F441685

General Info

Members Datasets Scaffolds Average Seq Length
428 271 856 137

Family's Representative Sequence

Representative Sequence 3300020069|Ga0197907_10885099|Ga0197907_108850992
Length 163
Sequence VPGQAGEQTGQESRSVRGTAVTSVSVMEISIQYTFLPHTDGEAALAFYRDTLGFEVRKDVGYEGMRWLTVGPANQPGTSVVLHPPAVDPGITDDERRTVLDLIAKGSYGAALTLATDDLDGLFKRLVDSGADVLQEPTEQPWGDRDCAFRDPTGNLVRINEVH

Samples

Sample ID Description Type Environment
1 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
185 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
190 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
191 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
197 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
242 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
252 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
253 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
261 2643221559 Lysobacter sp. Root559 Isolate Unclassified
262 2643221586 Lysobacter sp. Root667 Isolate Unclassified
263 2643221612 Lysobacter sp. Root76 Isolate Unclassified
264 2643221727 Lysobacter sp. Root96 Isolate Unclassified
265 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
266 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
267 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
268 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
269 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
270 2855683550 Micromonospora sp. RP3T Isolate Unclassified
271 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 3.04
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 0.23
Rhizoplane 9.58
Rhizosphere 82.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0197907_10885099 3300020069 Bacteria 732
2 JGI24741J21665_1022798 3300001915 Bacteria 969
3 JGI24743J22301_10064215 3300001991 Bacteria 759
4 JGI24743J22301_10078396 3300001991 Bacteria 695
5 JGI24751J29686_10002358 3300002459 Bacteria 3810
6 JGI25407J50210_10003927 3300003373 Bacteria 3603
7 Ga0058861_12014822 3300004800 Bacteria 739
8 Ga0070658_10118829 3300005327 Bacteria 2195
9 Ga0070658_10137587 3300005327 Bacteria 2039
10 Ga0070658_10486997 3300005327 Bacteria 1064
11 Ga0070683_100150464 3300005329 Bacteria 2207
12 Ga0070690_101068242 3300005330 Bacteria 639
13 Ga0070670_100329240 3300005331 Bacteria 1339
14 Ga0070670_100707498 3300005331 Bacteria 906
15 Ga0068869_100009358 3300005334 Bacteria 6356
16 Ga0068869_100746562 3300005334 Bacteria 838
17 Ga0070680_100034212 3300005336 Bacteria 4097
18 Ga0070682_100052911 3300005337 Bacteria 2542
19 Ga0070682_100088644 3300005337 Bacteria 2020
20 Ga0068868_100017809 3300005338 Bacteria 5298
21 Ga0070660_100021481 3300005339 Bacteria 4762
22 Ga0070660_100182896 3300005339 Bacteria 1696
23 Ga0070689_100071588 3300005340 Bacteria 2709
24 Ga0070691_10047065 3300005341 Bacteria 2050
25 Ga0070687_100572197 3300005343 Bacteria 772
26 Ga0070661_100024241 3300005344 Bacteria 4352
27 Ga0070692_10007795 3300005345 Bacteria 4743
28 Ga0070692_10044212 3300005345 Bacteria 2293
29 Ga0070668_100003010 3300005347 Bacteria 12460
30 Ga0070669_100440181 3300005353 Bacteria 1073
31 Ga0070675_100004917 3300005354 Bacteria 10192
32 Ga0070675_100015511 3300005354 Bacteria 6025
33 Ga0070671_100016964 3300005355 Bacteria 5889
34 Ga0070674_100037965 3300005356 Bacteria 3243
35 Ga0070673_100142453 3300005364 Bacteria 2023
36 Ga0070688_100020926 3300005365 Bacteria 3812
37 Ga0070659_100009446 3300005366 Bacteria 7163
38 Ga0070659_100239469 3300005366 Bacteria 1501
39 Ga0070659_100456650 3300005366 Bacteria 1084
40 Ga0070667_100208812 3300005367 Bacteria 1735
41 Ga0070667_101313693 3300005367 Bacteria 678
42 Ga0070709_10002881 3300005434 Bacteria 9281
43 Ga0070713_100038302 3300005436 Bacteria 3883
44 Ga0070713_100255947 3300005436 Bacteria 1599
45 Ga0070710_10121508 3300005437 Bacteria 1582
46 Ga0070700_100036502 3300005441 Bacteria 2981
47 Ga0070663_100099752 3300005455 Bacteria 2165
48 Ga0070663_100997458 3300005455 Bacteria 728
49 Ga0070678_100025122 3300005456 Bacteria 4002
50 Ga0070662_100097074 3300005457 Bacteria 2224
51 Ga0070662_100479028 3300005457 Bacteria 1036
52 Ga0070681_10083741 3300005458 Bacteria 3142
53 Ga0070681_10938617 3300005458 Bacteria 784
54 Ga0070681_11154503 3300005458 Bacteria 696
55 Ga0068867_100543822 3300005459 Bacteria 1005
56 Ga0068867_100598997 3300005459 Bacteria 961
57 Ga0070685_10016797 3300005466 Bacteria 3905
58 Ga0070679_100115611 3300005530 Bacteria 2668
59 Ga0070684_100005506 3300005535 Bacteria 9710
60 Ga0070684_101988186 3300005535 Bacteria 549
61 Ga0070697_100448535 3300005536 Bacteria 1124
62 Ga0070672_100517034 3300005543 Bacteria 1034
63 Ga0070696_100041299 3300005546 Bacteria 3186
64 Ga0070693_100004100 3300005547 Bacteria 6859
65 Ga0070693_100163092 3300005547 Bacteria 1421
66 Ga0068855_100147338 3300005563 Bacteria 2679
67 Ga0068855_100164912 3300005563 Bacteria 2512
68 Ga0070664_100006006 3300005564 Bacteria 9817
69 Ga0068857_100196306 3300005577 Bacteria 1839
70 Ga0068854_100083476 3300005578 Bacteria 2362
71 Ga0068856_100021478 3300005614 Bacteria 6274
72 Ga0070702_100060452 3300005615 Bacteria 2203
73 Ga0068852_100195046 3300005616 Bacteria 1913
74 Ga0068859_100053999 3300005617 Bacteria 4040
75 Ga0068864_100080530 3300005618 Bacteria 2853
76 Ga0068864_100171118 3300005618 Bacteria 1980
77 Ga0068861_100086639 3300005719 Bacteria 2463
78 Ga0068851_10037507 3300005834 Bacteria 2430
79 Ga0068870_10019657 3300005840 Bacteria 3278
80 Ga0068863_100088115 3300005841 Bacteria 2941
81 Ga0068863_100734327 3300005841 Bacteria 983
82 Ga0068858_100000791 3300005842 Bacteria 33039
83 Ga0068858_100231720 3300005842 Bacteria 1751
84 Ga0068860_100093123 3300005843 Bacteria 2872
85 Ga0068862_100013850 3300005844 Bacteria 6684
86 Ga0081538_10000943 3300005981 Bacteria 31327
87 Ga0081538_10267260 3300005981 Bacteria 642
88 Ga0081540_1070722 3300005983 Bacteria 1615
89 Ga0070717_11014963 3300006028 Bacteria 756
90 Ga0075365_10952047 3300006038 Bacteria 605
91 Ga0070712_100187301 3300006175 Bacteria 1617
92 Ga0070712_100393740 3300006175 Bacteria 1143
93 Ga0070712_100542848 3300006175 Bacteria 979
94 Ga0075370_10041645 3300006353 Bacteria 2593
95 Ga0068871_100101518 3300006358 Bacteria 2411
96 Ga0068871_100441829 3300006358 Bacteria 1165
97 Ga0068871_100559851 3300006358 Bacteria 1036
98 Ga0075428_100177807 3300006844 Bacteria 2304
99 Ga0075433_10036095 3300006852 Bacteria 4255
100 Ga0075434_100014814 3300006871 Bacteria 7461
101 Ga0075436_100410486 3300006914 Bacteria 982
102 Ga0097620_100054000 3300006931 Bacteria 4040
103 Ga0075435_100020503 3300007076 Bacteria 5066
104 Ga0075435_100204487 3300007076 Bacteria 1674
105 Ga0105240_10060309 3300009093 Bacteria 4729
106 Ga0111539_10000749 3300009094 Bacteria 42208
107 Ga0111539_10116947 3300009094 Bacteria 3126
108 Ga0105245_10022880 3300009098 Bacteria 5483
109 Ga0105245_10338351 3300009098 Bacteria 1487
110 Ga0105245_10850529 3300009098 Bacteria 952
111 Ga0105245_11020356 3300009098 Bacteria 872
112 Ga0105247_10069701 3300009101 Bacteria 2195
113 Ga0114129_11623202 3300009147 Bacteria 791
114 Ga0105243_11002232 3300009148 Bacteria 838
115 Ga0105243_12452570 3300009148 Bacteria 560
116 Ga0105241_10013550 3300009174 Bacteria 5975
117 Ga0105241_10246843 3300009174 Bacteria 1512
118 Ga0105237_10213898 3300009545 Bacteria 1927
119 Ga0105237_10331038 3300009545 Bacteria 1527
120 Ga0105237_11185986 3300009545 Bacteria 770
121 Ga0105238_10321215 3300009551 Bacteria 1534
122 Ga0105239_11167710 3300010375 Bacteria 887
123 Ga0157373_10078136 3300013100 Bacteria 2334
124 Ga0157371_10043935 3300013102 Bacteria 3182
125 Ga0157370_10163283 3300013104 Bacteria 2072
126 Ga0157370_10902279 3300013104 Bacteria 802
127 Ga0157369_10159419 3300013105 Bacteria 2382
128 Ga0157369_12303962 3300013105 Bacteria 546
129 Ga0157374_10101171 3300013296 Bacteria 2763
130 Ga0157374_10398387 3300013296 Bacteria 1373
131 Ga0157374_10486150 3300013296 Bacteria 1238
132 Ga0157378_10471452 3300013297 Bacteria 1249
133 Ga0163162_10110747 3300013306 Bacteria 2843
134 Ga0157372_10218206 3300013307 Bacteria 2211
135 Ga0157375_10515576 3300013308 Bacteria 1359
136 Ga0157375_11224604 3300013308 Bacteria 881
137 Ga0157375_11978269 3300013308 Bacteria 693
138 Ga0157375_12510829 3300013308 Bacteria 615
139 Ga0163163_10063134 3300014325 Bacteria 3672
140 Ga0163163_10278462 3300014325 Bacteria 1724
141 Ga0163163_10551646 3300014325 Bacteria 1215
142 Ga0163163_11461358 3300014325 Bacteria 745
143 Ga0157380_11449924 3300014326 Bacteria 738
144 Ga0182008_10340426 3300014497 Bacteria 793
145 Ga0157377_10001519 3300014745 Bacteria 10067
146 Ga0157377_10038824 3300014745 Bacteria 2631
147 Ga0157376_10565131 3300014969 Bacteria 1127
148 Ga0206356_10362240 3300020070 Bacteria 3259
149 Ga0206349_1621715 3300020075 Bacteria 799
150 Ga0206351_10641389 3300020077 Bacteria 2547
151 Ga0206353_10443871 3300020082 Bacteria 1926
152 Ga0206353_10939952 3300020082 Bacteria 3371
153 Ga0206353_10944564 3300020082 Bacteria 825
154 Ga0206353_11405763 3300020082 Bacteria 594
155 Ga0154015_1113465 3300020610 Bacteria 1569
156 Ga0224712_10022840 3300022467 Bacteria 2162
157 Ga0224712_10142416 3300022467 Bacteria 1056
158 Ga0207656_10011093 3300025321 Bacteria 3396
159 Ga0207713_1096520 3300025735 Bacteria 1028
160 Ga0207692_10035073 3300025898 Bacteria 2435
161 Ga0207642_10549913 3300025899 Bacteria 713
162 Ga0207710_10039466 3300025900 Bacteria 2090
163 Ga0207688_10030308 3300025901 Bacteria 2982
164 Ga0207688_10043189 3300025901 Bacteria 2510
165 Ga0207688_10059014 3300025901 Bacteria 2160
166 Ga0207680_10317747 3300025903 Bacteria 1088
167 Ga0207699_10014920 3300025906 Bacteria 4022
168 Ga0207645_10155670 3300025907 Bacteria 1493
169 Ga0207643_10000101 3300025908 Bacteria 58843
170 Ga0207705_10014910 3300025909 Bacteria 5590
171 Ga0207705_10259161 3300025909 Bacteria 1327
172 Ga0207654_10059588 3300025911 Bacteria 2227
173 Ga0207654_10246153 3300025911 Bacteria 1197
174 Ga0207707_10763424 3300025912 Bacteria 808
175 Ga0207707_11201200 3300025912 Bacteria 614
176 Ga0207695_10292203 3300025913 Bacteria 1522
177 Ga0207671_10265776 3300025914 Bacteria 1351
178 Ga0207693_10090124 3300025915 Bacteria 2404
179 Ga0207693_10136484 3300025915 Bacteria 1929
180 Ga0207693_10829048 3300025915 Bacteria 712
181 Ga0207660_10024741 3300025917 Bacteria 4068
182 Ga0207662_10074139 3300025918 Bacteria 2065
183 Ga0207662_10284689 3300025918 Bacteria 1095
184 Ga0207657_10007875 3300025919 Bacteria 10873
185 Ga0207657_10021631 3300025919 Bacteria 6047
186 Ga0207649_10001504 3300025920 Bacteria 13697
187 Ga0207649_10292761 3300025920 Bacteria 1188
188 Ga0207652_10018189 3300025921 Bacteria 5761
189 Ga0207681_10146355 3300025923 Bacteria 1766
190 Ga0207694_10060870 3300025924 Bacteria 2939
191 Ga0207650_10018243 3300025925 Bacteria 4922
192 Ga0207650_10026942 3300025925 Bacteria 4108
193 Ga0207659_10046393 3300025926 Bacteria 3068
194 Ga0207659_10471501 3300025926 Bacteria 1059
195 Ga0207687_10471531 3300025927 Bacteria 1044
196 Ga0207687_11149213 3300025927 Bacteria 667
197 Ga0207700_10005745 3300025928 Bacteria 7452
198 Ga0207644_10369930 3300025931 Bacteria 1167
199 Ga0207690_10022225 3300025932 Bacteria 3944
200 Ga0207690_10029794 3300025932 Bacteria 3474
201 Ga0207706_10002310 3300025933 Bacteria 18597
202 Ga0207686_10452838 3300025934 Bacteria 987
203 Ga0207709_10081160 3300025935 Bacteria 2090
204 Ga0207709_10234356 3300025935 Bacteria 1331
205 Ga0207709_10349066 3300025935 Bacteria 1116
206 Ga0207670_10295635 3300025936 Bacteria 1266
207 Ga0207669_10233115 3300025937 Bacteria 1359
208 Ga0207704_10243007 3300025938 Bacteria 1346
209 Ga0207689_10000644 3300025942 Bacteria 33268
210 Ga0207689_10015331 3300025942 Bacteria 6487
211 Ga0207661_10416693 3300025944 Bacteria 1219
212 Ga0207661_10777520 3300025944 Bacteria 881
213 Ga0207661_11252569 3300025944 Bacteria 682
214 Ga0207679_10011541 3300025945 Bacteria 5728
215 Ga0207679_10031685 3300025945 Bacteria 3703
216 Ga0207667_10488794 3300025949 Bacteria 1249
217 Ga0207651_10079933 3300025960 Bacteria 2351
218 Ga0207668_10006868 3300025972 Bacteria 6751
219 Ga0207640_10083299 3300025981 Bacteria 2193
220 Ga0207677_10013666 3300026023 Bacteria 4712
221 Ga0207677_10246789 3300026023 Bacteria 1448
222 Ga0207703_10185966 3300026035 Bacteria 1836
223 Ga0207678_10000139 3300026067 Bacteria 59389
224 Ga0207678_10019217 3300026067 Bacteria 6000
225 Ga0207678_10144893 3300026067 Bacteria 2027
226 Ga0207708_10127473 3300026075 Bacteria 1987
227 Ga0207702_10018220 3300026078 Bacteria 5808
228 Ga0207702_10026387 3300026078 Bacteria 4823
229 Ga0207702_10879498 3300026078 Bacteria 887
230 Ga0207641_10015702 3300026088 Bacteria 6204
231 Ga0207641_10187647 3300026088 Bacteria 1898
232 Ga0207648_10342328 3300026089 Bacteria 1347
233 Ga0207648_10647693 3300026089 Bacteria 976
234 Ga0207676_10016983 3300026095 Bacteria 5271
235 Ga0207674_10130748 3300026116 Bacteria 2474
236 Ga0207674_10162117 3300026116 Bacteria 2190
237 Ga0207674_11510315 3300026116 Bacteria 641
238 Ga0207675_100127344 3300026118 Bacteria 2413
239 Ga0207675_100337542 3300026118 Bacteria 1474
240 Ga0207683_10000316 3300026121 Bacteria 43919
241 Ga0207683_10180131 3300026121 Bacteria 1916
242 Ga0207428_10014470 3300027907 Bacteria 6853
243 Ga0207428_10064210 3300027907 Bacteria 2899
244 Ga0268266_10567607 3300028379 Bacteria 1088
245 Ga0268265_10010236 3300028380 Bacteria 6333
246 Ga0307515_10009076 3300028794 Bacteria 19288
247 Ga0307511_10062203 3300030521 Bacteria 2836
248 Ga0307512_10031583 3300030522 Bacteria 4582
249 Ga0265327_10000630 3300031251 Bacteria 57536
250 Ga0307513_10008407 3300031456 Bacteria 13217
251 Ga0307508_10005712 3300031616 Bacteria 11779
252 Ga0307405_10105397 3300031731 Bacteria 1899
253 Ga0307518_10000036 3300031838 Bacteria 91114
254 Ga0307406_10003954 3300031901 Bacteria 8054
255 Ga0307412_10049681 3300031911 Bacteria 2765
256 Ga0307412_10089357 3300031911 Bacteria 2151
257 Ga0307416_100810305 3300032002 Bacteria 1032
258 Ga0307411_10443370 3300032005 Bacteria 1084
259 Ga0307415_100007715 3300032126 Bacteria 5909
260 Ga0307415_100628561 3300032126 Bacteria 959
261 Ga0307415_100965829 3300032126 Bacteria 790
262 Ga0307510_10163891 3300033180 Bacteria 1815
263 Ga0395899_0027555 3300037312 Bacteria 4282
264 Ga0395899_0126505 3300037312 Bacteria 1827
265 Ga0395899_0367266 3300037312 Bacteria 959
266 Ga0395900_0031969 3300037418 Bacteria 5409
267 Ga0395900_0181826 3300037418 Bacteria 2136
268 Ga0395900_0972345 3300037418 Bacteria 770
269 Ga0395898_0057272 3300037466 Bacteria 3798
270 Ga0395898_0087955 3300037466 Bacteria 2992
271 Ga0395898_0276044 3300037466 Bacteria 1603
272 Ga0395898_0977321 3300037466 Bacteria 783
273 Ga0395901_0029688 3300038443 Bacteria 5630
274 Ga0395901_0387063 3300038443 Bacteria 1438
275 Ga0439436_0018331 3300041404 Bacteria 2093
276 Ga0439439_0005812 3300041406 Bacteria 2834
277 Ga0451789_0641791 3300041443 Bacteria 3248
278 Ga0451791_0794569 3300041451 Bacteria 833
279 Ga0451793_0894513 3300041452 Bacteria 6487
280 Ga0451793_1325731 3300041452 Bacteria 1279
281 Ga0451797_1351634 3300041453 Bacteria 889
282 Ga0451795_1209490 3300041456 Bacteria 817
283 Ga0451802_0060221 3300041460 Bacteria 1901
284 Ga0451802_0338690 3300041460 Bacteria 2774
285 Ga0451804_0942609 3300041463 Bacteria 848
286 Ga0451807_1655984 3300041486 Bacteria 1273
287 Ga0451807_1736117 3300041486 Bacteria 623
288 Ga0451833_0295084 3300041491 Bacteria 528
289 Ga0451837_0525443 3300041494 Bacteria 1303
290 Ga0451839_0702160 3300041496 Bacteria 1519
291 Ga0451839_0951047 3300041496 Bacteria 625
292 Ga0451839_1488530 3300041496 Bacteria 614
293 Ga0451849_0287471 3300041505 Bacteria 1520
294 Ga0451853_0937864 3300041512 Bacteria 3064
295 Ga0439448_0008173 3300042005 Bacteria 3056
296 Ga0439449_0021622 3300042007 Bacteria 2409
297 Ga0439463_009944 3300042016 Bacteria 2337
298 Ga0439459_0000631 3300042438 Bacteria 4760
299 Ga0439464_0315091 3300042439 Bacteria 512
300 Ga0466969_0030807 3300044656 Bacteria 2732
301 Ga0466969_0340370 3300044656 Bacteria 679
302 Ga0466972_0022235 3300044658 Bacteria 3159
303 Ga0466972_0035529 3300044658 Bacteria 2438
304 Ga0466972_0305048 3300044658 Bacteria 744
305 Ga0466965_0207742 3300044683 Bacteria 1040
306 Ga0466965_0443127 3300044683 Bacteria 722
307 Ga0466966_0092588 3300044684 Bacteria 1875
308 Ga0466961_0007438 3300044693 Bacteria 6971
309 Ga0466961_0022696 3300044693 Bacteria 4036
310 Ga0466961_0025138 3300044693 Bacteria 3832
311 Ga0466961_0112591 3300044693 Bacteria 1711
312 Ga0466963_0002274 3300044694 Bacteria 10670
313 Ga0466963_0198368 3300044694 Bacteria 1403
314 Ga0466963_0206152 3300044694 Bacteria 1375
315 Ga0466963_0266630 3300044694 Bacteria 1203
316 Ga0466963_0283840 3300044694 Bacteria 1164
317 Ga0466963_0327317 3300044694 Bacteria 1078
318 Ga0466963_0462704 3300044694 Bacteria 895
319 Ga0466964_0074665 3300044706 Bacteria 1442
320 Ga0466964_0137231 3300044706 Bacteria 1120
321 Ga0466964_0228280 3300044706 Bacteria 907
322 Ga0466971_0004895 3300044719 Bacteria 5791
323 Ga0466971_0042249 3300044719 Bacteria 2048
324 Ga0466971_0319893 3300044719 Bacteria 747
325 Ga0466968_0287940 3300044735 Bacteria 788
326 Ga0466970_0000569 3300044765 Bacteria 18059
327 Ga0466970_0023410 3300044765 Bacteria 3225
328 Ga0466970_0042647 3300044765 Bacteria 2413
329 Ga0466970_0287467 3300044765 Bacteria 925
330 Ga0466970_0844336 3300044765 Bacteria 537
331 Ga0466957_0035309 3300044842 Bacteria 3000
332 Ga0466957_0076900 3300044842 Bacteria 2073
333 Ga0466960_0001683 3300044901 Bacteria 8102
334 Ga0466960_0042963 3300044901 Bacteria 2148
335 Ga0466960_0050302 3300044901 Bacteria 2009
336 Ga0466960_0764046 3300044901 Bacteria 583
337 Ga0466959_0092439 3300045049 Bacteria 2171
338 Ga0466959_0225956 3300045049 Bacteria 1297
339 Ga0466958_0047297 3300045836 Bacteria 2597
340 Ga0466958_0065007 3300045836 Bacteria 2226
341 Ga0466958_0084684 3300045836 Bacteria 1955
342 Ga0466958_0098380 3300045836 Bacteria 1816
343 Ga0466958_0111587 3300045836 Bacteria 1707
344 Ga0466958_0122100 3300045836 Bacteria 1631
345 Ga0466958_0697118 3300045836 Bacteria 661
346 Ga0466967_0057236 3300045976 Bacteria 3441
347 Ga0495638_0095119 3300046460 Bacteria 1790
348 Ga0495584_0224872 3300046491 Bacteria 954
349 Ga0495632_0049781 3300046519 Bacteria 2070
350 Ga0495624_0667253 3300046690 Bacteria 618
351 Ga0495604_0242058 3300047317 Bacteria 1233
352 Ga0495687_035171 3300047443 Bacteria 2256
353 Ga0495685_229162 3300047447 Bacteria 592
354 Ga0496100_0282794 3300048903 Bacteria 1237
355 Ga0496100_0763036 3300048903 Bacteria 757
356 Ga0496101_0059287 3300048904 Bacteria 2774
357 Ga0496102_0051529 3300048905 Bacteria 3749
358 Ga0496102_1066326 3300048905 Bacteria 728
359 Ga0496103_0295739 3300048906 Bacteria 1042
360 Ga0496104_0049623 3300048907 Bacteria 3957
361 Ga0496104_0237780 3300048907 Bacteria 1733
362 Ga0496105_0151459 3300048908 Bacteria 1906
363 Ga0496105_0512076 3300048908 Bacteria 941
364 Ga0496106_0051044 3300048909 Bacteria 3118
365 Ga0496108_0279801 3300048911 Bacteria 1452
366 Ga0496108_1391702 3300048911 Bacteria 587
367 Ga0496109_0016606 3300048912 Bacteria 6437
368 Ga0496109_1127009 3300048912 Bacteria 721
369 Ga0496110_0156803 3300048913 Bacteria 2062
370 Ga0496110_0403206 3300048913 Bacteria 1246
371 Ga0496110_1577321 3300048913 Bacteria 566
372 Ga0496111_0017825 3300048914 Bacteria 4910
373 Ga0496111_0755924 3300048914 Bacteria 705
374 Ga0496112_0015497 3300048915 Bacteria 7117
375 Ga0496112_0208541 3300048915 Bacteria 1912
376 Ga0496112_0496893 3300048915 Bacteria 1155
377 Ga0496113_0089767 3300048916 Bacteria 2366
378 Ga0496113_0095599 3300048916 Bacteria 2296
379 Ga0496114_0029738 3300048917 Bacteria 4491
380 Ga0496114_0107468 3300048917 Bacteria 2388
381 Ga0496114_0758390 3300048917 Bacteria 848
382 Ga0496115_0305944 3300048918 Bacteria 1302
383 Ga0496115_0634502 3300048918 Bacteria 846
384 Ga0501291_037012 3300049514 Bacteria 845
385 Ga0501033_0977344 3300049570 Bacteria 567
386 Ga0501071_0838531 3300049587 Bacteria 709
387 Ga0501073_0435127 3300049589 Bacteria 907
388 Ga0501077_0634149 3300049593 Bacteria 687
389 Ga0501268_074789 3300049765 Bacteria 691
390 Ga0501283_048813 3300049779 Bacteria 746
391 Ga0501045_0318163 3300049824 Bacteria 1158
392 nmdc:mga07m45_373695_c1 3300050496 Bacteria 828
393 nmdc:mga07m45_59487_c1 3300050496 Bacteria 2162
394 nmdc:mga06r32_493396_c1 3300050510 Bacteria 1202
395 nmdc:mga08y16_11510_c1 3300050511 Bacteria 9296
396 nmdc:mga08y16_5873_c1 3300050511 Bacteria 12860
397 nmdc:mga0n895_1212204_c1 3300050512 Bacteria 728
398 nmdc:mga08x19_14772_c1 3300050514 Bacteria 4742
399 nmdc:mga08x19_500331_c1 3300050514 Bacteria 858
400 nmdc:mga08x19_697482_c1 3300050514 Bacteria 720
401 nmdc:mga0a205_31609_c1 3300050515 Bacteria 5073
402 Ga0500641_0047083 3300053096 Bacteria 1762
403 Ga0500650_0048115 3300053098 Bacteria 1978
404 Ga0500569_297510 3300053109 Bacteria 543
405 Ga0500621_043019 3300053126 Bacteria 1825
406 Ga0500652_014632 3300053131 Bacteria 2811
407 Ga0500633_0119561 3300053160 Bacteria 980
408 Ga0501084_1027249 3300054114 Bacteria 693
409 Ga0587073_0131894 3300059492 Bacteria 687
410 Ga0501082_0960249 3300060353 Bacteria 747
411 Ga0466962_0001081 3300061719 Bacteria 12519
412 Ga0466962_0014439 3300061719 Bacteria 3807
413 Ga0466962_0024619 3300061719 Bacteria 2890
414 Ga0466962_0071010 3300061719 Bacteria 1664
415 Ga0466962_0360801 3300061719 Bacteria 724
416 Ga0466962_0375712 3300061719 Bacteria 709
417 2586058089 2585427649 Bacteria 9053857
418 2643817502 2643221559 Bacteria 4424915
419 2643940156 2643221586 Bacteria 4446529
420 2644079284 2643221612 Bacteria 4361984
421 2644694728 2643221727 Bacteria 4415595
422 2689995137 2687453743 Bacteria 8361025
423 2775656989 2775506735 Bacteria 4556596
424 2809593068 2808606522 Bacteria 9488490
425 2816423737 2816332119 Bacteria 8120218
426 2855387262 2855386786 Bacteria 4752232
427 2855685384 2855683550 Bacteria 7134265
428 3006490525 3006486233 Bacteria 8157040
429 Ga0197907_10885099
430 JGI24741J21665_1022798
431 JGI24743J22301_10064215
432 JGI24743J22301_10078396
433 JGI24751J29686_10002358
434 JGI25407J50210_10003927
435 Ga0058861_12014822
436 Ga0070658_10118829
437 Ga0070658_10137587
438 Ga0070658_10486997
439 Ga0070683_100150464
440 Ga0070690_101068242
441 Ga0070670_100329240
442 Ga0070670_100707498
443 Ga0068869_100009358
444 Ga0068869_100746562
445 Ga0070680_100034212
446 Ga0070682_100052911
447 Ga0070682_100088644
448 Ga0068868_100017809
449 Ga0070660_100021481
450 Ga0070660_100182896
451 Ga0070689_100071588
452 Ga0070691_10047065
453 Ga0070687_100572197
454 Ga0070661_100024241
455 Ga0070692_10007795
456 Ga0070692_10044212
457 Ga0070668_100003010
458 Ga0070669_100440181
459 Ga0070675_100004917
460 Ga0070675_100015511
461 Ga0070671_100016964
462 Ga0070674_100037965
463 Ga0070673_100142453
464 Ga0070688_100020926
465 Ga0070659_100009446
466 Ga0070659_100239469
467 Ga0070659_100456650
468 Ga0070667_100208812
469 Ga0070667_101313693
470 Ga0070709_10002881
471 Ga0070713_100038302
472 Ga0070713_100255947
473 Ga0070710_10121508
474 Ga0070700_100036502
475 Ga0070663_100099752
476 Ga0070663_100997458
477 Ga0070678_100025122
478 Ga0070662_100097074
479 Ga0070662_100479028
480 Ga0070681_10083741
481 Ga0070681_10938617
482 Ga0070681_11154503
483 Ga0068867_100543822
484 Ga0068867_100598997
485 Ga0070685_10016797
486 Ga0070679_100115611
487 Ga0070684_100005506
488 Ga0070684_101988186
489 Ga0070697_100448535
490 Ga0070672_100517034
491 Ga0070696_100041299
492 Ga0070693_100004100
493 Ga0070693_100163092
494 Ga0068855_100147338
495 Ga0068855_100164912
496 Ga0070664_100006006
497 Ga0068857_100196306
498 Ga0068854_100083476
499 Ga0068856_100021478
500 Ga0070702_100060452
501 Ga0068852_100195046
502 Ga0068859_100053999
503 Ga0068864_100080530
504 Ga0068864_100171118
505 Ga0068861_100086639
506 Ga0068851_10037507
507 Ga0068870_10019657
508 Ga0068863_100088115
509 Ga0068863_100734327
510 Ga0068858_100000791
511 Ga0068858_100231720
512 Ga0068860_100093123
513 Ga0068862_100013850
514 Ga0081538_10000943
515 Ga0081538_10267260
516 Ga0081540_1070722
517 Ga0070717_11014963
518 Ga0075365_10952047
519 Ga0070712_100187301
520 Ga0070712_100393740
521 Ga0070712_100542848
522 Ga0075370_10041645
523 Ga0068871_100101518
524 Ga0068871_100441829
525 Ga0068871_100559851
526 Ga0075428_100177807
527 Ga0075433_10036095
528 Ga0075434_100014814
529 Ga0075436_100410486
530 Ga0097620_100054000
531 Ga0075435_100020503
532 Ga0075435_100204487
533 Ga0105240_10060309
534 Ga0111539_10000749
535 Ga0111539_10116947
536 Ga0105245_10022880
537 Ga0105245_10338351
538 Ga0105245_10850529
539 Ga0105245_11020356
540 Ga0105247_10069701
541 Ga0114129_11623202
542 Ga0105243_11002232
543 Ga0105243_12452570
544 Ga0105241_10013550
545 Ga0105241_10246843
546 Ga0105237_10213898
547 Ga0105237_10331038
548 Ga0105237_11185986
549 Ga0105238_10321215
550 Ga0105239_11167710
551 Ga0157373_10078136
552 Ga0157371_10043935
553 Ga0157370_10163283
554 Ga0157370_10902279
555 Ga0157369_10159419
556 Ga0157369_12303962
557 Ga0157374_10101171
558 Ga0157374_10398387
559 Ga0157374_10486150
560 Ga0157378_10471452
561 Ga0163162_10110747
562 Ga0157372_10218206
563 Ga0157375_10515576
564 Ga0157375_11224604
565 Ga0157375_11978269
566 Ga0157375_12510829
567 Ga0163163_10063134
568 Ga0163163_10278462
569 Ga0163163_10551646
570 Ga0163163_11461358
571 Ga0157380_11449924
572 Ga0182008_10340426
573 Ga0157377_10001519
574 Ga0157377_10038824
575 Ga0157376_10565131
576 Ga0206356_10362240
577 Ga0206349_1621715
578 Ga0206351_10641389
579 Ga0206353_10443871
580 Ga0206353_10939952
581 Ga0206353_10944564
582 Ga0206353_11405763
583 Ga0154015_1113465
584 Ga0224712_10022840
585 Ga0224712_10142416
586 Ga0207656_10011093
587 Ga0207713_1096520
588 Ga0207692_10035073
589 Ga0207642_10549913
590 Ga0207710_10039466
591 Ga0207688_10030308
592 Ga0207688_10043189
593 Ga0207688_10059014
594 Ga0207680_10317747
595 Ga0207699_10014920
596 Ga0207645_10155670
597 Ga0207643_10000101
598 Ga0207705_10014910
599 Ga0207705_10259161
600 Ga0207654_10059588
601 Ga0207654_10246153
602 Ga0207707_10763424
603 Ga0207707_11201200
604 Ga0207695_10292203
605 Ga0207671_10265776
606 Ga0207693_10090124
607 Ga0207693_10136484
608 Ga0207693_10829048
609 Ga0207660_10024741
610 Ga0207662_10074139
611 Ga0207662_10284689
612 Ga0207657_10007875
613 Ga0207657_10021631
614 Ga0207649_10001504
615 Ga0207649_10292761
616 Ga0207652_10018189
617 Ga0207681_10146355
618 Ga0207694_10060870
619 Ga0207650_10018243
620 Ga0207650_10026942
621 Ga0207659_10046393
622 Ga0207659_10471501
623 Ga0207687_10471531
624 Ga0207687_11149213
625 Ga0207700_10005745
626 Ga0207644_10369930
627 Ga0207690_10022225
628 Ga0207690_10029794
629 Ga0207706_10002310
630 Ga0207686_10452838
631 Ga0207709_10081160
632 Ga0207709_10234356
633 Ga0207709_10349066
634 Ga0207670_10295635
635 Ga0207669_10233115
636 Ga0207704_10243007
637 Ga0207689_10000644
638 Ga0207689_10015331
639 Ga0207661_10416693
640 Ga0207661_10777520
641 Ga0207661_11252569
642 Ga0207679_10011541
643 Ga0207679_10031685
644 Ga0207667_10488794
645 Ga0207651_10079933
646 Ga0207668_10006868
647 Ga0207640_10083299
648 Ga0207677_10013666
649 Ga0207677_10246789
650 Ga0207703_10185966
651 Ga0207678_10000139
652 Ga0207678_10019217
653 Ga0207678_10144893
654 Ga0207708_10127473
655 Ga0207702_10018220
656 Ga0207702_10026387
657 Ga0207702_10879498
658 Ga0207641_10015702
659 Ga0207641_10187647
660 Ga0207648_10342328
661 Ga0207648_10647693
662 Ga0207676_10016983
663 Ga0207674_10130748
664 Ga0207674_10162117
665 Ga0207674_11510315
666 Ga0207675_100127344
667 Ga0207675_100337542
668 Ga0207683_10000316
669 Ga0207683_10180131
670 Ga0207428_10014470
671 Ga0207428_10064210
672 Ga0268266_10567607
673 Ga0268265_10010236
674 Ga0307515_10009076
675 Ga0307511_10062203
676 Ga0307512_10031583
677 Ga0265327_10000630
678 Ga0307513_10008407
679 Ga0307508_10005712
680 Ga0307405_10105397
681 Ga0307518_10000036
682 Ga0307406_10003954
683 Ga0307412_10049681
684 Ga0307412_10089357
685 Ga0307416_100810305
686 Ga0307411_10443370
687 Ga0307415_100007715
688 Ga0307415_100628561
689 Ga0307415_100965829
690 Ga0307510_10163891
691 Ga0395899_0027555
692 Ga0395899_0126505
693 Ga0395899_0367266
694 Ga0395900_0031969
695 Ga0395900_0181826
696 Ga0395900_0972345
697 Ga0395898_0057272
698 Ga0395898_0087955
699 Ga0395898_0276044
700 Ga0395898_0977321
701 Ga0395901_0029688
702 Ga0395901_0387063
703 Ga0439436_0018331
704 Ga0439439_0005812
705 Ga0451789_0641791
706 Ga0451791_0794569
707 Ga0451793_0894513
708 Ga0451793_1325731
709 Ga0451797_1351634
710 Ga0451795_1209490
711 Ga0451802_0060221
712 Ga0451802_0338690
713 Ga0451804_0942609
714 Ga0451807_1655984
715 Ga0451807_1736117
716 Ga0451833_0295084
717 Ga0451837_0525443
718 Ga0451839_0702160
719 Ga0451839_0951047
720 Ga0451839_1488530
721 Ga0451849_0287471
722 Ga0451853_0937864
723 Ga0439448_0008173
724 Ga0439449_0021622
725 Ga0439463_009944
726 Ga0439459_0000631
727 Ga0439464_0315091
728 Ga0466969_0030807
729 Ga0466969_0340370
730 Ga0466972_0022235
731 Ga0466972_0035529
732 Ga0466972_0305048
733 Ga0466965_0207742
734 Ga0466965_0443127
735 Ga0466966_0092588
736 Ga0466961_0007438
737 Ga0466961_0022696
738 Ga0466961_0025138
739 Ga0466961_0112591
740 Ga0466963_0002274
741 Ga0466963_0198368
742 Ga0466963_0206152
743 Ga0466963_0266630
744 Ga0466963_0283840
745 Ga0466963_0327317
746 Ga0466963_0462704
747 Ga0466964_0074665
748 Ga0466964_0137231
749 Ga0466964_0228280
750 Ga0466971_0004895
751 Ga0466971_0042249
752 Ga0466971_0319893
753 Ga0466968_0287940
754 Ga0466970_0000569
755 Ga0466970_0023410
756 Ga0466970_0042647
757 Ga0466970_0287467
758 Ga0466970_0844336
759 Ga0466957_0035309
760 Ga0466957_0076900
761 Ga0466960_0001683
762 Ga0466960_0042963
763 Ga0466960_0050302
764 Ga0466960_0764046
765 Ga0466959_0092439
766 Ga0466959_0225956
767 Ga0466958_0047297
768 Ga0466958_0065007
769 Ga0466958_0084684
770 Ga0466958_0098380
771 Ga0466958_0111587
772 Ga0466958_0122100
773 Ga0466958_0697118
774 Ga0466967_0057236
775 Ga0495638_0095119
776 Ga0495584_0224872
777 Ga0495632_0049781
778 Ga0495624_0667253
779 Ga0495604_0242058
780 Ga0495687_035171
781 Ga0495685_229162
782 Ga0496100_0282794
783 Ga0496100_0763036
784 Ga0496101_0059287
785 Ga0496102_0051529
786 Ga0496102_1066326
787 Ga0496103_0295739
788 Ga0496104_0049623
789 Ga0496104_0237780
790 Ga0496105_0151459
791 Ga0496105_0512076
792 Ga0496106_0051044
793 Ga0496108_0279801
794 Ga0496108_1391702
795 Ga0496109_0016606
796 Ga0496109_1127009
797 Ga0496110_0156803
798 Ga0496110_0403206
799 Ga0496110_1577321
800 Ga0496111_0017825
801 Ga0496111_0755924
802 Ga0496112_0015497
803 Ga0496112_0208541
804 Ga0496112_0496893
805 Ga0496113_0089767
806 Ga0496113_0095599
807 Ga0496114_0029738
808 Ga0496114_0107468
809 Ga0496114_0758390
810 Ga0496115_0305944
811 Ga0496115_0634502
812 Ga0501291_037012
813 Ga0501033_0977344
814 Ga0501071_0838531
815 Ga0501073_0435127
816 Ga0501077_0634149
817 Ga0501268_074789
818 Ga0501283_048813
819 Ga0501045_0318163
820 nmdc:mga07m45_373695_c1
821 nmdc:mga07m45_59487_c1
822 nmdc:mga06r32_493396_c1
823 nmdc:mga08y16_11510_c1
824 nmdc:mga08y16_5873_c1
825 nmdc:mga0n895_1212204_c1
826 nmdc:mga08x19_14772_c1
827 nmdc:mga08x19_500331_c1
828 nmdc:mga08x19_697482_c1
829 nmdc:mga0a205_31609_c1
830 Ga0500641_0047083
831 Ga0500650_0048115
832 Ga0500569_297510
833 Ga0500621_043019
834 Ga0500652_014632
835 Ga0500633_0119561
836 Ga0501084_1027249
837 Ga0587073_0131894
838 Ga0501082_0960249
839 Ga0466962_0001081
840 Ga0466962_0014439
841 Ga0466962_0024619
842 Ga0466962_0071010
843 Ga0466962_0360801
844 Ga0466962_0375712
845 2586058089
846 2643817502
847 2643940156
848 2644079284
849 2644694728
850 2689995137
851 2775656989
852 2809593068
853 2816423737
854 2855387262
855 2855685384
856 3006490525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

159

0.85

PF18029

Glyoxalase_6

Glyoxalase-like domain

33

160

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8712 1 136
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8652 1 136
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8623 2 137
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8613 1 136
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8554 1 136
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9252 83 135 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.918 83 133 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8753 84 137 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8511 83 133 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8486 83 135 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A286ER46-F1-model_v4 Uncharacterized glyoxalase superfamily protein PhnB 0.9881 1 137
AF-A0A6I5X500-F1-model_v4 VOC family protein 0.9869 1 136
AF-A0A7Y7I9D5-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9862 1 137 GO:0016829
GO:0051213
AF-A0A0Q1CJ93-F1-model_v4 Glyoxalase 0.9855 1 137
AF-A0A535RXX1-F1-model_v4 VOC family protein 0.9846 1 136

Map