F441726

General Info

Members Datasets Scaffolds Average Seq Length
428 262 410 323

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000019|Ga0466972_0000019_147102_148235
Length 377
Sequence VWWLVSEKRFWCAFREDVGLFYTSRCFGIIFKHGMSVILICMLNGIKEKKRLRIFTWHIHGSYLYYLSQGNYDIYIPVNAEKTEGYYGRGTTFPFGPNVIEVPAAEVRNLSFDCILFQTARNFLTDQYELLSEEQRQLPRVYLEHDPPTKHPTEMRHVMDDPEVCLVHVTHFNKLMWLSDVPKVRVIDHGVMPPPAVYTGELEKGIVVVNNLHKRGRRLGPDVFEEVSRQVPLDLVGMGTAEFGGLGEVLHPDLPAFIARYRFFFNPIRYTSLGLAVLEAMMQGIPVVALASTEYTTVIRDGESGFIHTDIDYLVKQMHVLLENRDLAFRLGQAGKRTAEERFNIRRFVNDWEQLFHWTIHNSNNTETYEKKNSLYQ

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
3 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
4 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
5 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
6 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
8 2857558681 Duganella sp. R-74565 Isolate Unclassified
9 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
10 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
11 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
12 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
13 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
14 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
15 2928058823 Ralstonia sp. 1138 Isolate Unclassified
16 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
17 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
241 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
245 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
246 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
247 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
248 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
249 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
252 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
253 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
254 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
257 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
258 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
261 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
262 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 1.4
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.64
Nodule 1.87
Rhizoplane 1.64
Rhizosphere 78.74
Stem 0
Stem Tuber 0
Unclassified 9.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000245 3300001915 Bacteria 16148
2 JGI24740J21852_10000057 3300001979 Bacteria 35487
3 JGI24740J21852_10026559 3300001979 Bacteria 1938
4 JGI24735J21928_10059275 3300002067 Bacteria 1100
5 JGI25156J39149_1005017 3300002705 Bacteria 3908
6 rootH2_10004104 3300003320 Bacteria 2963
7 rootH2_10085773 3300003320 Bacteria 7516
8 rootL2_10006832 3300003322 Unclassified 3943
9 rootL2_10045368 3300003322 Bacteria 2119
10 rootL2_10066415 3300003322 Unclassified 3537
11 rootL2_10080456 3300003322 Bacteria 10017
12 rootL2_10181898 3300003322 Bacteria 4281
13 rootL2_10264817 3300003322 Bacteria 1465
14 rootH1_10002268 3300003316 Bacteria 14703
15 rootH1_10002268 3300003323 Bacteria 96736
16 rootH1_10053766 3300003323 Bacteria 2714
17 rootH1_10066961 3300003323 Bacteria 7488
18 rootH1_10069593 3300003323 Unclassified 4483
19 rootH1_10071396 3300003323 Bacteria 2280
20 rootH1_10071397 3300003323 Bacteria 4069
21 JGI25160J50197_1007970 3300003354 Bacteria 4078
22 Ga0006562J51391_1172264 3300003578 Bacteria 3170
23 Ga0006562J51391_1172265 3300003578 Bacteria 2880
24 Ga0055538_1003988 3300003751 Bacteria 1754
25 Ga0055539_1000168 3300003752 Bacteria 58108
26 Ga0055532_1000033 3300003758 Bacteria 214652
27 Ga0055525_1000264 3300003759 Bacteria 49985
28 Ga0055527_1000464 3300003760 Bacteria 15635
29 Ga0055527_1003195 3300003760 Bacteria 2502
30 Ga0055535_1000024 3300003761 Bacteria 214652
31 Ga0055529_1000044 3300003763 Bacteria 214652
32 Ga0055526_1009925 3300003771 Bacteria 4505
33 Ga0055528_1001249 3300003790 Bacteria 16142
34 Ga0055541_1003465 3300003841 Bacteria 2964
35 Ga0055541_1007868 3300003841 Bacteria 1727
36 Ga0065165_1000056 3300005262 Bacteria 186730
37 Ga0070658_10215235 3300005327 Bacteria 1624
38 Ga0070683_100178981 3300005329 Bacteria 2013
39 Ga0070683_100423276 3300005329 Bacteria 1270
40 Ga0070670_100004367 3300005331 Bacteria 11835
41 Ga0070670_100031302 3300005331 Bacteria 4581
42 Ga0070670_100049080 3300005331 Bacteria 3630
43 Ga0070670_100050606 3300005331 Bacteria 3569
44 Ga0070677_10018237 3300005333 Bacteria 2525
45 Ga0070666_10014800 3300005335 Unclassified 4972
46 Ga0070666_10065036 3300005335 Bacteria 2474
47 Ga0070680_100000801 3300005336 Bacteria 22167
48 Ga0068868_100001671 3300005338 Bacteria 15159
49 Ga0068868_100471233 3300005338 Bacteria 1095
50 Ga0070660_100082117 3300005339 Bacteria 2530
51 Ga0070660_100094583 3300005339 Bacteria 2361
52 Ga0070661_100000027 3300005344 Bacteria 117972
53 Ga0070675_100001354 3300005354 Bacteria 17922
54 Ga0070675_100010623 3300005354 Bacteria 7196
55 Ga0070671_100000812 3300005355 Bacteria 22612
56 Ga0070673_100006283 3300005364 Bacteria 7708
57 Ga0070673_100021066 3300005364 Bacteria 4716
58 Ga0070673_100045781 3300005364 Bacteria 3395
59 Ga0070667_100027353 3300005367 Bacteria 4744
60 Ga0070714_100114237 3300005435 Unclassified 2395
61 Ga0070663_100000004 3300005455 Bacteria 254839
62 Ga0070663_100066855 3300005455 Bacteria 2605
63 Ga0070678_100000748 3300005456 Bacteria 16259
64 Ga0070681_10001223 3300005458 Bacteria 22355
65 Ga0070681_10046958 3300005458 Bacteria 4317
66 Ga0068867_100071791 3300005459 Bacteria 2590
67 Ga0070679_100000103 3300005530 Bacteria 66004
68 Ga0070679_100242667 3300005530 Bacteria 1759
69 Ga0070679_100267001 3300005530 Bacteria 1666
70 Ga0070684_100044152 3300005535 Bacteria 3853
71 Ga0068853_100016590 3300005539 Bacteria 6065
72 Ga0068853_100088130 3300005539 Unclassified 2724
73 Ga0070672_100000880 3300005543 Bacteria 17997
74 Ga0070693_100038087 3300005547 Bacteria 2685
75 Ga0068855_100000145 3300005563 Bacteria 91452
76 Ga0068855_100127787 3300005563 Bacteria 2905
77 Ga0068855_100565059 3300005563 Bacteria 1230
78 Ga0070664_100000041 3300005564 Bacteria 78215
79 Ga0070664_100006755 3300005564 Bacteria 9251
80 Ga0068857_100000360 3300005577 Bacteria 31775
81 Ga0068854_100013300 3300005578 Bacteria 5397
82 Ga0068854_100032258 3300005578 Bacteria 3643
83 Ga0068854_100131590 3300005578 Bacteria 1911
84 Ga0068856_100000004 3300005614 Bacteria 233761
85 Ga0068856_100234523 3300005614 Bacteria 1850
86 Ga0068852_100000427 3300005616 Bacteria 28012
87 Ga0068852_100049168 3300005616 Bacteria 3606
88 Ga0068852_100170616 3300005616 Bacteria 2039
89 Ga0068852_100374144 3300005616 Bacteria 1396
90 Ga0068864_100002867 3300005618 Bacteria 14245
91 Ga0068851_10005120 3300005834 Bacteria 5944
92 Ga0068851_10014458 3300005834 Bacteria 3747
93 Ga0068870_10140292 3300005840 Bacteria 1413
94 Ga0070717_10007143 3300006028 Bacteria 8276
95 Ga0097621_100001319 3300006237 Bacteria 17077
96 Ga0068871_100000793 3300006358 Bacteria 21236
97 Ga0097620_100758129 3300006931 Bacteria 1059
98 Ga0105240_10000950 3300009093 Bacteria 51619
99 Ga0105240_10107911 3300009093 Bacteria 3374
100 Ga0105240_10143216 3300009093 Bacteria 2856
101 Ga0105240_10204570 3300009093 Bacteria 2312
102 Ga0111539_10628492 3300009094 Bacteria 1250
103 Ga0105245_10200299 3300009098 Bacteria 1917
104 Ga0105241_10003363 3300009174 Bacteria 11912
105 Ga0105241_10097145 3300009174 Bacteria 2335
106 Ga0105248_10083942 3300009177 Bacteria 3583
107 Ga0105248_10326356 3300009177 Bacteria 1729
108 Ga0105237_10090904 3300009545 Bacteria 3042
109 Ga0105238_10003851 3300009551 Bacteria 14899
110 Ga0105238_10008429 3300009551 Bacteria 10319
111 Ga0105238_10039827 3300009551 Bacteria 4764
112 Ga0105239_10072218 3300010375 Bacteria 3793
113 Ga0157373_10001236 3300013100 Bacteria 19545
114 Ga0157373_10036359 3300013100 Bacteria 3535
115 Ga0157373_10065298 3300013100 Unclassified 2575
116 Ga0157371_10000028 3300013102 Bacteria 254964
117 Ga0157371_10003005 3300013102 Bacteria 15665
118 Ga0157371_10014215 3300013102 Bacteria 6017
119 Ga0157370_10000002 3300013104 Bacteria 431400
120 Ga0157370_10003373 3300013104 Bacteria 18784
121 Ga0157370_10003659 3300013104 Bacteria 17970
122 Ga0157370_10005278 3300013104 Bacteria 14516
123 Ga0157370_10129956 3300013104 Bacteria 2350
124 Ga0157369_10011153 3300013105 Bacteria 10216
125 Ga0157369_10172064 3300013105 Bacteria 2282
126 Ga0157374_10002290 3300013296 Bacteria 16117
127 Ga0157374_10093626 3300013296 Bacteria 2869
128 Ga0157374_10232548 3300013296 Bacteria 1811
129 Ga0157378_10032133 3300013297 Bacteria 4636
130 Ga0163162_10006681 3300013306 Bacteria 11190
131 Ga0163162_10485636 3300013306 Bacteria 1366
132 Ga0157372_10000065 3300013307 Bacteria 114576
133 Ga0157372_10001086 3300013307 Bacteria 29610
134 Ga0157372_10009931 3300013307 Bacteria 10124
135 Ga0157372_10010097 3300013307 Bacteria 10030
136 Ga0157372_10012311 3300013307 Bacteria 9116
137 Ga0157372_10218190 3300013307 Bacteria 2211
138 Ga0157375_10002016 3300013308 Bacteria 17524
139 Ga0157375_10043126 3300013308 Bacteria 4373
140 Ga0157375_10101573 3300013308 Bacteria 2959
141 Ga0157376_10061113 3300014969 Bacteria 3166
142 Ga0157376_10081728 3300014969 Bacteria 2775
143 Ga0157376_10113906 3300014969 Bacteria 2385
144 Ga0182006_1001420 3300015261 Bacteria 14485
145 Ga0182006_1024091 3300015261 Bacteria 2513
146 Ga0183361_10005 3300016635 Bacteria 413599
147 Ga0197907_10996652 3300020069 Bacteria 1133
148 Ga0197907_11202477 3300020069 Bacteria 1240
149 Ga0154015_1036957 3300020610 Bacteria 1975
150 Ga0224712_10001993 3300022467 Bacteria 4943
151 Ga0209784_100024 3300025224 Bacteria 394613
152 Ga0209784_102339 3300025224 Bacteria 1965
153 Ga0209566_100018 3300025225 Bacteria 448638
154 Ga0209566_100725 3300025225 Bacteria 18620
155 Ga0209674_100046 3300025226 Bacteria 357920
156 Ga0209674_104647 3300025226 Bacteria 2190
157 Ga0209672_100138 3300025228 Bacteria 70350
158 Ga0209672_100179 3300025228 Bacteria 52004
159 Ga0209672_100284 3300025228 Bacteria 36000
160 Ga0209147_100008 3300025229 Bacteria 777096
161 Ga0209563_100039 3300025230 Bacteria 409717
162 Ga0209563_100090 3300025230 Bacteria 169322
163 Ga0209258_100013 3300025242 Bacteria 777096
164 Ga0209677_100024 3300025253 Bacteria 406035
165 Ga0209759_1001093 3300025256 Bacteria 17598
166 Ga0209759_1023777 3300025256 Bacteria 1340
167 Ga0209455_1000042 3300025272 Bacteria 419638
168 Ga0209673_1000014 3300025273 Bacteria 537082
169 Ga0209673_1000018 3300025273 Bacteria 458281
170 Ga0209758_1003372 3300025297 Bacteria 14629
171 Ga0209758_1006043 3300025297 Bacteria 8929
172 Ga0209050_1000539 3300025298 Bacteria 62759
173 Ga0209257_1001417 3300025304 Bacteria 28547
174 Ga0207656_10005505 3300025321 Bacteria 4480
175 Ga0207656_10049860 3300025321 Bacteria 1806
176 Ga0207682_10012501 3300025893 Bacteria 3312
177 Ga0207680_10043316 3300025903 Unclassified 2639
178 Ga0207680_10246984 3300025903 Bacteria 1231
179 Ga0207645_10029883 3300025907 Bacteria 3512
180 Ga0207643_10059192 3300025908 Bacteria 2185
181 Ga0207705_10004703 3300025909 Bacteria 10294
182 Ga0207705_10019022 3300025909 Bacteria 4913
183 Ga0207705_10112255 3300025909 Bacteria 2015
184 Ga0207707_10087284 3300025912 Bacteria 2726
185 Ga0207695_10005156 3300025913 Bacteria 17498
186 Ga0207695_10010294 3300025913 Bacteria 11450
187 Ga0207695_10010513 3300025913 Bacteria 11320
188 Ga0207695_10012734 3300025913 Bacteria 10070
189 Ga0207695_10047815 3300025913 Bacteria 4523
190 Ga0207671_10002522 3300025914 Bacteria 19505
191 Ga0207660_10002419 3300025917 Bacteria 12260
192 Ga0207649_10000685 3300025920 Bacteria 22462
193 Ga0207649_10167351 3300025920 Bacteria 1528
194 Ga0207652_10000098 3300025921 Bacteria 94858
195 Ga0207652_10000187 3300025921 Bacteria 65282
196 Ga0207652_10292202 3300025921 Bacteria 1470
197 Ga0207652_10449467 3300025921 Bacteria 1162
198 Ga0207694_10007359 3300025924 Bacteria 8350
199 Ga0207694_10011325 3300025924 Bacteria 6732
200 Ga0207694_10024624 3300025924 Bacteria 4572
201 Ga0207650_10001544 3300025925 Bacteria 16496
202 Ga0207650_10044292 3300025925 Bacteria 3269
203 Ga0207650_10061177 3300025925 Bacteria 2811
204 Ga0207659_10167308 3300025926 Bacteria 1731
205 Ga0207659_10222135 3300025926 Bacteria 1519
206 Ga0207644_10006588 3300025931 Bacteria 7565
207 Ga0207691_10000467 3300025940 Bacteria 39953
208 Ga0207691_10117960 3300025940 Bacteria 2354
209 Ga0207711_10094518 3300025941 Bacteria 2635
210 Ga0207679_10000004 3300025945 Bacteria 589021
211 Ga0207679_10006057 3300025945 Bacteria 7625
212 Ga0207667_10000508 3300025949 Bacteria 51422
213 Ga0207667_10000519 3300025949 Bacteria 50770
214 Ga0207667_10015756 3300025949 Bacteria 8572
215 Ga0207667_10460562 3300025949 Bacteria 1291
216 Ga0207651_10034239 3300025960 Bacteria 3287
217 Ga0207651_10107147 3300025960 Bacteria 2088
218 Ga0207651_10239527 3300025960 Bacteria 1478
219 Ga0207640_10023955 3300025981 Bacteria 3676
220 Ga0207658_10124606 3300025986 Bacteria 2060
221 Ga0207658_10415376 3300025986 Bacteria 1185
222 Ga0207639_10082657 3300026041 Bacteria 2547
223 Ga0207639_10097491 3300026041 Bacteria 2368
224 Ga0207678_10000005 3300026067 Bacteria 193984
225 Ga0207678_10008198 3300026067 Bacteria 9212
226 Ga0207678_10018345 3300026067 Bacteria 6146
227 Ga0207702_10000276 3300026078 Bacteria 59069
228 Ga0207702_10105391 3300026078 Bacteria 2497
229 Ga0207641_10117672 3300026088 Bacteria 2366
230 Ga0207648_10033070 3300026089 Bacteria 4562
231 Ga0207648_10055894 3300026089 Bacteria 3445
232 Ga0207676_10031075 3300026095 Bacteria 4014
233 Ga0207674_10001621 3300026116 Bacteria 28946
234 Ga0207674_10030001 3300026116 Bacteria 5721
235 Ga0207674_10130734 3300026116 Bacteria 2474
236 Ga0207674_10181156 3300026116 Bacteria 2058
237 Ga0207675_100255870 3300026118 Bacteria 1696
238 Ga0207683_10000732 3300026121 Bacteria 29840
239 Ga0207683_10009735 3300026121 Bacteria 8194
240 Ga0207698_10000821 3300026142 Bacteria 18035
241 Ga0207698_10001833 3300026142 Bacteria 12414
242 Ga0207698_10020985 3300026142 Bacteria 4510
243 Ga0207698_10092151 3300026142 Bacteria 2483
244 Ga0207698_10382851 3300026142 Bacteria 1339
245 Ga0207698_10479316 3300026142 Bacteria 1206
246 Ga0209371_1004820 3300027312 Bacteria 5664
247 Ga0268266_10181626 3300028379 Bacteria 1916
248 Ga0268266_10312022 3300028379 Bacteria 1470
249 Ga0316182_1148082 3300030745 Bacteria 6466
250 Ga0307508_10006802 3300031616 Bacteria 10698
251 Ga0307405_10001731 3300031731 Bacteria 9319
252 Ga0307409_100274132 3300031995 Bacteria 1555
253 Ga0307416_100261978 3300032002 Bacteria 1690
254 Ga0307414_10002676 3300032004 Bacteria 9366
255 Ga0395899_0000964 3300037312 Bacteria 26679
256 Ga0395899_0014152 3300037312 Bacteria 6088
257 Ga0395899_0094988 3300037312 Bacteria 2157
258 Ga0395900_0008936 3300037418 Bacteria 10273
259 Ga0395900_0017540 3300037418 Bacteria 7305
260 Ga0395900_0041237 3300037418 Bacteria 4759
261 Ga0395898_0040178 3300037466 Bacteria 4627
262 Ga0395905_0000706 3300037471 Bacteria 44318
263 Ga0395905_0048188 3300037471 Bacteria 3994
264 Ga0395905_0218582 3300037471 Unclassified 1784
265 Ga0436364_1136242 3300037853 Bacteria 3508
266 Ga0395901_0234373 3300038443 Bacteria 1916
267 Ga0436360_0296168 3300039438 Bacteria 1287
268 Ga0451853_2330983 3300041512 Bacteria 2003
269 Ga0466986_0001695 3300044650 Bacteria 9962
270 Ga0466969_0000258 3300044656 Bacteria 29040
271 Ga0466969_0003868 3300044656 Bacteria 7946
272 Ga0466969_0005656 3300044656 Bacteria 6648
273 Ga0466972_0000019 3300044658 Bacteria 198523
274 Ga0466972_0037628 3300044658 Bacteria 2365
275 Ga0466977_0344158 3300044666 Bacteria 884
276 Ga0466965_0000602 3300044683 Bacteria 13107
277 Ga0466966_0000049 3300044684 Bacteria 89046
278 Ga0466966_0081146 3300044684 Bacteria 2019
279 Ga0466961_0000282 3300044693 Bacteria 33721
280 Ga0466961_0119030 3300044693 Bacteria 1658
281 Ga0466963_0001136 3300044694 Bacteria 13910
282 Ga0466964_0037688 3300044706 Bacteria 1942
283 Ga0466971_0011216 3300044719 Bacteria 3926
284 Ga0466971_0107141 3300044719 Bacteria 1288
285 Ga0466968_0005691 3300044735 Bacteria 4669
286 Ga0466970_0000346 3300044765 Bacteria 22536
287 Ga0466970_0010781 3300044765 Bacteria 4647
288 Ga0466970_0047593 3300044765 Bacteria 2286
289 Ga0466957_0076594 3300044842 Bacteria 2077
290 Ga0466960_0005125 3300044901 Bacteria 5184
291 Ga0466960_0010936 3300044901 Unclassified 3780
292 Ga0466959_0000195 3300045049 Bacteria 39999
293 Ga0466959_0000688 3300045049 Bacteria 19769
294 Ga0466959_0004430 3300045049 Bacteria 9403
295 Ga0451576_0433546 3300045051 Bacteria 1379
296 Ga0466958_0083467 3300045836 Bacteria 1969
297 Ga0466967_0011292 3300045976 Bacteria 6753
298 Ga0466967_0506036 3300045976 Bacteria 1186
299 Ga0495592_0051299 3300046454 Bacteria 3064
300 Ga0495603_0000013 3300046455 Bacteria 69483
301 Ga0495603_0059683 3300046455 Bacteria 2255
302 Ga0495629_0000559 3300046459 Bacteria 30384
303 Ga0495629_0094815 3300046459 Bacteria 2082
304 Ga0495638_0002050 3300046460 Bacteria 17123
305 Ga0495638_0041716 3300046460 Bacteria 2901
306 Ga0495638_0042564 3300046460 Bacteria 2868
307 Ga0495653_0000131 3300046463 Bacteria 61893
308 Ga0495650_0001233 3300046471 Bacteria 26584
309 Ga0495650_0001360 3300046471 Bacteria 24248
310 Ga0495650_0013288 3300046471 Bacteria 4364
311 Ga0495580_0000092 3300046472 Bacteria 58592
312 Ga0495580_0000587 3300046472 Bacteria 30774
313 Ga0495580_0003686 3300046472 Bacteria 12989
314 Ga0495580_0004981 3300046472 Bacteria 11091
315 Ga0495580_0005179 3300046472 Bacteria 10838
316 Ga0495582_0000319 3300046473 Bacteria 26353
317 Ga0495605_0003426 3300046474 Bacteria 9439
318 Ga0495605_0004751 3300046474 Bacteria 7944
319 Ga0495662_0072981 3300046476 Bacteria 1664
320 Ga0495664_0000059 3300046477 Bacteria 54375
321 Ga0495583_0001119 3300046506 Bacteria 29569
322 Ga0495583_0026577 3300046506 Bacteria 2866
323 Ga0495606_0001317 3300046507 Bacteria 33954
324 Ga0495606_0028190 3300046507 Bacteria 3966
325 Ga0495606_0133444 3300046507 Bacteria 1473
326 Ga0495618_0001060 3300046514 Bacteria 18760
327 Ga0495620_0043799 3300046515 Bacteria 1948
328 Ga0495628_0000086 3300046516 Bacteria 73047
329 Ga0495630_0000033 3300046517 Bacteria 130787
330 Ga0495632_0141639 3300046519 Bacteria 1115
331 Ga0495648_0002029 3300046524 Bacteria 19205
332 Ga0495648_0002602 3300046524 Bacteria 16499
333 Ga0495648_0008081 3300046524 Bacteria 8320
334 Ga0495648_0025155 3300046524 Bacteria 4036
335 Ga0495648_0054854 3300046524 Bacteria 2405
336 Ga0495648_0114992 3300046524 Bacteria 1456
337 Ga0495666_0000005 3300046526 Bacteria 114737
338 Ga0495652_0002418 3300046529 Bacteria 19257
339 Ga0495665_0000017 3300046531 Bacteria 63287
340 Ga0495640_0021102 3300046533 Bacteria 4787
341 Ga0495586_0000433 3300046535 Bacteria 25196
342 Ga0495587_0000109 3300046536 Bacteria 62399
343 Ga0495597_0072967 3300046542 Bacteria 1476
344 Ga0495645_0000030 3300046543 Bacteria 112864
345 Ga0495634_0000811 3300046642 Bacteria 30384
346 Ga0495635_0013650 3300046663 Bacteria 5686
347 Ga0495661_0000777 3300046665 Bacteria 30468
348 Ga0495646_0000214 3300046680 Bacteria 28847
349 Ga0495613_0000129 3300046689 Bacteria 74597
350 Ga0495624_0000054 3300046690 Bacteria 73277
351 Ga0495671_0007015 3300046692 Bacteria 6457
352 Ga0495649_0049150 3300046694 Bacteria 2291
353 Ga0495581_0000158 3300047315 Bacteria 30364
354 Ga0495604_0003450 3300047317 Bacteria 12603
355 Ga0495674_0000119 3300047319 Bacteria 59827
356 Ga0495672_0038939 3300047320 Bacteria 2896
357 Ga0495672_0119922 3300047320 Bacteria 1399
358 Ga0495676_0000148 3300047321 Bacteria 53859
359 Ga0495676_0046158 3300047321 Bacteria 3539
360 Ga0495680_0001057 3300047322 Bacteria 30484
361 Ga0495683_0002503 3300047323 Bacteria 11057
362 Ga0495687_001243 3300047443 Bacteria 24283
363 Ga0495675_0047787 3300047444 Bacteria 2722
364 Ga0495679_000443 3300047446 Bacteria 30551
365 Ga0495679_000908 3300047446 Bacteria 18551
366 Ga0495673_0017521 3300047469 Bacteria 3632
367 Ga0495673_0019302 3300047469 Bacteria 3417
368 Ga0495673_0042616 3300047469 Bacteria 2036
369 Ga0495684_0034656 3300047471 Bacteria 3872
370 Ga0495686_0184867 3300047472 Bacteria 1205
371 Ga0495593_0000613 3300047673 Bacteria 20382
372 Ga0495602_0000044 3300048088 Bacteria 119477
373 Ga0495614_0000002 3300048089 Bacteria 106059
374 Ga0496100_0127889 3300048903 Bacteria 1786
375 Ga0496106_0311137 3300048909 Bacteria 1264
376 Ga0496108_0112115 3300048911 Bacteria 2333
377 Ga0496110_0011343 3300048913 Bacteria 7290
378 Ga0496111_0020101 3300048914 Bacteria 4645
379 Ga0496112_0168663 3300048915 Bacteria 2155
380 Ga0496116_0000905 3300048919 Bacteria 36721
381 Ga0496117_0095668 3300048920 Bacteria 1897
382 Ga0496118_0032459 3300048921 Bacteria 4300
383 Ga0496121_0015585 3300048924 Bacteria 7942
384 Ga0496124_0000079 3300048927 Bacteria 212057
385 Ga0496125_0003266 3300048928 Bacteria 19944
386 Ga0496125_0004563 3300048928 Bacteria 15881
387 Ga0495678_007001 3300049459 Bacteria 5915
388 Ga0495682_0000588 3300049460 Bacteria 24729
389 Ga0495682_0000601 3300049460 Bacteria 24387
390 Ga0495682_0030097 3300049460 Bacteria 2009
391 Ga0501033_0066029 3300049570 Bacteria 2661
392 Ga0501034_0142557 3300049571 Bacteria 2375
393 Ga0501034_0370282 3300049571 Bacteria 1359
394 Ga0501034_0422585 3300049571 Bacteria 1254
395 Ga0501198_003298 3300049649 Bacteria 2199
396 Ga0501202_001069 3300049652 Unclassified 4264
397 Ga0501210_000143 3300049657 Bacteria 2738
398 Ga0501217_011442 3300049661 Bacteria 1963
399 Ga0501257_001080 3300049686 Bacteria 5527
400 Ga0501259_004471 3300049688 Bacteria 2229
401 Ga0501225_0014927 3300049705 Bacteria 2167
402 Ga0501241_010241 3300049758 Bacteria 1705
403 Ga0501264_000059 3300049761 Bacteria 15630
404 Ga0501266_001015 3300049763 Bacteria 3626
405 Ga0501268_002269 3300049765 Bacteria 2521
406 Ga0501035_0153630 3300049822 Bacteria 1996
407 Ga0501284_00047 3300050005 Bacteria 47681
408 Ga0500562_042332 3300053108 Bacteria 1211
409 Ga0500573_0084816 3300053140 Bacteria 1797
410 Ga0466962_0005410 3300061719 Bacteria 6140

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044666 Ga0466977_0344158 Ga0466977_0344158_67_870 267
2 3300049822 Ga0501035_0153630 Ga0501035_0153630_1047_1973 299
3 3300046455 Ga0495603_0059683 Ga0495603_0059683_591_1547 302
4 3300046472 Ga0495580_0000587 Ga0495580_0000587_27797_28753 302
5 3300046474 Ga0495605_0004751 Ga0495605_0004751_6858_7814 302
6 3300046506 Ga0495583_0026577 Ga0495583_0026577_1589_2545 302
7 3300046524 Ga0495648_0002602 Ga0495648_0002602_14111_15067 302
8 3300047320 Ga0495672_0038939 Ga0495672_0038939_1760_2716 302
9 3300047323 Ga0495683_0002503 Ga0495683_0002503_1615_2571 302
10 3300047443 Ga0495687_001243 Ga0495687_001243_8491_9447 302
11 3300049460 Ga0495682_0000588 Ga0495682_0000588_13940_14896 302
12 3300003322 rootL2_10264817 rootL2_102648171 303
13 3300025924 Ga0207694_10011325 Ga0207694_100113254 303
14 3300010375 Ga0105239_10072218 Ga0105239_100722183 304
15 3300031616 Ga0307508_10006802 Ga0307508_100068027 308
16 3300015261 Ga0182006_1024091 Ga0182006_10240912 309
17 iso_pu_bacteria 2857558681 2857559111 310
18 3300047469 Ga0495673_0019302 Ga0495673_0019302_2225_3160 311
19 iso_pu_bacteria 2834641062 2834643271 311
20 iso_pu_bacteria 8003400568 8003402501 311
21 3300031995 Ga0307409_100274132 Ga0307409_1002741322 312
22 3300032002 Ga0307416_100261978 Ga0307416_1002619782 312
23 3300049649 Ga0501198_003298 Ga0501198_003298_680_1669 312
24 3300049705 Ga0501225_0014927 Ga0501225_0014927_378_1367 312
25 iso_pu_bacteria 2884791551 2884791884 312
26 iso_pu_bacteria 2515154123 2515689694 313
27 3300020069 Ga0197907_11202477 Ga0197907_112024771 314
28 3300020610 Ga0154015_1036957 Ga0154015_10369571 314
29 3300030745 Ga0316182_1148082 Ga0316182_11480827 314
30 3300046524 Ga0495648_0025155 Ga0495648_0025155_2839_3783 314
31 iso_pu_bacteria 2510065045 2510247564 314
32 iso_pu_bacteria 2512047030 2512351327 314
33 iso_pu_bacteria 2515154122 2515685584 314
34 iso_pu_bacteria 2718217991 2719638264 314
35 iso_pu_bacteria 2885270888 2885275970 314
36 iso_pu_bacteria 2902682994 2902687623 314
37 iso_pu_bacteria 2921643360 2921649073 314
38 iso_pu_bacteria 642555112 642596969 314
39 iso_pu_bacteria 8055266321 8055268773 314
40 3300003323 rootH1_10069593 rootH1_100695931 315
41 3300003323 rootH1_10071396 rootH1_100713962 315
42 3300005331 Ga0070670_100031302 Ga0070670_1000313023 315
43 3300005331 Ga0070670_100050606 Ga0070670_1000506062 315
44 3300005333 Ga0070677_10018237 Ga0070677_100182372 315
45 3300005335 Ga0070666_10014800 Ga0070666_100148005 315
46 3300005338 Ga0068868_100471233 Ga0068868_1004712331 315
47 3300005354 Ga0070675_100010623 Ga0070675_1000106235 315
48 3300005364 Ga0070673_100021066 Ga0070673_1000210665 315
49 3300005364 Ga0070673_100045781 Ga0070673_1000457813 315
50 3300005367 Ga0070667_100027353 Ga0070667_1000273532 315
51 3300005455 Ga0070663_100066855 Ga0070663_1000668551 315
52 3300005539 Ga0068853_100088130 Ga0068853_1000881302 315
53 3300005543 Ga0070672_100000880 Ga0070672_10000088011 315
54 3300005547 Ga0070693_100038087 Ga0070693_1000380872 315
55 3300005616 Ga0068852_100374144 Ga0068852_1003741442 315
56 3300005834 Ga0068851_10014458 Ga0068851_100144583 315
57 3300005840 Ga0068870_10140292 Ga0068870_101402922 315
58 3300009093 Ga0105240_10000950 Ga0105240_100009508 315
59 3300009174 Ga0105241_10003363 Ga0105241_100033636 315
60 3300009177 Ga0105248_10326356 Ga0105248_103263562 315
61 3300009551 Ga0105238_10008429 Ga0105238_100084295 315
62 3300013296 Ga0157374_10232548 Ga0157374_102325482 315
63 3300013308 Ga0157375_10043126 Ga0157375_100431264 315
64 3300014969 Ga0157376_10061113 Ga0157376_100611132 315
65 3300014969 Ga0157376_10081728 Ga0157376_100817283 315
66 3300025321 Ga0207656_10049860 Ga0207656_100498601 315
67 3300025893 Ga0207682_10012501 Ga0207682_100125013 315
68 3300025903 Ga0207680_10043316 Ga0207680_100433162 315
69 3300025907 Ga0207645_10029883 Ga0207645_100298832 315
70 3300025908 Ga0207643_10059192 Ga0207643_100591922 315
71 3300025914 Ga0207671_10002522 Ga0207671_1000252217 315
72 3300025925 Ga0207650_10044292 Ga0207650_100442923 315
73 3300025925 Ga0207650_10061177 Ga0207650_100611773 315
74 3300025926 Ga0207659_10222135 Ga0207659_102221352 315
75 3300025940 Ga0207691_10117960 Ga0207691_101179602 315
76 3300025941 Ga0207711_10094518 Ga0207711_100945182 315
77 3300025960 Ga0207651_10034239 Ga0207651_100342392 315
78 3300025986 Ga0207658_10415376 Ga0207658_104153762 315
79 3300026041 Ga0207639_10097491 Ga0207639_100974912 315
80 3300026067 Ga0207678_10008198 Ga0207678_100081983 315
81 3300026088 Ga0207641_10117672 Ga0207641_101176722 315
82 3300026118 Ga0207675_100255870 Ga0207675_1002558702 315
83 3300026121 Ga0207683_10009735 Ga0207683_100097358 315
84 3300026142 Ga0207698_10092151 Ga0207698_100921512 315
85 3300026142 Ga0207698_10382851 Ga0207698_103828512 315
86 3300026142 Ga0207698_10479316 Ga0207698_104793161 315
87 3300044693 Ga0466961_0119030 Ga0466961_0119030_298_1278 315
88 3300044735 Ga0466968_0005691 Ga0466968_0005691_18_965 315
89 3300045836 Ga0466958_0083467 Ga0466958_0083467_324_1274 315
90 3300045976 Ga0466967_0506036 Ga0466967_0506036_42_995 315
91 3300048903 Ga0496100_0127889 Ga0496100_0127889_550_1497 315
92 3300048919 Ga0496116_0000905 Ga0496116_0000905_16930_17883 315
93 3300048927 Ga0496124_0000079 Ga0496124_0000079_35144_36094 315
94 3300048928 Ga0496125_0004563 Ga0496125_0004563_3276_4226 315
95 3300049661 Ga0501217_011442 Ga0501217_011442_968_1945 315
96 3300049688 Ga0501259_004471 Ga0501259_004471_503_1486 315
97 3300049763 Ga0501266_001015 Ga0501266_001015_2215_3198 315
98 3300049765 Ga0501268_002269 Ga0501268_002269_1138_2121 315
99 3300053108 Ga0500562_042332 Ga0500562_042332_230_1177 315
100 3300003322 rootL2_10066415 rootL2_100664152 316
101 3300022467 Ga0224712_10001993 Ga0224712_100019932 316
102 3300032004 Ga0307414_10002676 Ga0307414_100026764 316
103 3300003760 Ga0055527_1003195 Ga0055527_10031952 317
104 3300006028 Ga0070717_10007143 Ga0070717_100071435 317
105 3300025228 Ga0209672_100284 Ga0209672_1002844 317
106 3300025297 Ga0209758_1006043 Ga0209758_10060436 317
107 3300037466 Ga0395898_0040178 Ga0395898_0040178_1793_2746 317
108 3300044656 Ga0466969_0003868 Ga0466969_0003868_1597_2550 317
109 3300044684 Ga0466966_0081146 Ga0466966_0081146_1018_1971 317
110 3300045049 Ga0466959_0004430 Ga0466959_0004430_1339_2292 317
111 3300046507 Ga0495606_0001317 Ga0495606_0001317_31439_32437 317
112 3300048915 Ga0496112_0168663 Ga0496112_0168663_228_1223 317
113 3300049571 Ga0501034_0422585 Ga0501034_0422585_137_1120 317
114 3300001979 JGI24740J21852_10026559 JGI24740J21852_100265592 318
115 3300002067 JGI24735J21928_10059275 JGI24735J21928_100592751 318
116 3300003323 rootH1_10066961 rootH1_100669616 318
117 3300003323 rootH1_10071397 rootH1_100713972 318
118 3300005563 Ga0068855_100127787 Ga0068855_1001277873 318
119 3300006931 Ga0097620_100758129 Ga0097620_1007581292 318
120 3300009174 Ga0105241_10097145 Ga0105241_100971452 318
121 3300013296 Ga0157374_10093626 Ga0157374_100936262 318
122 3300016635 Ga0183361_10005 Ga0183361_10005269 318
123 3300025949 Ga0207667_10015756 Ga0207667_100157562 318
124 3300026116 Ga0207674_10130734 Ga0207674_101307342 318
125 3300026116 Ga0207674_10181156 Ga0207674_101811562 318
126 3300027312 Ga0209371_1004820 Ga0209371_10048202 318
127 3300037312 Ga0395899_0000964 Ga0395899_0000964_133_1119 318
128 3300037418 Ga0395900_0041237 Ga0395900_0041237_720_1706 318
129 3300037471 Ga0395905_0000706 Ga0395905_0000706_23615_24571 318
130 3300037471 Ga0395905_0048188 Ga0395905_0048188_1083_2069 318
131 3300039438 Ga0436360_0296168 Ga0436360_0296168_135_1094 318
132 3300044656 Ga0466969_0000258 Ga0466969_0000258_25664_26647 318
133 3300044684 Ga0466966_0000049 Ga0466966_0000049_67642_68625 318
134 3300044719 Ga0466971_0107141 Ga0466971_0107141_174_1157 318
135 3300044842 Ga0466957_0076594 Ga0466957_0076594_1012_1989 318
136 3300045049 Ga0466959_0000195 Ga0466959_0000195_30350_31333 318
137 3300045051 Ga0451576_0433546 Ga0451576_0433546_205_1182 318
138 3300046454 Ga0495592_0051299 Ga0495592_0051299_1630_2586 318
139 3300046455 Ga0495603_0000013 Ga0495603_0000013_66880_67836 318
140 3300046459 Ga0495629_0000559 Ga0495629_0000559_10510_11466 318
141 3300046459 Ga0495629_0094815 Ga0495629_0094815_859_1815 318
142 3300046460 Ga0495638_0002050 Ga0495638_0002050_11197_12195 318
143 3300046460 Ga0495638_0041716 Ga0495638_0041716_502_1458 318
144 3300046463 Ga0495653_0000131 Ga0495653_0000131_36052_37008 318
145 3300046471 Ga0495650_0001233 Ga0495650_0001233_18751_19707 318
146 3300046471 Ga0495650_0001360 Ga0495650_0001360_18321_19277 318
147 3300046471 Ga0495650_0013288 Ga0495650_0013288_1737_2693 318
148 3300046472 Ga0495580_0000092 Ga0495580_0000092_23651_24607 318
149 3300046472 Ga0495580_0003686 Ga0495580_0003686_10264_11220 318
150 3300046472 Ga0495580_0004981 Ga0495580_0004981_5019_5975 318
151 3300046472 Ga0495580_0005179 Ga0495580_0005179_6277_7233 318
152 3300046473 Ga0495582_0000319 Ga0495582_0000319_371_1327 318
153 3300046474 Ga0495605_0003426 Ga0495605_0003426_4150_5106 318
154 3300046476 Ga0495662_0072981 Ga0495662_0072981_266_1222 318
155 3300046477 Ga0495664_0000059 Ga0495664_0000059_34521_35477 318
156 3300046506 Ga0495583_0001119 Ga0495583_0001119_13020_13976 318
157 3300046507 Ga0495606_0028190 Ga0495606_0028190_194_1150 318
158 3300046507 Ga0495606_0133444 Ga0495606_0133444_12_968 318
159 3300046514 Ga0495618_0001060 Ga0495618_0001060_17411_18367 318
160 3300046515 Ga0495620_0043799 Ga0495620_0043799_303_1259 318
161 3300046516 Ga0495628_0000086 Ga0495628_0000086_38106_39062 318
162 3300046517 Ga0495630_0000033 Ga0495630_0000033_33968_34924 318
163 3300046519 Ga0495632_0141639 Ga0495632_0141639_41_1021 318
164 3300046524 Ga0495648_0002029 Ga0495648_0002029_10964_11920 318
165 3300046524 Ga0495648_0008081 Ga0495648_0008081_4890_5846 318
166 3300046524 Ga0495648_0054854 Ga0495648_0054854_1016_1972 318
167 3300046524 Ga0495648_0114992 Ga0495648_0114992_472_1428 318
168 3300046526 Ga0495666_0000005 Ga0495666_0000005_10482_11438 318
169 3300046529 Ga0495652_0002418 Ga0495652_0002418_12988_13944 318
170 3300046531 Ga0495665_0000017 Ga0495665_0000017_28346_29302 318
171 3300046533 Ga0495640_0021102 Ga0495640_0021102_265_1221 318
172 3300046535 Ga0495586_0000433 Ga0495586_0000433_18927_19883 318
173 3300046536 Ga0495587_0000109 Ga0495587_0000109_10510_11466 318
174 3300046542 Ga0495597_0072967 Ga0495597_0072967_176_1132 318
175 3300046543 Ga0495645_0000030 Ga0495645_0000030_24278_25234 318
176 3300046642 Ga0495634_0000811 Ga0495634_0000811_18927_19883 318
177 3300046663 Ga0495635_0013650 Ga0495635_0013650_2658_3614 318
178 3300046665 Ga0495661_0000777 Ga0495661_0000777_18919_19875 318
179 3300046680 Ga0495646_0000214 Ga0495646_0000214_18925_19881 318
180 3300046689 Ga0495613_0000129 Ga0495613_0000129_35536_36492 318
181 3300046690 Ga0495624_0000054 Ga0495624_0000054_66880_67836 318
182 3300046692 Ga0495671_0007015 Ga0495671_0007015_2740_3696 318
183 3300047315 Ga0495581_0000158 Ga0495581_0000158_18914_19870 318
184 3300047317 Ga0495604_0003450 Ga0495604_0003450_2034_2990 318
185 3300047319 Ga0495674_0000119 Ga0495674_0000119_24886_25842 318
186 3300047320 Ga0495672_0119922 Ga0495672_0119922_233_1189 318
187 3300047321 Ga0495676_0000148 Ga0495676_0000148_18926_19882 318
188 3300047321 Ga0495676_0046158 Ga0495676_0046158_2147_3103 318
189 3300047322 Ga0495680_0001057 Ga0495680_0001057_14633_15589 318
190 3300047444 Ga0495675_0047787 Ga0495675_0047787_1457_2413 318
191 3300047446 Ga0495679_000443 Ga0495679_000443_16637_17593 318
192 3300047446 Ga0495679_000908 Ga0495679_000908_10510_11466 318
193 3300047469 Ga0495673_0017521 Ga0495673_0017521_1120_2076 318
194 3300047469 Ga0495673_0042616 Ga0495673_0042616_461_1417 318
195 3300047471 Ga0495684_0034656 Ga0495684_0034656_2696_3652 318
196 3300047673 Ga0495593_0000613 Ga0495593_0000613_18926_19882 318
197 3300048088 Ga0495602_0000044 Ga0495602_0000044_36052_37008 318
198 3300048089 Ga0495614_0000002 Ga0495614_0000002_23221_24177 318
199 3300048909 Ga0496106_0311137 Ga0496106_0311137_220_1230 318
200 3300048920 Ga0496117_0095668 Ga0496117_0095668_220_1176 318
201 3300048921 Ga0496118_0032459 Ga0496118_0032459_2929_3885 318
202 3300048924 Ga0496121_0015585 Ga0496121_0015585_6276_7232 318
203 3300049459 Ga0495678_007001 Ga0495678_007001_3162_4118 318
204 3300049460 Ga0495682_0000601 Ga0495682_0000601_10964_11920 318
205 3300049460 Ga0495682_0030097 Ga0495682_0030097_821_1777 318
206 3300049571 Ga0501034_0142557 Ga0501034_0142557_206_1192 318
207 3300049758 Ga0501241_010241 Ga0501241_010241_284_1246 318
208 3300050005 Ga0501284_00047 Ga0501284_00047_32512_33474 318
209 iso_pu_bacteria 2857627736 2857628623 318
210 3300003322 rootL2_10006832 rootL2_100068324 319
211 3300003322 rootL2_10045368 rootL2_100453682 319
212 3300003322 rootL2_10181898 rootL2_101818983 319
213 3300003323 rootH1_10053766 rootH1_100537662 319
214 3300005329 Ga0070683_100423276 Ga0070683_1004232761 319
215 3300005331 Ga0070670_100004367 Ga0070670_1000043679 319
216 3300005335 Ga0070666_10065036 Ga0070666_100650362 319
217 3300005338 Ga0068868_100001671 Ga0068868_10000167110 319
218 3300005339 Ga0070660_100094583 Ga0070660_1000945832 319
219 3300005354 Ga0070675_100001354 Ga0070675_1000013547 319
220 3300005355 Ga0070671_100000812 Ga0070671_10000081212 319
221 3300005364 Ga0070673_100006283 Ga0070673_1000062838 319
222 3300005456 Ga0070678_100000748 Ga0070678_1000007489 319
223 3300005458 Ga0070681_10046958 Ga0070681_100469582 319
224 3300005459 Ga0068867_100071791 Ga0068867_1000717912 319
225 3300005530 Ga0070679_100267001 Ga0070679_1002670012 319
226 3300005535 Ga0070684_100044152 Ga0070684_1000441521 319
227 3300005539 Ga0068853_100016590 Ga0068853_1000165905 319
228 3300005563 Ga0068855_100565059 Ga0068855_1005650592 319
229 3300005564 Ga0070664_100006755 Ga0070664_1000067555 319
230 3300005578 Ga0068854_100013300 Ga0068854_1000133004 319
231 3300005578 Ga0068854_100131590 Ga0068854_1001315902 319
232 3300005616 Ga0068852_100049168 Ga0068852_1000491683 319
233 3300005618 Ga0068864_100002867 Ga0068864_10000286711 319
234 3300005834 Ga0068851_10005120 Ga0068851_100051203 319
235 3300006237 Ga0097621_100001319 Ga0097621_10000131911 319
236 3300006358 Ga0068871_100000793 Ga0068871_1000007937 319
237 3300009093 Ga0105240_10107911 Ga0105240_101079112 319
238 3300009093 Ga0105240_10143216 Ga0105240_101432162 319
239 3300009094 Ga0111539_10628492 Ga0111539_106284921 319
240 3300009098 Ga0105245_10200299 Ga0105245_102002992 319
241 3300009177 Ga0105248_10083942 Ga0105248_100839422 319
242 3300009545 Ga0105237_10090904 Ga0105237_100909042 319
243 3300009551 Ga0105238_10039827 Ga0105238_100398272 319
244 3300013100 Ga0157373_10036359 Ga0157373_100363591 319
245 3300013104 Ga0157370_10003659 Ga0157370_100036594 319
246 3300013104 Ga0157370_10129956 Ga0157370_101299562 319
247 3300013105 Ga0157369_10172064 Ga0157369_101720642 319
248 3300013296 Ga0157374_10002290 Ga0157374_1000229010 319
249 3300013297 Ga0157378_10032133 Ga0157378_100321332 319
250 3300013306 Ga0163162_10006681 Ga0163162_100066819 319
251 3300013306 Ga0163162_10485636 Ga0163162_104856362 319
252 3300013307 Ga0157372_10010097 Ga0157372_100100972 319
253 3300013307 Ga0157372_10218190 Ga0157372_102181901 319
254 3300013308 Ga0157375_10002016 Ga0157375_1000201613 319
255 3300013308 Ga0157375_10101573 Ga0157375_101015734 319
256 3300014969 Ga0157376_10113906 Ga0157376_101139062 319
257 3300020069 Ga0197907_10996652 Ga0197907_109966521 319
258 3300025321 Ga0207656_10005505 Ga0207656_100055053 319
259 3300025903 Ga0207680_10246984 Ga0207680_102469841 319
260 3300025909 Ga0207705_10019022 Ga0207705_100190222 319
261 3300025912 Ga0207707_10087284 Ga0207707_100872842 319
262 3300025913 Ga0207695_10005156 Ga0207695_1000515615 319
263 3300025913 Ga0207695_10010294 Ga0207695_100102945 319
264 3300025913 Ga0207695_10047815 Ga0207695_100478153 319
265 3300025920 Ga0207649_10167351 Ga0207649_101673512 319
266 3300025921 Ga0207652_10292202 Ga0207652_102922022 319
267 3300025924 Ga0207694_10024624 Ga0207694_100246245 319
268 3300025925 Ga0207650_10001544 Ga0207650_100015441 319
269 3300025926 Ga0207659_10167308 Ga0207659_101673082 319
270 3300025931 Ga0207644_10006588 Ga0207644_100065882 319
271 3300025940 Ga0207691_10000467 Ga0207691_1000046724 319
272 3300025945 Ga0207679_10006057 Ga0207679_100060576 319
273 3300025949 Ga0207667_10460562 Ga0207667_104605622 319
274 3300025960 Ga0207651_10107147 Ga0207651_101071471 319
275 3300025986 Ga0207658_10124606 Ga0207658_101246063 319
276 3300026041 Ga0207639_10082657 Ga0207639_100826572 319
277 3300026089 Ga0207648_10033070 Ga0207648_100330702 319
278 3300026089 Ga0207648_10055894 Ga0207648_100558942 319
279 3300026095 Ga0207676_10031075 Ga0207676_100310751 319
280 3300026121 Ga0207683_10000732 Ga0207683_1000073214 319
281 3300026142 Ga0207698_10000821 Ga0207698_100008216 319
282 3300028379 Ga0268266_10181626 Ga0268266_101816262 319
283 3300028379 Ga0268266_10312022 Ga0268266_103120222 319
284 3300041512 Ga0451853_2330983 Ga0451853_2330983_207_1169 319
285 3300044765 Ga0466970_0047593 Ga0466970_0047593_554_1513 319
286 3300046460 Ga0495638_0042564 Ga0495638_0042564_990_1949 319
287 3300046694 Ga0495649_0049150 Ga0495649_0049150_608_1609 319
288 3300047472 Ga0495686_0184867 Ga0495686_0184867_223_1182 319
289 3300048911 Ga0496108_0112115 Ga0496108_0112115_523_1485 319
290 3300048913 Ga0496110_0011343 Ga0496110_0011343_6238_7200 319
291 3300048914 Ga0496111_0020101 Ga0496111_0020101_2657_3619 319
292 3300053140 Ga0500573_0084816 Ga0500573_0084816_48_1055 319
293 3300025921 Ga0207652_10449467 Ga0207652_104494672 320
294 3300037853 Ga0436364_1136242 Ga0436364_1136242_557_1531 320
295 3300038443 Ga0395901_0234373 Ga0395901_0234373_97_1164 320
296 3300003320 rootH2_10004104 rootH2_100041044 321
297 3300003320 rootH2_10085773 rootH2_100857734 321
298 3300003354 JGI25160J50197_1007970 JGI25160J50197_10079702 321
299 3300003771 Ga0055526_1009925 Ga0055526_10099255 321
300 3300003790 Ga0055528_1001249 Ga0055528_10012493 321
301 3300005262 Ga0065165_1000056 Ga0065165_1000056133 321
302 3300005329 Ga0070683_100178981 Ga0070683_1001789812 321
303 3300005336 Ga0070680_100000801 Ga0070680_10000080113 321
304 3300005339 Ga0070660_100082117 Ga0070660_1000821172 321
305 3300005435 Ga0070714_100114237 Ga0070714_1001142372 321
306 3300005458 Ga0070681_10001223 Ga0070681_100012239 321
307 3300005530 Ga0070679_100000103 Ga0070679_10000010350 321
308 3300005563 Ga0068855_100000145 Ga0068855_10000014546 321
309 3300005614 Ga0068856_100234523 Ga0068856_1002345232 321
310 3300013100 Ga0157373_10065298 Ga0157373_100652982 321
311 3300013307 Ga0157372_10012311 Ga0157372_100123114 321
312 3300025273 Ga0209673_1000014 Ga0209673_100001478 321
313 3300025273 Ga0209673_1000018 Ga0209673_100001826 321
314 3300025297 Ga0209758_1003372 Ga0209758_100337212 321
315 3300025298 Ga0209050_1000539 Ga0209050_100053925 321
316 3300025304 Ga0209257_1001417 Ga0209257_100141721 321
317 3300025909 Ga0207705_10004703 Ga0207705_100047037 321
318 3300025917 Ga0207660_10002419 Ga0207660_100024199 321
319 3300025921 Ga0207652_10000098 Ga0207652_1000009836 321
320 3300025921 Ga0207652_10000187 Ga0207652_1000018718 321
321 3300025949 Ga0207667_10000508 Ga0207667_1000050815 321
322 3300026067 Ga0207678_10018345 Ga0207678_100183452 321
323 3300026078 Ga0207702_10105391 Ga0207702_101053912 321
324 3300031731 Ga0307405_10001731 Ga0307405_100017315 321
325 3300037418 Ga0395900_0008936 Ga0395900_0008936_7377_8372 321
326 3300037471 Ga0395905_0218582 Ga0395905_0218582_645_1640 321
327 3300049570 Ga0501033_0066029 Ga0501033_0066029_1043_2035 321
328 3300049571 Ga0501034_0370282 Ga0501034_0370282_104_1096 321
329 3300003322 rootL2_10080456 rootL2_100804563 322
330 3300005331 Ga0070670_100049080 Ga0070670_1000490802 322
331 3300005530 Ga0070679_100242667 Ga0070679_1002426672 322
332 3300005577 Ga0068857_100000360 Ga0068857_1000003607 322
333 3300005578 Ga0068854_100032258 Ga0068854_1000322582 322
334 3300005616 Ga0068852_100000427 Ga0068852_1000004277 322
335 3300009551 Ga0105238_10003851 Ga0105238_100038517 322
336 3300013102 Ga0157371_10003005 Ga0157371_1000300513 322
337 3300013102 Ga0157371_10014215 Ga0157371_100142151 322
338 3300013104 Ga0157370_10003373 Ga0157370_1000337319 322
339 3300013104 Ga0157370_10005278 Ga0157370_100052782 322
340 3300013105 Ga0157369_10011153 Ga0157369_100111534 322
341 3300013307 Ga0157372_10001086 Ga0157372_1000108616 322
342 3300013307 Ga0157372_10009931 Ga0157372_1000993112 322
343 3300025913 Ga0207695_10012734 Ga0207695_100127347 322
344 3300025924 Ga0207694_10007359 Ga0207694_100073594 322
345 3300025949 Ga0207667_10000519 Ga0207667_100005197 322
346 3300025960 Ga0207651_10239527 Ga0207651_102395272 322
347 3300025981 Ga0207640_10023955 Ga0207640_100239552 322
348 3300026116 Ga0207674_10001621 Ga0207674_100016218 322
349 3300026142 Ga0207698_10001833 Ga0207698_100018337 322
350 3300037312 Ga0395899_0014152 Ga0395899_0014152_2616_3674 322
351 3300049652 Ga0501202_001069 Ga0501202_001069_1292_2293 322
352 3300049657 Ga0501210_000143 Ga0501210_000143_1363_2364 322
353 3300049686 Ga0501257_001080 Ga0501257_001080_2023_3024 322
354 3300049761 Ga0501264_000059 Ga0501264_000059_2819_3820 322
355 iso_pu_bacteria 2929154850 2929159188 322
356 3300003323 rootH1_10002268 rootH1_1000226853 323
357 3300005327 Ga0070658_10215235 Ga0070658_102152351 323
358 3300025909 Ga0207705_10112255 Ga0207705_101122552 323
359 3300044658 Ga0466972_0000019 Ga0466972_0000019_147102_148235 323
360 3300044765 Ga0466970_0010781 Ga0466970_0010781_2193_3326 323
361 3300044901 Ga0466960_0010936 Ga0466960_0010936_491_1531 323
362 iso_pu_bacteria 2599185178 2599444783 326
363 iso_pu_bacteria 2900577576 2900582540 326
364 iso_pu_bacteria 2928058823 2928059914 326
365 3300001915 JGI24741J21665_1000245 JGI24741J21665_100024510 330
366 3300001979 JGI24740J21852_10000057 JGI24740J21852_1000005720 330
367 3300002705 JGI25156J39149_1005017 JGI25156J39149_10050174 330
368 3300003578 Ga0006562J51391_1172264 Ga0006562J51391_11722643 330
369 3300003578 Ga0006562J51391_1172265 Ga0006562J51391_11722652 330
370 3300003751 Ga0055538_1003988 Ga0055538_10039882 330
371 3300003752 Ga0055539_1000168 Ga0055539_100016825 330
372 3300003758 Ga0055532_1000033 Ga0055532_100003328 330
373 3300003759 Ga0055525_1000264 Ga0055525_100026448 330
374 3300003760 Ga0055527_1000464 Ga0055527_100046411 330
375 3300003761 Ga0055535_1000024 Ga0055535_100002428 330
376 3300003763 Ga0055529_1000044 Ga0055529_100004428 330
377 3300003841 Ga0055541_1003465 Ga0055541_10034652 330
378 3300003841 Ga0055541_1007868 Ga0055541_10078682 330
379 3300005344 Ga0070661_100000027 Ga0070661_10000002760 330
380 3300005455 Ga0070663_100000004 Ga0070663_100000004167 330
381 3300005564 Ga0070664_100000041 Ga0070664_10000004113 330
382 3300005614 Ga0068856_100000004 Ga0068856_100000004152 330
383 3300005616 Ga0068852_100170616 Ga0068852_1001706162 330
384 3300009093 Ga0105240_10204570 Ga0105240_102045703 330
385 3300013100 Ga0157373_10001236 Ga0157373_1000123611 330
386 3300013102 Ga0157371_10000028 Ga0157371_1000002858 330
387 3300013104 Ga0157370_10000002 Ga0157370_10000002194 330
388 3300013307 Ga0157372_10000065 Ga0157372_1000006571 330
389 3300015261 Ga0182006_1001420 Ga0182006_10014207 330
390 3300025224 Ga0209784_100024 Ga0209784_100024167 330
391 3300025224 Ga0209784_102339 Ga0209784_1023392 330
392 3300025225 Ga0209566_100018 Ga0209566_100018167 330
393 3300025225 Ga0209566_100725 Ga0209566_10072511 330
394 3300025226 Ga0209674_100046 Ga0209674_100046196 330
395 3300025226 Ga0209674_104647 Ga0209674_1046472 330
396 3300025228 Ga0209672_100138 Ga0209672_10013841 330
397 3300025228 Ga0209672_100179 Ga0209672_10017912 330
398 3300025229 Ga0209147_100008 Ga0209147_100008214 330
399 3300025230 Ga0209563_100039 Ga0209563_100039196 330
400 3300025230 Ga0209563_100090 Ga0209563_10009043 330
401 3300025242 Ga0209258_100013 Ga0209258_100013214 330
402 3300025253 Ga0209677_100024 Ga0209677_100024194 330
403 3300025256 Ga0209759_1001093 Ga0209759_100109314 330
404 3300025256 Ga0209759_1023777 Ga0209759_10237772 330
405 3300025272 Ga0209455_1000042 Ga0209455_1000042214 330
406 3300025913 Ga0207695_10010513 Ga0207695_100105135 330
407 3300025920 Ga0207649_10000685 Ga0207649_1000068514 330
408 3300025945 Ga0207679_10000004 Ga0207679_10000004351 330
409 3300026067 Ga0207678_10000005 Ga0207678_10000005167 330
410 3300026078 Ga0207702_10000276 Ga0207702_100002768 330
411 3300026116 Ga0207674_10030001 Ga0207674_100300014 330
412 3300026142 Ga0207698_10020985 Ga0207698_100209855 330
413 3300037312 Ga0395899_0094988 Ga0395899_0094988_268_1260 330
414 3300037418 Ga0395900_0017540 Ga0395900_0017540_4590_5582 330
415 3300044650 Ga0466986_0001695 Ga0466986_0001695_8636_9628 330
416 3300044656 Ga0466969_0005656 Ga0466969_0005656_4521_5513 330
417 3300044658 Ga0466972_0037628 Ga0466972_0037628_326_1318 330
418 3300044683 Ga0466965_0000602 Ga0466965_0000602_3245_4237 330
419 3300044693 Ga0466961_0000282 Ga0466961_0000282_17002_17994 330
420 3300044694 Ga0466963_0001136 Ga0466963_0001136_6069_7061 330
421 3300044706 Ga0466964_0037688 Ga0466964_0037688_778_1770 330
422 3300044719 Ga0466971_0011216 Ga0466971_0011216_1045_2037 330
423 3300044765 Ga0466970_0000346 Ga0466970_0000346_12304_13296 330
424 3300044901 Ga0466960_0005125 Ga0466960_0005125_3776_4768 330
425 3300045049 Ga0466959_0000688 Ga0466959_0000688_1750_2742 330
426 3300045976 Ga0466967_0011292 Ga0466967_0011292_884_1876 330
427 3300048928 Ga0496125_0003266 Ga0496125_0003266_8237_9229 330
428 3300061719 Ga0466962_0005410 Ga0466962_0005410_1575_2567 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

206

324

0.94

PF00534

Glycos_transf_1

Glycosyl transferases group 1

241

338

0.93

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

217

354

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.7768 69 319
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.7615 153 304
4x7r-assembly1.cif.gz_A crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp 0.7534 75 319
4wac-assembly1.cif.gz_A crystal structure of tarm 0.7439 76 319
7ec7-assembly1.cif.gz_A crystal structure of sdgb (complexed with phosphate ions) 0.7404 77 317
ID Description Score Start End Superfamily
af_Q9SSP6_536_651_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9116 235 304 3.40.50.2000
af_Q58469_205_369_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8206 168 300 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8178 168 304 3.40.50.2000
af_Q84QB1_230_385_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8158 168 303 3.40.50.2000
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7955 168 301 3.40.50.2000
ID Description Score Start End GO Terms
AF-B8HSR2-F1-model_v4 Glycosyl transferase group 1 0.9898 6 324 GO:0016757
AF-K0DT44-F1-model_v4 Group 1 glucosyll transferase 0.9891 12 323 GO:0016757
AF-E5ALC2-F1-model_v4 Lipopolysaccharide N-acetylglucosaminyltransferase 0.9877 1 323 GO:0016757
AF-A0A2H5YRP3-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9855 6 324 GO:0016757
AF-A0A2U2HEX1-F1-model_v4 LPS biosynthesis transferase 0.9854 6 324 GO:0016757

Feature Viewer

pLDDT pTM Quality
94.01 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map