3300048927 | Bacteria | 212057 |
| 385 | Ga0496125_0003266 | 3300048928 | Bacteria | 19944 |
| 386 | Ga0496125_0004563 | 3300048928 | Bacteria | 15881 |
| 387 | Ga0495678_007001 | 3300049459 | Bacteria | 5915 |
| 388 | Ga0495682_0000588 | 3300049460 | Bacteria | 24729 |
| 389 | Ga0495682_0000601 | 3300049460 | Bacteria | 24387 |
| 390 | Ga0495682_0030097 | 3300049460 | Bacteria | 2009 |
| 391 | Ga0501033_0066029 | 3300049570 | Bacteria | 2661 |
| 392 | Ga0501034_0142557 | 3300049571 | Bacteria | 2375 |
| 393 | Ga0501034_0370282 | 3300049571 | Bacteria | 1359 |
| 394 | Ga0501034_0422585 | 3300049571 | Bacteria | 1254 |
| 395 | Ga0501198_003298 | 3300049649 | Bacteria | 2199 |
| 396 | Ga0501202_001069 | 3300049652 | Unclassified | 4264 |
| 397 | Ga0501210_000143 | 3300049657 | Bacteria | 2738 |
| 398 | Ga0501217_011442 | 3300049661 | Bacteria | 1963 |
| 399 | Ga0501257_001080 | 3300049686 | Bacteria | 5527 |
| 400 | Ga0501259_004471 | 3300049688 | Bacteria | 2229 |
| 401 | Ga0501225_0014927 | 3300049705 | Bacteria | 2167 |
| 402 | Ga0501241_010241 | 3300049758 | Bacteria | 1705 |
| 403 | Ga0501264_000059 | 3300049761 | Bacteria | 15630 |
| 404 | Ga0501266_001015 | 3300049763 | Bacteria | 3626 |
| 405 | Ga0501268_002269 | 3300049765 | Bacteria | 2521 |
| 406 | Ga0501035_0153630 | 3300049822 | Bacteria | 1996 |
| 407 | Ga0501284_00047 | 3300050005 | Bacteria | 47681 |
| 408 | Ga0500562_042332 | 3300053108 | Bacteria | 1211 |
| 409 | Ga0500573_0084816 | 3300053140 | Bacteria | 1797 |
| 410 | Ga0466962_0005410 | 3300061719 | Bacteria | 6140 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044666 | Ga0466977_0344158 | Ga0466977_0344158_67_870 | 267 |
| 2 | 3300049822 | Ga0501035_0153630 | Ga0501035_0153630_1047_1973 | 299 |
| 3 | 3300046455 | Ga0495603_0059683 | Ga0495603_0059683_591_1547 | 302 |
| 4 | 3300046472 | Ga0495580_0000587 | Ga0495580_0000587_27797_28753 | 302 |
| 5 | 3300046474 | Ga0495605_0004751 | Ga0495605_0004751_6858_7814 | 302 |
| 6 | 3300046506 | Ga0495583_0026577 | Ga0495583_0026577_1589_2545 | 302 |
| 7 | 3300046524 | Ga0495648_0002602 | Ga0495648_0002602_14111_15067 | 302 |
| 8 | 3300047320 | Ga0495672_0038939 | Ga0495672_0038939_1760_2716 | 302 |
| 9 | 3300047323 | Ga0495683_0002503 | Ga0495683_0002503_1615_2571 | 302 |
| 10 | 3300047443 | Ga0495687_001243 | Ga0495687_001243_8491_9447 | 302 |
| 11 | 3300049460 | Ga0495682_0000588 | Ga0495682_0000588_13940_14896 | 302 |
| 12 | 3300003322 | rootL2_10264817 | rootL2_102648171 | 303 |
| 13 | 3300025924 | Ga0207694_10011325 | Ga0207694_100113254 | 303 |
| 14 | 3300010375 | Ga0105239_10072218 | Ga0105239_100722183 | 304 |
| 15 | 3300031616 | Ga0307508_10006802 | Ga0307508_100068027 | 308 |
| 16 | 3300015261 | Ga0182006_1024091 | Ga0182006_10240912 | 309 |
| 17 | iso_pu_bacteria | 2857558681 | 2857559111 | 310 |
| 18 | 3300047469 | Ga0495673_0019302 | Ga0495673_0019302_2225_3160 | 311 |
| 19 | iso_pu_bacteria | 2834641062 | 2834643271 | 311 |
| 20 | iso_pu_bacteria | 8003400568 | 8003402501 | 311 |
| 21 | 3300031995 | Ga0307409_100274132 | Ga0307409_1002741322 | 312 |
| 22 | 3300032002 | Ga0307416_100261978 | Ga0307416_1002619782 | 312 |
| 23 | 3300049649 | Ga0501198_003298 | Ga0501198_003298_680_1669 | 312 |
| 24 | 3300049705 | Ga0501225_0014927 | Ga0501225_0014927_378_1367 | 312 |
| 25 | iso_pu_bacteria | 2884791551 | 2884791884 | 312 |
| 26 | iso_pu_bacteria | 2515154123 | 2515689694 | 313 |
| 27 | 3300020069 | Ga0197907_11202477 | Ga0197907_112024771 | 314 |
| 28 | 3300020610 | Ga0154015_1036957 | Ga0154015_10369571 | 314 |
| 29 | 3300030745 | Ga0316182_1148082 | Ga0316182_11480827 | 314 |
| 30 | 3300046524 | Ga0495648_0025155 | Ga0495648_0025155_2839_3783 | 314 |
| 31 | iso_pu_bacteria | 2510065045 | 2510247564 | 314 |
| 32 | iso_pu_bacteria | 2512047030 | 2512351327 | 314 |
| 33 | iso_pu_bacteria | 2515154122 | 2515685584 | 314 |
| 34 | iso_pu_bacteria | 2718217991 | 2719638264 | 314 |
| 35 | iso_pu_bacteria | 2885270888 | 2885275970 | 314 |
| 36 | iso_pu_bacteria | 2902682994 | 2902687623 | 314 |
| 37 | iso_pu_bacteria | 2921643360 | 2921649073 | 314 |
| 38 | iso_pu_bacteria | 642555112 | 642596969 | 314 |
| 39 | iso_pu_bacteria | 8055266321 | 8055268773 | 314 |
| 40 | 3300003323 | rootH1_10069593 | rootH1_100695931 | 315 |
| 41 | 3300003323 | rootH1_10071396 | rootH1_100713962 | 315 |
| 42 | 3300005331 | Ga0070670_100031302 | Ga0070670_1000313023 | 315 |
| 43 | 3300005331 | Ga0070670_100050606 | Ga0070670_1000506062 | 315 |
| 44 | 3300005333 | Ga0070677_10018237 | Ga0070677_100182372 | 315 |
| 45 | 3300005335 | Ga0070666_10014800 | Ga0070666_100148005 | 315 |
| 46 | 3300005338 | Ga0068868_100471233 | Ga0068868_1004712331 | 315 |
| 47 | 3300005354 | Ga0070675_100010623 | Ga0070675_1000106235 | 315 |
| 48 | 3300005364 | Ga0070673_100021066 | Ga0070673_1000210665 | 315 |
| 49 | 3300005364 | Ga0070673_100045781 | Ga0070673_1000457813 | 315 |
| 50 | 3300005367 | Ga0070667_100027353 | Ga0070667_1000273532 | 315 |
| 51 | 3300005455 | Ga0070663_100066855 | Ga0070663_1000668551 | 315 |
| 52 | 3300005539 | Ga0068853_100088130 | Ga0068853_1000881302 | 315 |
| 53 | 3300005543 | Ga0070672_100000880 | Ga0070672_10000088011 | 315 |
| 54 | 3300005547 | Ga0070693_100038087 | Ga0070693_1000380872 | 315 |
| 55 | 3300005616 | Ga0068852_100374144 | Ga0068852_1003741442 | 315 |
| 56 | 3300005834 | Ga0068851_10014458 | Ga0068851_100144583 | 315 |
| 57 | 3300005840 | Ga0068870_10140292 | Ga0068870_101402922 | 315 |
| 58 | 3300009093 | Ga0105240_10000950 | Ga0105240_100009508 | 315 |
| 59 | 3300009174 | Ga0105241_10003363 | Ga0105241_100033636 | 315 |
| 60 | 3300009177 | Ga0105248_10326356 | Ga0105248_103263562 | 315 |
| 61 | 3300009551 | Ga0105238_10008429 | Ga0105238_100084295 | 315 |
| 62 | 3300013296 | Ga0157374_10232548 | Ga0157374_102325482 | 315 |
| 63 | 3300013308 | Ga0157375_10043126 | Ga0157375_100431264 | 315 |
| 64 | 3300014969 | Ga0157376_10061113 | Ga0157376_100611132 | 315 |
| 65 | 3300014969 | Ga0157376_10081728 | Ga0157376_100817283 | 315 |
| 66 | 3300025321 | Ga0207656_10049860 | Ga0207656_100498601 | 315 |
| 67 | 3300025893 | Ga0207682_10012501 | Ga0207682_100125013 | 315 |
| 68 | 3300025903 | Ga0207680_10043316 | Ga0207680_100433162 | 315 |
| 69 | 3300025907 | Ga0207645_10029883 | Ga0207645_100298832 | 315 |
| 70 | 3300025908 | Ga0207643_10059192 | Ga0207643_100591922 | 315 |
| 71 | 3300025914 | Ga0207671_10002522 | Ga0207671_1000252217 | 315 |
| 72 | 3300025925 | Ga0207650_10044292 | Ga0207650_100442923 | 315 |
| 73 | 3300025925 | Ga0207650_10061177 | Ga0207650_100611773 | 315 |
| 74 | 3300025926 | Ga0207659_10222135 | Ga0207659_102221352 | 315 |
| 75 | 3300025940 | Ga0207691_10117960 | Ga0207691_101179602 | 315 |
| 76 | 3300025941 | Ga0207711_10094518 | Ga0207711_100945182 | 315 |
| 77 | 3300025960 | Ga0207651_10034239 | Ga0207651_100342392 | 315 |
| 78 | 3300025986 | Ga0207658_10415376 | Ga0207658_104153762 | 315 |
| 79 | 3300026041 | Ga0207639_10097491 | Ga0207639_100974912 | 315 |
| 80 | 3300026067 | Ga0207678_10008198 | Ga0207678_100081983 | 315 |
| 81 | 3300026088 | Ga0207641_10117672 | Ga0207641_101176722 | 315 |
| 82 | 3300026118 | Ga0207675_100255870 | Ga0207675_1002558702 | 315 |
| 83 | 3300026121 | Ga0207683_10009735 | Ga0207683_100097358 | 315 |
| 84 | 3300026142 | Ga0207698_10092151 | Ga0207698_100921512 | 315 |
| 85 | 3300026142 | Ga0207698_10382851 | Ga0207698_103828512 | 315 |
| 86 | 3300026142 | Ga0207698_10479316 | Ga0207698_104793161 | 315 |
| 87 | 3300044693 | Ga0466961_0119030 | Ga0466961_0119030_298_1278 | 315 |
| 88 | 3300044735 | Ga0466968_0005691 | Ga0466968_0005691_18_965 | 315 |
| 89 | 3300045836 | Ga0466958_0083467 | Ga0466958_0083467_324_1274 | 315 |
| 90 | 3300045976 | Ga0466967_0506036 | Ga0466967_0506036_42_995 | 315 |
| 91 | 3300048903 | Ga0496100_0127889 | Ga0496100_0127889_550_1497 | 315 |
| 92 | 3300048919 | Ga0496116_0000905 | Ga0496116_0000905_16930_17883 | 315 |
| 93 | 3300048927 | Ga0496124_0000079 | Ga0496124_0000079_35144_36094 | 315 |
| 94 | 3300048928 | Ga0496125_0004563 | Ga0496125_0004563_3276_4226 | 315 |
| 95 | 3300049661 | Ga0501217_011442 | Ga0501217_011442_968_1945 | 315 |
| 96 | 3300049688 | Ga0501259_004471 | Ga0501259_004471_503_1486 | 315 |
| 97 | 3300049763 | Ga0501266_001015 | Ga0501266_001015_2215_3198 | 315 |
| 98 | 3300049765 | Ga0501268_002269 | Ga0501268_002269_1138_2121 | 315 |
| 99 | 3300053108 | Ga0500562_042332 | Ga0500562_042332_230_1177 | 315 |
| 100 | 3300003322 | rootL2_10066415 | rootL2_100664152 | 316 |
| 101 | 3300022467 | Ga0224712_10001993 | Ga0224712_100019932 | 316 |
| 102 | 3300032004 | Ga0307414_10002676 | Ga0307414_100026764 | 316 |
| 103 | 3300003760 | Ga0055527_1003195 | Ga0055527_10031952 | 317 |
| 104 | 3300006028 | Ga0070717_10007143 | Ga0070717_100071435 | 317 |
| 105 | 3300025228 | Ga0209672_100284 | Ga0209672_1002844 | 317 |
| 106 | 3300025297 | Ga0209758_1006043 | Ga0209758_10060436 | 317 |
| 107 | 3300037466 | Ga0395898_0040178 | Ga0395898_0040178_1793_2746 | 317 |
| 108 | 3300044656 | Ga0466969_0003868 | Ga0466969_0003868_1597_2550 | 317 |
| 109 | 3300044684 | Ga0466966_0081146 | Ga0466966_0081146_1018_1971 | 317 |
| 110 | 3300045049 | Ga0466959_0004430 | Ga0466959_0004430_1339_2292 | 317 |
| 111 | 3300046507 | Ga0495606_0001317 | Ga0495606_0001317_31439_32437 | 317 |
| 112 | 3300048915 | Ga0496112_0168663 | Ga0496112_0168663_228_1223 | 317 |
| 113 | 3300049571 | Ga0501034_0422585 | Ga0501034_0422585_137_1120 | 317 |
| 114 | 3300001979 | JGI24740J21852_10026559 | JGI24740J21852_100265592 | 318 |
| 115 | 3300002067 | JGI24735J21928_10059275 | JGI24735J21928_100592751 | 318 |
| 116 | 3300003323 | rootH1_10066961 | rootH1_100669616 | 318 |
| 117 | 3300003323 | rootH1_10071397 | rootH1_100713972 | 318 |
| 118 | 3300005563 | Ga0068855_100127787 | Ga0068855_1001277873 | 318 |
| 119 | 3300006931 | Ga0097620_100758129 | Ga0097620_1007581292 | 318 |
| 120 | 3300009174 | Ga0105241_10097145 | Ga0105241_100971452 | 318 |
| 121 | 3300013296 | Ga0157374_10093626 | Ga0157374_100936262 | 318 |
| 122 | 3300016635 | Ga0183361_10005 | Ga0183361_10005269 | 318 |
| 123 | 3300025949 | Ga0207667_10015756 | Ga0207667_100157562 | 318 |
| 124 | 3300026116 | Ga0207674_10130734 | Ga0207674_101307342 | 318 |
| 125 | 3300026116 | Ga0207674_10181156 | Ga0207674_101811562 | 318 |
| 126 | 3300027312 | Ga0209371_1004820 | Ga0209371_10048202 | 318 |
| 127 | 3300037312 | Ga0395899_0000964 | Ga0395899_0000964_133_1119 | 318 |
| 128 | 3300037418 | Ga0395900_0041237 | Ga0395900_0041237_720_1706 | 318 |
| 129 | 3300037471 | Ga0395905_0000706 | Ga0395905_0000706_23615_24571 | 318 |
| 130 | 3300037471 | Ga0395905_0048188 | Ga0395905_0048188_1083_2069 | 318 |
| 131 | 3300039438 | Ga0436360_0296168 | Ga0436360_0296168_135_1094 | 318 |
| 132 | 3300044656 | Ga0466969_0000258 | Ga0466969_0000258_25664_26647 | 318 |
| 133 | 3300044684 | Ga0466966_0000049 | Ga0466966_0000049_67642_68625 | 318 |
| 134 | 3300044719 | Ga0466971_0107141 | Ga0466971_0107141_174_1157 | 318 |
| 135 | 3300044842 | Ga0466957_0076594 | Ga0466957_0076594_1012_1989 | 318 |
| 136 | 3300045049 | Ga0466959_0000195 | Ga0466959_0000195_30350_31333 | 318 |
| 137 | 3300045051 | Ga0451576_0433546 | Ga0451576_0433546_205_1182 | 318 |
| 138 | 3300046454 | Ga0495592_0051299 | Ga0495592_0051299_1630_2586 | 318 |
| 139 | 3300046455 | Ga0495603_0000013 | Ga0495603_0000013_66880_67836 | 318 |
| 140 | 3300046459 | Ga0495629_0000559 | Ga0495629_0000559_10510_11466 | 318 |
| 141 | 3300046459 | Ga0495629_0094815 | Ga0495629_0094815_859_1815 | 318 |
| 142 | 3300046460 | Ga0495638_0002050 | Ga0495638_0002050_11197_12195 | 318 |
| 143 | 3300046460 | Ga0495638_0041716 | Ga0495638_0041716_502_1458 | 318 |
| 144 | 3300046463 | Ga0495653_0000131 | Ga0495653_0000131_36052_37008 | 318 |
| 145 | 3300046471 | Ga0495650_0001233 | Ga0495650_0001233_18751_19707 | 318 |
| 146 | 3300046471 | Ga0495650_0001360 | Ga0495650_0001360_18321_19277 | 318 |
| 147 | 3300046471 | Ga0495650_0013288 | Ga0495650_0013288_1737_2693 | 318 |
| 148 | 3300046472 | Ga0495580_0000092 | Ga0495580_0000092_23651_24607 | 318 |
| 149 | 3300046472 | Ga0495580_0003686 | Ga0495580_0003686_10264_11220 | 318 |
| 150 | 3300046472 | Ga0495580_0004981 | Ga0495580_0004981_5019_5975 | 318 |
| 151 | 3300046472 | Ga0495580_0005179 | Ga0495580_0005179_6277_7233 | 318 |
| 152 | 3300046473 | Ga0495582_0000319 | Ga0495582_0000319_371_1327 | 318 |
| 153 | 3300046474 | Ga0495605_0003426 | Ga0495605_0003426_4150_5106 | 318 |
| 154 | 3300046476 | Ga0495662_0072981 | Ga0495662_0072981_266_1222 | 318 |
| 155 | 3300046477 | Ga0495664_0000059 | Ga0495664_0000059_34521_35477 | 318 |
| 156 | 3300046506 | Ga0495583_0001119 | Ga0495583_0001119_13020_13976 | 318 |
| 157 | 3300046507 | Ga0495606_0028190 | Ga0495606_0028190_194_1150 | 318 |
| 158 | 3300046507 | Ga0495606_0133444 | Ga0495606_0133444_12_968 | 318 |
| 159 | 3300046514 | Ga0495618_0001060 | Ga0495618_0001060_17411_18367 | 318 |
| 160 | 3300046515 | Ga0495620_0043799 | Ga0495620_0043799_303_1259 | 318 |
| 161 | 3300046516 | Ga0495628_0000086 | Ga0495628_0000086_38106_39062 | 318 |
| 162 | 3300046517 | Ga0495630_0000033 | Ga0495630_0000033_33968_34924 | 318 |
| 163 | 3300046519 | Ga0495632_0141639 | Ga0495632_0141639_41_1021 | 318 |
| 164 | 3300046524 | Ga0495648_0002029 | Ga0495648_0002029_10964_11920 | 318 |
| 165 | 3300046524 | Ga0495648_0008081 | Ga0495648_0008081_4890_5846 | 318 |
| 166 | 3300046524 | Ga0495648_0054854 | Ga0495648_0054854_1016_1972 | 318 |
| 167 | 3300046524 | Ga0495648_0114992 | Ga0495648_0114992_472_1428 | 318 |
| 168 | 3300046526 | Ga0495666_0000005 | Ga0495666_0000005_10482_11438 | 318 |
| 169 | 3300046529 | Ga0495652_0002418 | Ga0495652_0002418_12988_13944 | 318 |
| 170 | 3300046531 | Ga0495665_0000017 | Ga0495665_0000017_28346_29302 | 318 |
| 171 | 3300046533 | Ga0495640_0021102 | Ga0495640_0021102_265_1221 | 318 |
| 172 | 3300046535 | Ga0495586_0000433 | Ga0495586_0000433_18927_19883 | 318 |
| 173 | 3300046536 | Ga0495587_0000109 | Ga0495587_0000109_10510_11466 | 318 |
| 174 | 3300046542 | Ga0495597_0072967 | Ga0495597_0072967_176_1132 | 318 |
| 175 | 3300046543 | Ga0495645_0000030 | Ga0495645_0000030_24278_25234 | 318 |
| 176 | 3300046642 | Ga0495634_0000811 | Ga0495634_0000811_18927_19883 | 318 |
| 177 | 3300046663 | Ga0495635_0013650 | Ga0495635_0013650_2658_3614 | 318 |
| 178 | 3300046665 | Ga0495661_0000777 | Ga0495661_0000777_18919_19875 | 318 |
| 179 | 3300046680 | Ga0495646_0000214 | Ga0495646_0000214_18925_19881 | 318 |
| 180 | 3300046689 | Ga0495613_0000129 | Ga0495613_0000129_35536_36492 | 318 |
| 181 | 3300046690 | Ga0495624_0000054 | Ga0495624_0000054_66880_67836 | 318 |
| 182 | 3300046692 | Ga0495671_0007015 | Ga0495671_0007015_2740_3696 | 318 |
| 183 | 3300047315 | Ga0495581_0000158 | Ga0495581_0000158_18914_19870 | 318 |
| 184 | 3300047317 | Ga0495604_0003450 | Ga0495604_0003450_2034_2990 | 318 |
| 185 | 3300047319 | Ga0495674_0000119 | Ga0495674_0000119_24886_25842 | 318 |
| 186 | 3300047320 | Ga0495672_0119922 | Ga0495672_0119922_233_1189 | 318 |
| 187 | 3300047321 | Ga0495676_0000148 | Ga0495676_0000148_18926_19882 | 318 |
| 188 | 3300047321 | Ga0495676_0046158 | Ga0495676_0046158_2147_3103 | 318 |
| 189 | 3300047322 | Ga0495680_0001057 | Ga0495680_0001057_14633_15589 | 318 |
| 190 | 3300047444 | Ga0495675_0047787 | Ga0495675_0047787_1457_2413 | 318 |
| 191 | 3300047446 | Ga0495679_000443 | Ga0495679_000443_16637_17593 | 318 |
| 192 | 3300047446 | Ga0495679_000908 | Ga0495679_000908_10510_11466 | 318 |
| 193 | 3300047469 | Ga0495673_0017521 | Ga0495673_0017521_1120_2076 | 318 |
| 194 | 3300047469 | Ga0495673_0042616 | Ga0495673_0042616_461_1417 | 318 |
| 195 | 3300047471 | Ga0495684_0034656 | Ga0495684_0034656_2696_3652 | 318 |
| 196 | 3300047673 | Ga0495593_0000613 | Ga0495593_0000613_18926_19882 | 318 |
| 197 | 3300048088 | Ga0495602_0000044 | Ga0495602_0000044_36052_37008 | 318 |
| 198 | 3300048089 | Ga0495614_0000002 | Ga0495614_0000002_23221_24177 | 318 |
| 199 | 3300048909 | Ga0496106_0311137 | Ga0496106_0311137_220_1230 | 318 |
| 200 | 3300048920 | Ga0496117_0095668 | Ga0496117_0095668_220_1176 | 318 |
| 201 | 3300048921 | Ga0496118_0032459 | Ga0496118_0032459_2929_3885 | 318 |
| 202 | 3300048924 | Ga0496121_0015585 | Ga0496121_0015585_6276_7232 | 318 |
| 203 | 3300049459 | Ga0495678_007001 | Ga0495678_007001_3162_4118 | 318 |
| 204 | 3300049460 | Ga0495682_0000601 | Ga0495682_0000601_10964_11920 | 318 |
| 205 | 3300049460 | Ga0495682_0030097 | Ga0495682_0030097_821_1777 | 318 |
| 206 | 3300049571 | Ga0501034_0142557 | Ga0501034_0142557_206_1192 | 318 |
| 207 | 3300049758 | Ga0501241_010241 | Ga0501241_010241_284_1246 | 318 |
| 208 | 3300050005 | Ga0501284_00047 | Ga0501284_00047_32512_33474 | 318 |
| 209 | iso_pu_bacteria | 2857627736 | 2857628623 | 318 |
| 210 | 3300003322 | rootL2_10006832 | rootL2_100068324 | 319 |
| 211 | 3300003322 | rootL2_10045368 | rootL2_100453682 | 319 |
| 212 | 3300003322 | rootL2_10181898 | rootL2_101818983 | 319 |
| 213 | 3300003323 | rootH1_10053766 | rootH1_100537662 | 319 |
| 214 | 3300005329 | Ga0070683_100423276 | Ga0070683_1004232761 | 319 |
| 215 | 3300005331 | Ga0070670_100004367 | Ga0070670_1000043679 | 319 |
| 216 | 3300005335 | Ga0070666_10065036 | Ga0070666_100650362 | 319 |
| 217 | 3300005338 | Ga0068868_100001671 | Ga0068868_10000167110 | 319 |
| 218 | 3300005339 | Ga0070660_100094583 | Ga0070660_1000945832 | 319 |
| 219 | 3300005354 | Ga0070675_100001354 | Ga0070675_1000013547 | 319 |
| 220 | 3300005355 | Ga0070671_100000812 | Ga0070671_10000081212 | 319 |
| 221 | 3300005364 | Ga0070673_100006283 | Ga0070673_1000062838 | 319 |
| 222 | 3300005456 | Ga0070678_100000748 | Ga0070678_1000007489 | 319 |
| 223 | 3300005458 | Ga0070681_10046958 | Ga0070681_100469582 | 319 |
| 224 | 3300005459 | Ga0068867_100071791 | Ga0068867_1000717912 | 319 |
| 225 | 3300005530 | Ga0070679_100267001 | Ga0070679_1002670012 | 319 |
| 226 | 3300005535 | Ga0070684_100044152 | Ga0070684_1000441521 | 319 |
| 227 | 3300005539 | Ga0068853_100016590 | Ga0068853_1000165905 | 319 |
| 228 | 3300005563 | Ga0068855_100565059 | Ga0068855_1005650592 | 319 |
| 229 | 3300005564 | Ga0070664_100006755 | Ga0070664_1000067555 | 319 |
| 230 | 3300005578 | Ga0068854_100013300 | Ga0068854_1000133004 | 319 |
| 231 | 3300005578 | Ga0068854_100131590 | Ga0068854_1001315902 | 319 |
| 232 | 3300005616 | Ga0068852_100049168 | Ga0068852_1000491683 | 319 |
| 233 | 3300005618 | Ga0068864_100002867 | Ga0068864_10000286711 | 319 |
| 234 | 3300005834 | Ga0068851_10005120 | Ga0068851_100051203 | 319 |
| 235 | 3300006237 | Ga0097621_100001319 | Ga0097621_10000131911 | 319 |
| 236 | 3300006358 | Ga0068871_100000793 | Ga0068871_1000007937 | 319 |
| 237 | 3300009093 | Ga0105240_10107911 | Ga0105240_101079112 | 319 |
| 238 | 3300009093 | Ga0105240_10143216 | Ga0105240_101432162 | 319 |
| 239 | 3300009094 | Ga0111539_10628492 | Ga0111539_106284921 | 319 |
| 240 | 3300009098 | Ga0105245_10200299 | Ga0105245_102002992 | 319 |
| 241 | 3300009177 | Ga0105248_10083942 | Ga0105248_100839422 | 319 |
| 242 | 3300009545 | Ga0105237_10090904 | Ga0105237_100909042 | 319 |
| 243 | 3300009551 | Ga0105238_10039827 | Ga0105238_100398272 | 319 |
| 244 | 3300013100 | Ga0157373_10036359 | Ga0157373_100363591 | 319 |
| 245 | 3300013104 | Ga0157370_10003659 | Ga0157370_100036594 | 319 |
| 246 | 3300013104 | Ga0157370_10129956 | Ga0157370_101299562 | 319 |
| 247 | 3300013105 | Ga0157369_10172064 | Ga0157369_101720642 | 319 |
| 248 | 3300013296 | Ga0157374_10002290 | Ga0157374_1000229010 | 319 |
| 249 | 3300013297 | Ga0157378_10032133 | Ga0157378_100321332 | 319 |
| 250 | 3300013306 | Ga0163162_10006681 | Ga0163162_100066819 | 319 |
| 251 | 3300013306 | Ga0163162_10485636 | Ga0163162_104856362 | 319 |
| 252 | 3300013307 | Ga0157372_10010097 | Ga0157372_100100972 | 319 |
| 253 | 3300013307 | Ga0157372_10218190 | Ga0157372_102181901 | 319 |
| 254 | 3300013308 | Ga0157375_10002016 | Ga0157375_1000201613 | 319 |
| 255 | 3300013308 | Ga0157375_10101573 | Ga0157375_101015734 | 319 |
| 256 | 3300014969 | Ga0157376_10113906 | Ga0157376_101139062 | 319 |
| 257 | 3300020069 | Ga0197907_10996652 | Ga0197907_109966521 | 319 |
| 258 | 3300025321 | Ga0207656_10005505 | Ga0207656_100055053 | 319 |
| 259 | 3300025903 | Ga0207680_10246984 | Ga0207680_102469841 | 319 |
| 260 | 3300025909 | Ga0207705_10019022 | Ga0207705_100190222 | 319 |
| 261 | 3300025912 | Ga0207707_10087284 | Ga0207707_100872842 | 319 |
| 262 | 3300025913 | Ga0207695_10005156 | Ga0207695_1000515615 | 319 |
| 263 | 3300025913 | Ga0207695_10010294 | Ga0207695_100102945 | 319 |
| 264 | 3300025913 | Ga0207695_10047815 | Ga0207695_100478153 | 319 |
| 265 | 3300025920 | Ga0207649_10167351 | Ga0207649_101673512 | 319 |
| 266 | 3300025921 | Ga0207652_10292202 | Ga0207652_102922022 | 319 |
| 267 | 3300025924 | Ga0207694_10024624 | Ga0207694_100246245 | 319 |
| 268 | 3300025925 | Ga0207650_10001544 | Ga0207650_100015441 | 319 |
| 269 | 3300025926 | Ga0207659_10167308 | Ga0207659_101673082 | 319 |
| 270 | 3300025931 | Ga0207644_10006588 | Ga0207644_100065882 | 319 |
| 271 | 3300025940 | Ga0207691_10000467 | Ga0207691_1000046724 | 319 |
| 272 | 3300025945 | Ga0207679_10006057 | Ga0207679_100060576 | 319 |
| 273 | 3300025949 | Ga0207667_10460562 | Ga0207667_104605622 | 319 |
| 274 | 3300025960 | Ga0207651_10107147 | Ga0207651_101071471 | 319 |
| 275 | 3300025986 | Ga0207658_10124606 | Ga0207658_101246063 | 319 |
| 276 | 3300026041 | Ga0207639_10082657 | Ga0207639_100826572 | 319 |
| 277 | 3300026089 | Ga0207648_10033070 | Ga0207648_100330702 | 319 |
| 278 | 3300026089 | Ga0207648_10055894 | Ga0207648_100558942 | 319 |
| 279 | 3300026095 | Ga0207676_10031075 | Ga0207676_100310751 | 319 |
| 280 | 3300026121 | Ga0207683_10000732 | Ga0207683_1000073214 | 319 |
| 281 | 3300026142 | Ga0207698_10000821 | Ga0207698_100008216 | 319 |
| 282 | 3300028379 | Ga0268266_10181626 | Ga0268266_101816262 | 319 |
| 283 | 3300028379 | Ga0268266_10312022 | Ga0268266_103120222 | 319 |
| 284 | 3300041512 | Ga0451853_2330983 | Ga0451853_2330983_207_1169 | 319 |
| 285 | 3300044765 | Ga0466970_0047593 | Ga0466970_0047593_554_1513 | 319 |
| 286 | 3300046460 | Ga0495638_0042564 | Ga0495638_0042564_990_1949 | 319 |
| 287 | 3300046694 | Ga0495649_0049150 | Ga0495649_0049150_608_1609 | 319 |
| 288 | 3300047472 | Ga0495686_0184867 | Ga0495686_0184867_223_1182 | 319 |
| 289 | 3300048911 | Ga0496108_0112115 | Ga0496108_0112115_523_1485 | 319 |
| 290 | 3300048913 | Ga0496110_0011343 | Ga0496110_0011343_6238_7200 | 319 |
| 291 | 3300048914 | Ga0496111_0020101 | Ga0496111_0020101_2657_3619 | 319 |
| 292 | 3300053140 | Ga0500573_0084816 | Ga0500573_0084816_48_1055 | 319 |
| 293 | 3300025921 | Ga0207652_10449467 | Ga0207652_104494672 | 320 |
| 294 | 3300037853 | Ga0436364_1136242 | Ga0436364_1136242_557_1531 | 320 |
| 295 | 3300038443 | Ga0395901_0234373 | Ga0395901_0234373_97_1164 | 320 |
| 296 | 3300003320 | rootH2_10004104 | rootH2_100041044 | 321 |
| 297 | 3300003320 | rootH2_10085773 | rootH2_100857734 | 321 |
| 298 | 3300003354 | JGI25160J50197_1007970 | JGI25160J50197_10079702 | 321 |
| 299 | 3300003771 | Ga0055526_1009925 | Ga0055526_10099255 | 321 |
| 300 | 3300003790 | Ga0055528_1001249 | Ga0055528_10012493 | 321 |
| 301 | 3300005262 | Ga0065165_1000056 | Ga0065165_1000056133 | 321 |
| 302 | 3300005329 | Ga0070683_100178981 | Ga0070683_1001789812 | 321 |
| 303 | 3300005336 | Ga0070680_100000801 | Ga0070680_10000080113 | 321 |
| 304 | 3300005339 | Ga0070660_100082117 | Ga0070660_1000821172 | 321 |
| 305 | 3300005435 | Ga0070714_100114237 | Ga0070714_1001142372 | 321 |
| 306 | 3300005458 | Ga0070681_10001223 | Ga0070681_100012239 | 321 |
| 307 | 3300005530 | Ga0070679_100000103 | Ga0070679_10000010350 | 321 |
| 308 | 3300005563 | Ga0068855_100000145 | Ga0068855_10000014546 | 321 |
| 309 | 3300005614 | Ga0068856_100234523 | Ga0068856_1002345232 | 321 |
| 310 | 3300013100 | Ga0157373_10065298 | Ga0157373_100652982 | 321 |
| 311 | 3300013307 | Ga0157372_10012311 | Ga0157372_100123114 | 321 |
| 312 | 3300025273 | Ga0209673_1000014 | Ga0209673_100001478 | 321 |
| 313 | 3300025273 | Ga0209673_1000018 | Ga0209673_100001826 | 321 |
| 314 | 3300025297 | Ga0209758_1003372 | Ga0209758_100337212 | 321 |
| 315 | 3300025298 | Ga0209050_1000539 | Ga0209050_100053925 | 321 |
| 316 | 3300025304 | Ga0209257_1001417 | Ga0209257_100141721 | 321 |
| 317 | 3300025909 | Ga0207705_10004703 | Ga0207705_100047037 | 321 |
| 318 | 3300025917 | Ga0207660_10002419 | Ga0207660_100024199 | 321 |
| 319 | 3300025921 | Ga0207652_10000098 | Ga0207652_1000009836 | 321 |
| 320 | 3300025921 | Ga0207652_10000187 | Ga0207652_1000018718 | 321 |
| 321 | 3300025949 | Ga0207667_10000508 | Ga0207667_1000050815 | 321 |
| 322 | 3300026067 | Ga0207678_10018345 | Ga0207678_100183452 | 321 |
| 323 | 3300026078 | Ga0207702_10105391 | Ga0207702_101053912 | 321 |
| 324 | 3300031731 | Ga0307405_10001731 | Ga0307405_100017315 | 321 |
| 325 | 3300037418 | Ga0395900_0008936 | Ga0395900_0008936_7377_8372 | 321 |
| 326 | 3300037471 | Ga0395905_0218582 | Ga0395905_0218582_645_1640 | 321 |
| 327 | 3300049570 | Ga0501033_0066029 | Ga0501033_0066029_1043_2035 | 321 |
| 328 | 3300049571 | Ga0501034_0370282 | Ga0501034_0370282_104_1096 | 321 |
| 329 | 3300003322 | rootL2_10080456 | rootL2_100804563 | 322 |
| 330 | 3300005331 | Ga0070670_100049080 | Ga0070670_1000490802 | 322 |
| 331 | 3300005530 | Ga0070679_100242667 | Ga0070679_1002426672 | 322 |
| 332 | 3300005577 | Ga0068857_100000360 | Ga0068857_1000003607 | 322 |
| 333 | 3300005578 | Ga0068854_100032258 | Ga0068854_1000322582 | 322 |
| 334 | 3300005616 | Ga0068852_100000427 | Ga0068852_1000004277 | 322 |
| 335 | 3300009551 | Ga0105238_10003851 | Ga0105238_100038517 | 322 |
| 336 | 3300013102 | Ga0157371_10003005 | Ga0157371_1000300513 | 322 |
| 337 | 3300013102 | Ga0157371_10014215 | Ga0157371_100142151 | 322 |
| 338 | 3300013104 | Ga0157370_10003373 | Ga0157370_1000337319 | 322 |
| 339 | 3300013104 | Ga0157370_10005278 | Ga0157370_100052782 | 322 |
| 340 | 3300013105 | Ga0157369_10011153 | Ga0157369_100111534 | 322 |
| 341 | 3300013307 | Ga0157372_10001086 | Ga0157372_1000108616 | 322 |
| 342 | 3300013307 | Ga0157372_10009931 | Ga0157372_1000993112 | 322 |
| 343 | 3300025913 | Ga0207695_10012734 | Ga0207695_100127347 | 322 |
| 344 | 3300025924 | Ga0207694_10007359 | Ga0207694_100073594 | 322 |
| 345 | 3300025949 | Ga0207667_10000519 | Ga0207667_100005197 | 322 |
| 346 | 3300025960 | Ga0207651_10239527 | Ga0207651_102395272 | 322 |
| 347 | 3300025981 | Ga0207640_10023955 | Ga0207640_100239552 | 322 |
| 348 | 3300026116 | Ga0207674_10001621 | Ga0207674_100016218 | 322 |
| 349 | 3300026142 | Ga0207698_10001833 | Ga0207698_100018337 | 322 |
| 350 | 3300037312 | Ga0395899_0014152 | Ga0395899_0014152_2616_3674 | 322 |
| 351 | 3300049652 | Ga0501202_001069 | Ga0501202_001069_1292_2293 | 322 |
| 352 | 3300049657 | Ga0501210_000143 | Ga0501210_000143_1363_2364 | 322 |
| 353 | 3300049686 | Ga0501257_001080 | Ga0501257_001080_2023_3024 | 322 |
| 354 | 3300049761 | Ga0501264_000059 | Ga0501264_000059_2819_3820 | 322 |
| 355 | iso_pu_bacteria | 2929154850 | 2929159188 | 322 |
| 356 | 3300003323 | rootH1_10002268 | rootH1_1000226853 | 323 |
| 357 | 3300005327 | Ga0070658_10215235 | Ga0070658_102152351 | 323 |
| 358 | 3300025909 | Ga0207705_10112255 | Ga0207705_101122552 | 323 |
| 359 | 3300044658 | Ga0466972_0000019 | Ga0466972_0000019_147102_148235 | 323 |
| 360 | 3300044765 | Ga0466970_0010781 | Ga0466970_0010781_2193_3326 | 323 |
| 361 | 3300044901 | Ga0466960_0010936 | Ga0466960_0010936_491_1531 | 323 |
| 362 | iso_pu_bacteria | 2599185178 | 2599444783 | 326 |
| 363 | iso_pu_bacteria | 2900577576 | 2900582540 | 326 |
| 364 | iso_pu_bacteria | 2928058823 | 2928059914 | 326 |
| 365 | 3300001915 | JGI24741J21665_1000245 | JGI24741J21665_100024510 | 330 |
| 366 | 3300001979 | JGI24740J21852_10000057 | JGI24740J21852_1000005720 | 330 |
| 367 | 3300002705 | JGI25156J39149_1005017 | JGI25156J39149_10050174 | 330 |
| 368 | 3300003578 | Ga0006562J51391_1172264 | Ga0006562J51391_11722643 | 330 |
| 369 | 3300003578 | Ga0006562J51391_1172265 | Ga0006562J51391_11722652 | 330 |
| 370 | 3300003751 | Ga0055538_1003988 | Ga0055538_10039882 | 330 |
| 371 | 3300003752 | Ga0055539_1000168 | Ga0055539_100016825 | 330 |
| 372 | 3300003758 | Ga0055532_1000033 | Ga0055532_100003328 | 330 |
| 373 | 3300003759 | Ga0055525_1000264 | Ga0055525_100026448 | 330 |
| 374 | 3300003760 | Ga0055527_1000464 | Ga0055527_100046411 | 330 |
| 375 | 3300003761 | Ga0055535_1000024 | Ga0055535_100002428 | 330 |
| 376 | 3300003763 | Ga0055529_1000044 | Ga0055529_100004428 | 330 |
| 377 | 3300003841 | Ga0055541_1003465 | Ga0055541_10034652 | 330 |
| 378 | 3300003841 | Ga0055541_1007868 | Ga0055541_10078682 | 330 |
| 379 | 3300005344 | Ga0070661_100000027 | Ga0070661_10000002760 | 330 |
| 380 | 3300005455 | Ga0070663_100000004 | Ga0070663_100000004167 | 330 |
| 381 | 3300005564 | Ga0070664_100000041 | Ga0070664_10000004113 | 330 |
| 382 | 3300005614 | Ga0068856_100000004 | Ga0068856_100000004152 | 330 |
| 383 | 3300005616 | Ga0068852_100170616 | Ga0068852_1001706162 | 330 |
| 384 | 3300009093 | Ga0105240_10204570 | Ga0105240_102045703 | 330 |
| 385 | 3300013100 | Ga0157373_10001236 | Ga0157373_1000123611 | 330 |
| 386 | 3300013102 | Ga0157371_10000028 | Ga0157371_1000002858 | 330 |
| 387 | 3300013104 | Ga0157370_10000002 | Ga0157370_10000002194 | 330 |
| 388 | 3300013307 | Ga0157372_10000065 | Ga0157372_1000006571 | 330 |
| 389 | 3300015261 | Ga0182006_1001420 | Ga0182006_10014207 | 330 |
| 390 | 3300025224 | Ga0209784_100024 | Ga0209784_100024167 | 330 |
| 391 | 3300025224 | Ga0209784_102339 | Ga0209784_1023392 | 330 |
| 392 | 3300025225 | Ga0209566_100018 | Ga0209566_100018167 | 330 |
| 393 | 3300025225 | Ga0209566_100725 | Ga0209566_10072511 | 330 |
| 394 | 3300025226 | Ga0209674_100046 | Ga0209674_100046196 | 330 |
| 395 | 3300025226 | Ga0209674_104647 | Ga0209674_1046472 | 330 |
| 396 | 3300025228 | Ga0209672_100138 | Ga0209672_10013841 | 330 |
| 397 | 3300025228 | Ga0209672_100179 | Ga0209672_10017912 | 330 |
| 398 | 3300025229 | Ga0209147_100008 | Ga0209147_100008214 | 330 |
| 399 | 3300025230 | Ga0209563_100039 | Ga0209563_100039196 | 330 |
| 400 | 3300025230 | Ga0209563_100090 | Ga0209563_10009043 | 330 |
| 401 | 3300025242 | Ga0209258_100013 | Ga0209258_100013214 | 330 |
| 402 | 3300025253 | Ga0209677_100024 | Ga0209677_100024194 | 330 |
| 403 | 3300025256 | Ga0209759_1001093 | Ga0209759_100109314 | 330 |
| 404 | 3300025256 | Ga0209759_1023777 | Ga0209759_10237772 | 330 |
| 405 | 3300025272 | Ga0209455_1000042 | Ga0209455_1000042214 | 330 |
| 406 | 3300025913 | Ga0207695_10010513 | Ga0207695_100105135 | 330 |
| 407 | 3300025920 | Ga0207649_10000685 | Ga0207649_1000068514 | 330 |
| 408 | 3300025945 | Ga0207679_10000004 | Ga0207679_10000004351 | 330 |
| 409 | 3300026067 | Ga0207678_10000005 | Ga0207678_10000005167 | 330 |
| 410 | 3300026078 | Ga0207702_10000276 | Ga0207702_100002768 | 330 |
| 411 | 3300026116 | Ga0207674_10030001 | Ga0207674_100300014 | 330 |
| 412 | 3300026142 | Ga0207698_10020985 | Ga0207698_100209855 | 330 |
| 413 | 3300037312 | Ga0395899_0094988 | Ga0395899_0094988_268_1260 | 330 |
| 414 | 3300037418 | Ga0395900_0017540 | Ga0395900_0017540_4590_5582 | 330 |
| 415 | 3300044650 | Ga0466986_0001695 | Ga0466986_0001695_8636_9628 | 330 |
| 416 | 3300044656 | Ga0466969_0005656 | Ga0466969_0005656_4521_5513 | 330 |
| 417 | 3300044658 | Ga0466972_0037628 | Ga0466972_0037628_326_1318 | 330 |
| 418 | 3300044683 | Ga0466965_0000602 | Ga0466965_0000602_3245_4237 | 330 |
| 419 | 3300044693 | Ga0466961_0000282 | Ga0466961_0000282_17002_17994 | 330 |
| 420 | 3300044694 | Ga0466963_0001136 | Ga0466963_0001136_6069_7061 | 330 |
| 421 | 3300044706 | Ga0466964_0037688 | Ga0466964_0037688_778_1770 | 330 |
| 422 | 3300044719 | Ga0466971_0011216 | Ga0466971_0011216_1045_2037 | 330 |
| 423 | 3300044765 | Ga0466970_0000346 | Ga0466970_0000346_12304_13296 | 330 |
| 424 | 3300044901 | Ga0466960_0005125 | Ga0466960_0005125_3776_4768 | 330 |
| 425 | 3300045049 | Ga0466959_0000688 | Ga0466959_0000688_1750_2742 | 330 |
| 426 | 3300045976 | Ga0466967_0011292 | Ga0466967_0011292_884_1876 | 330 |
| 427 | 3300048928 | Ga0496125_0003266 | Ga0496125_0003266_8237_9229 | 330 |
| 428 | 3300061719 | Ga0466962_0005410 | Ga0466962_0005410_1575_2567 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p1x-assembly1.cif.gz_AAA | tarm(se)_g117r-udp-glucose | 0.7768 | 69 | 319 |
| 2f9f-assembly1.cif.gz_A | crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. | 0.7615 | 153 | 304 |
| 4x7r-assembly1.cif.gz_A | crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp | 0.7534 | 75 | 319 |
| 4wac-assembly1.cif.gz_A | crystal structure of tarm | 0.7439 | 76 | 319 |
| 7ec7-assembly1.cif.gz_A | crystal structure of sdgb (complexed with phosphate ions) | 0.7404 | 77 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SSP6_536_651_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9116 | 235 | 304 | 3.40.50.2000 |
| af_Q58469_205_369_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8206 | 168 | 300 | 3.40.50.2000 |
| af_Q58577_179_333_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8178 | 168 | 304 | 3.40.50.2000 |
| af_Q84QB1_230_385_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8158 | 168 | 303 | 3.40.50.2000 |
| af_P9WMY5_198_350_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7955 | 168 | 301 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B8HSR2-F1-model_v4 | Glycosyl transferase group 1 | 0.9898 | 6 | 324 |
GO:0016757
|
| AF-K0DT44-F1-model_v4 | Group 1 glucosyll transferase | 0.9891 | 12 | 323 |
GO:0016757
|
| AF-E5ALC2-F1-model_v4 | Lipopolysaccharide N-acetylglucosaminyltransferase | 0.9877 | 1 | 323 |
GO:0016757
|
| AF-A0A2H5YRP3-F1-model_v4 | Glycosyl transferase family 1 domain-containing protein | 0.9855 | 6 | 324 |
GO:0016757
|
| AF-A0A2U2HEX1-F1-model_v4 | LPS biosynthesis transferase | 0.9854 | 6 | 324 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar