F441658

General Info

Members Datasets Scaffolds Average Seq Length
428 214 856 225

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10439197|Ga0105247_104391972
Length 242
Sequence VSTNGGAPLLRLDAIDTYYGQIHILENLNLEVREGELVSLLGGNASGKSTTLKTILGLVQPRNGTVEFRGENVTGRTTSYRIQRGMAIVPENRRLFGPMTVLENLEMGARTPAARAARRETLEEVFALFPRLRERVPQSAGTLSGGEQQMLAIGRALMARPRLLLLDEPSLGLAPIAVRNIMEIVATVNRRGTTILLVEQNVRRALALCGRGYVVENGVVALAGSREELLRSDHVRQAYLGM

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 15.19
Rhizosphere 84.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10439197 3300009101 Bacteria 938
2 Ga0070658_10003740 3300005327 Bacteria 12441
3 Ga0070658_10011962 3300005327 Bacteria 6968
4 Ga0070658_10058321 3300005327 Bacteria 3141
5 Ga0070683_100091011 3300005329 Bacteria 2864
6 Ga0070683_100136186 3300005329 Bacteria 2326
7 Ga0070683_100287862 3300005329 Bacteria 1563
8 Ga0070683_100653357 3300005329 Bacteria 1007
9 Ga0070680_100013384 3300005336 Bacteria 6388
10 Ga0070682_100077177 3300005337 Bacteria 2146
11 Ga0070682_100111133 3300005337 Bacteria 1826
12 Ga0070682_100309375 3300005337 Bacteria 1162
13 Ga0070689_100436699 3300005340 Bacteria 1112
14 Ga0070661_100016558 3300005344 Bacteria 5214
15 Ga0070671_100321424 3300005355 Bacteria 1319
16 Ga0070673_100612739 3300005364 Bacteria 994
17 Ga0070688_100113442 3300005365 Bacteria 1806
18 Ga0070659_100066832 3300005366 Bacteria 2850
19 Ga0070667_100540232 3300005367 Bacteria 1071
20 Ga0070709_10002809 3300005434 Bacteria 9404
21 Ga0070714_100021378 3300005435 Bacteria 5295
22 Ga0070714_100027937 3300005435 Bacteria 4676
23 Ga0070710_10000749 3300005437 Bacteria 15464
24 Ga0070710_10015289 3300005437 Bacteria 3881
25 Ga0070701_10300153 3300005438 Bacteria 987
26 Ga0070711_100137085 3300005439 Bacteria 1830
27 Ga0070711_100446922 3300005439 Bacteria 1057
28 Ga0070708_100306721 3300005445 Bacteria 1495
29 Ga0070663_100255390 3300005455 Bacteria 1388
30 Ga0070681_10065799 3300005458 Bacteria 3594
31 Ga0070681_10083455 3300005458 Bacteria 3149
32 Ga0070681_10151483 3300005458 Bacteria 2245
33 Ga0070681_10275890 3300005458 Bacteria 1592
34 Ga0070681_10376376 3300005458 Bacteria 1330
35 Ga0070685_10131424 3300005466 Bacteria 1566
36 Ga0070706_100228355 3300005467 Bacteria 1738
37 Ga0070707_100052248 3300005468 Bacteria 3918
38 Ga0070707_100057316 3300005468 Bacteria 3737
39 Ga0070707_100284871 3300005468 Bacteria 1606
40 Ga0070707_100564808 3300005468 Bacteria 1100
41 Ga0070707_100933200 3300005468 Bacteria 833
42 Ga0070698_100116270 3300005471 Bacteria 2638
43 Ga0070698_100212584 3300005471 Bacteria 1868
44 Ga0070679_100030959 3300005530 Bacteria 5285
45 Ga0070679_100038945 3300005530 Bacteria 4726
46 Ga0070679_100090127 3300005530 Bacteria 3054
47 Ga0070679_100129631 3300005530 Bacteria 2504
48 Ga0070679_100143664 3300005530 Bacteria 2365
49 Ga0070679_100287540 3300005530 Bacteria 1596
50 Ga0070679_100351518 3300005530 Bacteria 1421
51 Ga0070684_100192449 3300005535 Bacteria 1856
52 Ga0070697_100507688 3300005536 Bacteria 1055
53 Ga0068853_100321951 3300005539 Bacteria 1433
54 Ga0070693_100098679 3300005547 Bacteria 1775
55 Ga0068855_100133736 3300005563 Bacteria 2830
56 Ga0068855_100187686 3300005563 Bacteria 2334
57 Ga0068855_100674121 3300005563 Bacteria 1108
58 Ga0070664_100293865 3300005564 Bacteria 1467
59 Ga0068857_100047596 3300005577 Bacteria 3807
60 Ga0068857_100829961 3300005577 Bacteria 884
61 Ga0068854_100124757 3300005578 Bacteria 1959
62 Ga0070702_100031743 3300005615 Bacteria 2893
63 Ga0070702_100067262 3300005615 Bacteria 2104
64 Ga0081455_10015879 3300005937 Bacteria 7290
65 Ga0081455_10100158 3300005937 Bacteria 2329
66 Ga0081540_1017439 3300005983 Bacteria 4445
67 Ga0081539_10006778 3300005985 Bacteria 10749
68 Ga0070717_10470302 3300006028 Bacteria 1134
69 Ga0075365_10110592 3300006038 Bacteria 1888
70 Ga0075364_10271275 3300006051 Bacteria 1154
71 Ga0070715_10001093 3300006163 Bacteria 7687
72 Ga0070716_100030131 3300006173 Bacteria 2940
73 Ga0070712_100020162 3300006175 Bacteria 4360
74 Ga0070712_100348486 3300006175 Bacteria 1211
75 Ga0075431_100748357 3300006847 Bacteria 953
76 Ga0075433_10110496 3300006852 Bacteria 2439
77 Ga0075433_10196513 3300006852 Bacteria 1794
78 Ga0075433_10521195 3300006852 Bacteria 1046
79 Ga0075434_100038941 3300006871 Bacteria 4710
80 Ga0075436_100173179 3300006914 Bacteria 1524
81 Ga0075435_100027279 3300007076 Bacteria 4466
82 Ga0105240_10265807 3300009093 Bacteria 1977
83 Ga0105240_10560275 3300009093 Bacteria 1263
84 Ga0111539_10148333 3300009094 Bacteria 2746
85 Ga0111539_10580794 3300009094 Bacteria 1305
86 Ga0105245_10077645 3300009098 Bacteria 3028
87 Ga0105245_10111054 3300009098 Bacteria 2549
88 Ga0105245_10124001 3300009098 Bacteria 2416
89 Ga0105245_10575171 3300009098 Bacteria 1151
90 Ga0114129_10001394 3300009147 Bacteria 32556
91 Ga0105237_10026669 3300009545 Bacteria 5905
92 Ga0157373_10033797 3300013100 Bacteria 3676
93 Ga0157370_10820839 3300013104 Bacteria 846
94 Ga0157369_10015959 3300013105 Bacteria 8450
95 Ga0157369_10023518 3300013105 Bacteria 6863
96 Ga0157369_10196970 3300013105 Bacteria 2115
97 Ga0157369_10596840 3300013105 Bacteria 1140
98 Ga0157372_11221432 3300013307 Bacteria 868
99 Ga0163163_10525260 3300014325 Bacteria 1246
100 Ga0163163_10915427 3300014325 Bacteria 940
101 Ga0182008_10035238 3300014497 Bacteria 2507
102 Ga0157377_10073403 3300014745 Bacteria 1983
103 Ga0206356_11154534 3300020070 Bacteria 1970
104 Ga0206354_11400608 3300020081 Bacteria 1284
105 Ga0206354_11507604 3300020081 Bacteria 909
106 Ga0206353_10532524 3300020082 Bacteria 1442
107 Ga0213871_10005131 3300021441 Bacteria 2678
108 Ga0207653_10052427 3300025885 Bacteria 1360
109 Ga0207692_10001782 3300025898 Bacteria 8174
110 Ga0207692_10164333 3300025898 Bacteria 1282
111 Ga0207692_10192578 3300025898 Bacteria 1194
112 Ga0207699_10062925 3300025906 Bacteria 2239
113 Ga0207643_10117058 3300025908 Bacteria 1575
114 Ga0207705_10035661 3300025909 Bacteria 3558
115 Ga0207705_10045086 3300025909 Bacteria 3169
116 Ga0207705_10051539 3300025909 Bacteria 2962
117 Ga0207705_10280922 3300025909 Bacteria 1274
118 Ga0207684_10057069 3300025910 Bacteria 3313
119 Ga0207684_10308781 3300025910 Bacteria 1363
120 Ga0207654_10268526 3300025911 Bacteria 1150
121 Ga0207707_10017652 3300025912 Bacteria 6224
122 Ga0207707_10026509 3300025912 Bacteria 5065
123 Ga0207707_10088872 3300025912 Bacteria 2700
124 Ga0207693_10004412 3300025915 Bacteria 11894
125 Ga0207693_10022918 3300025915 Bacteria 4958
126 Ga0207693_10346859 3300025915 Bacteria 1162
127 Ga0207663_10031852 3300025916 Bacteria 3124
128 Ga0207663_10040390 3300025916 Bacteria 2835
129 Ga0207660_10015510 3300025917 Bacteria 5030
130 Ga0207660_10019071 3300025917 Bacteria 4582
131 Ga0207660_10053718 3300025917 Bacteria 2873
132 Ga0207662_10046423 3300025918 Bacteria 2570
133 Ga0207657_10001151 3300025919 Bacteria 28127
134 Ga0207657_10015590 3300025919 Bacteria 7355
135 Ga0207657_10035104 3300025919 Bacteria 4501
136 Ga0207657_10109259 3300025919 Bacteria 2286
137 Ga0207657_10299401 3300025919 Bacteria 1274
138 Ga0207652_10044695 3300025921 Bacteria 3774
139 Ga0207652_10097428 3300025921 Bacteria 2592
140 Ga0207652_10100936 3300025921 Bacteria 2548
141 Ga0207652_10193358 3300025921 Bacteria 1830
142 Ga0207646_10072212 3300025922 Bacteria 3083
143 Ga0207646_10166822 3300025922 Bacteria 1988
144 Ga0207646_10227565 3300025922 Bacteria 1685
145 Ga0207646_10400972 3300025922 Bacteria 1239
146 Ga0207694_10131719 3300025924 Bacteria 2005
147 Ga0207687_10136108 3300025927 Bacteria 1858
148 Ga0207700_10013343 3300025928 Bacteria 5342
149 Ga0207664_10005465 3300025929 Bacteria 8690
150 Ga0207664_10006342 3300025929 Bacteria 8126
151 Ga0207664_10011211 3300025929 Bacteria 6356
152 Ga0207664_10033233 3300025929 Bacteria 3961
153 Ga0207664_10039460 3300025929 Bacteria 3666
154 Ga0207664_10067111 3300025929 Bacteria 2877
155 Ga0207644_10312965 3300025931 Bacteria 1268
156 Ga0207690_10177718 3300025932 Bacteria 1600
157 Ga0207690_10488352 3300025932 Bacteria 995
158 Ga0207709_10064901 3300025935 Bacteria 2294
159 Ga0207670_10148494 3300025936 Bacteria 1736
160 Ga0207665_10000146 3300025939 Bacteria 47929
161 Ga0207661_10268645 3300025944 Bacteria 1521
162 Ga0207661_10558423 3300025944 Bacteria 1049
163 Ga0207661_10607107 3300025944 Bacteria 1004
164 Ga0207679_10209559 3300025945 Bacteria 1633
165 Ga0207667_10026297 3300025949 Bacteria 6360
166 Ga0207667_10868149 3300025949 Bacteria 896
167 Ga0207667_10878519 3300025949 Bacteria 889
168 Ga0207712_10132020 3300025961 Bacteria 1904
169 Ga0207639_10965727 3300026041 Bacteria 797
170 Ga0207676_10152036 3300026095 Bacteria 1995
171 Ga0207674_10022013 3300026116 Bacteria 6855
172 Ga0207674_10066057 3300026116 Bacteria 3644
173 Ga0207683_10264726 3300026121 Bacteria 1570
174 Ga0207698_11119156 3300026142 Bacteria 800
175 Ga0265319_1005420 3300028563 Bacteria 6102
176 Ga0265318_10003907 3300028577 Bacteria 7345
177 Ga0265318_10019384 3300028577 Bacteria 2759
178 Ga0265336_10014588 3300028666 Bacteria 2600
179 Ga0265338_10137735 3300028800 Bacteria 1916
180 Ga0265330_10028444 3300031235 Bacteria 2519
181 Ga0265332_10146914 3300031238 Bacteria 987
182 Ga0265320_10013996 3300031240 Bacteria 4593
183 Ga0265320_10029831 3300031240 Bacteria 2819
184 Ga0265339_10077289 3300031249 Bacteria 1764
185 Ga0265331_10047774 3300031250 Bacteria 2060
186 Ga0265327_10048420 3300031251 Bacteria 2236
187 Ga0265327_10144385 3300031251 Bacteria 1110
188 Ga0265316_10269781 3300031344 Bacteria 1245
189 Ga0265313_10077147 3300031595 Bacteria 1521
190 Ga0265314_10007865 3300031711 Bacteria 9202
191 Ga0307409_100305059 3300031995 Bacteria 1483
192 Ga0316583_10028969 3300032133 Bacteria 1975
193 Ga0373943_0021634 3300035170 Bacteria 2972
194 Ga0373931_0186256 3300035691 Bacteria 1232
195 Ga0373931_0289484 3300035691 Bacteria 1008
196 Ga0395899_0015762 3300037312 Bacteria 5762
197 Ga0395899_0016441 3300037312 Bacteria 5640
198 Ga0395899_0022818 3300037312 Bacteria 4741
199 Ga0395899_0224426 3300037312 Bacteria 1300
200 Ga0395900_0005060 3300037418 Bacteria 13832
201 Ga0395900_0005709 3300037418 Bacteria 13009
202 Ga0395900_0072493 3300037418 Bacteria 3540
203 Ga0395900_0126538 3300037418 Bacteria 2621
204 Ga0395900_0199993 3300037418 Bacteria 2022
205 Ga0395900_0217509 3300037418 Bacteria 1927
206 Ga0395900_0239327 3300037418 Bacteria 1822
207 Ga0395900_0361925 3300037418 Bacteria 1422
208 Ga0395900_0838512 3300037418 Bacteria 845
209 Ga0395898_0017620 3300037466 Bacteria 7292
210 Ga0395898_0029919 3300037466 Bacteria 5451
211 Ga0395898_0042723 3300037466 Bacteria 4470
212 Ga0395898_0100648 3300037466 Bacteria 2775
213 Ga0395905_0012290 3300037471 Bacteria 8244
214 Ga0395905_0032551 3300037471 Bacteria 4903
215 Ga0395905_0105249 3300037471 Bacteria 2649
216 Ga0395905_0146678 3300037471 Bacteria 2220
217 Ga0395901_0011415 3300038443 Bacteria 8999
218 Ga0395901_0018384 3300038443 Bacteria 7134
219 Ga0395901_0020675 3300038443 Bacteria 6737
220 Ga0395901_0095264 3300038443 Bacteria 3119
221 Ga0395901_0097160 3300038443 Bacteria 3087
222 Ga0395901_0261678 3300038443 Bacteria 1800
223 Ga0395901_0276053 3300038443 Bacteria 1747
224 Ga0395901_0282111 3300038443 Bacteria 1726
225 Ga0395901_0413198 3300038443 Bacteria 1385
226 Ga0436360_0435711 3300039438 Bacteria 5419
227 Ga0436360_0956525 3300039438 Bacteria 889
228 Ga0439456_055695 3300042013 Bacteria 866
229 Ga0466965_0006684 3300044683 Bacteria 5257
230 Ga0466965_0211331 3300044683 Bacteria 1032
231 Ga0466966_0011285 3300044684 Bacteria 5929
232 Ga0466961_0001608 3300044693 Bacteria 13999
233 Ga0466961_0019797 3300044693 Bacteria 4330
234 Ga0466963_0001597 3300044694 Bacteria 12314
235 Ga0466963_0002515 3300044694 Bacteria 10261
236 Ga0466963_0004886 3300044694 Bacteria 7815
237 Ga0466963_0008397 3300044694 Bacteria 6187
238 Ga0466963_0014147 3300044694 Bacteria 4916
239 Ga0466963_0016609 3300044694 Bacteria 4580
240 Ga0466963_0023846 3300044694 Bacteria 3891
241 Ga0466971_0001582 3300044719 Bacteria 9616
242 Ga0466968_0007158 3300044735 Bacteria 4237
243 Ga0466970_0278657 3300044765 Bacteria 940
244 Ga0466957_0000400 3300044842 Bacteria 21152
245 Ga0466957_0081436 3300044842 Bacteria 2016
246 Ga0466959_0021229 3300045049 Bacteria 4788
247 Ga0466959_0050886 3300045049 Bacteria 3040
248 Ga0466959_0052888 3300045049 Bacteria 2972
249 Ga0466959_0211627 3300045049 Bacteria 1347
250 Ga0451576_0285632 3300045051 Bacteria 1725
251 Ga0466958_0000119 3300045836 Bacteria 25649
252 Ga0466958_0018159 3300045836 Bacteria 4077
253 Ga0466967_0004005 3300045976 Bacteria 9819
254 Ga0466967_0009346 3300045976 Bacteria 7267
255 Ga0466967_0018523 3300045976 Bacteria 5568
256 Ga0466967_0077290 3300045976 Bacteria 2996
257 Ga0466967_0102847 3300045976 Bacteria 2614
258 Ga0466967_0135888 3300045976 Bacteria 2286
259 Ga0466967_0235673 3300045976 Bacteria 1744
260 Ga0466967_0475057 3300045976 Bacteria 1224
261 Ga0466967_0539220 3300045976 Bacteria 1148
262 Ga0466967_0607794 3300045976 Bacteria 1079
263 Ga0495592_0070725 3300046454 Bacteria 2541
264 Ga0495592_0290781 3300046454 Bacteria 1065
265 Ga0495603_0235599 3300046455 Bacteria 1055
266 Ga0495629_0099397 3300046459 Bacteria 2030
267 Ga0495641_0002128 3300046461 Bacteria 15969
268 Ga0495653_0024854 3300046463 Bacteria 4821
269 Ga0495653_0063502 3300046463 Bacteria 2786
270 Ga0495582_0000127 3300046473 Bacteria 40540
271 Ga0495582_0058585 3300046473 Bacteria 2124
272 Ga0495664_0053010 3300046477 Bacteria 2412
273 Ga0495664_0081345 3300046477 Bacteria 1942
274 Ga0495594_0208669 3300046499 Bacteria 1114
275 Ga0495594_0334604 3300046499 Bacteria 862
276 Ga0495608_0163111 3300046511 Bacteria 1416
277 Ga0495618_0084658 3300046514 Bacteria 2026
278 Ga0495628_0068742 3300046516 Bacteria 2763
279 Ga0495630_0006167 3300046517 Bacteria 8501
280 Ga0495663_0060286 3300046525 Bacteria 1192
281 Ga0495652_0061729 3300046529 Bacteria 3162
282 Ga0495665_0000469 3300046531 Bacteria 20320
283 Ga0495587_0034183 3300046536 Bacteria 3067
284 Ga0495645_0301152 3300046543 Bacteria 1047
285 Ga0495645_0449335 3300046543 Bacteria 813
286 Ga0495667_0058608 3300046559 Bacteria 2529
287 Ga0495667_0257288 3300046559 Bacteria 1110
288 Ga0495634_0177760 3300046642 Bacteria 1334
289 Ga0495658_0000744 3300046683 Bacteria 17574
290 Ga0495613_0002469 3300046689 Bacteria 13937
291 Ga0495613_0278482 3300046689 Bacteria 1162
292 Ga0495624_0050544 3300046690 Bacteria 2633
293 Ga0495581_0005553 3300047315 Bacteria 7306
294 Ga0495604_0064423 3300047317 Bacteria 2793
295 Ga0495604_0068509 3300047317 Bacteria 2693
296 Ga0495674_0235391 3300047319 Bacteria 1510
297 Ga0495676_0003082 3300047321 Bacteria 15076
298 Ga0495680_0003111 3300047322 Bacteria 16521
299 Ga0495680_0040006 3300047322 Bacteria 3736
300 Ga0495684_0007252 3300047471 Bacteria 8601
301 Ga0495684_0007936 3300047471 Bacteria 8211
302 Ga0495593_0048654 3300047673 Bacteria 2253
303 Ga0495602_0179057 3300048088 Bacteria 1637
304 Ga0496100_0005026 3300048903 Bacteria 7077
305 Ga0496100_0012259 3300048903 Bacteria 4909
306 Ga0496100_0191933 3300048903 Bacteria 1483
307 Ga0496100_0402098 3300048903 Bacteria 1043
308 Ga0496101_0002073 3300048904 Bacteria 12209
309 Ga0496101_0027145 3300048904 Bacteria 3985
310 Ga0496101_0124049 3300048904 Bacteria 1955
311 Ga0496102_0015500 3300048905 Bacteria 6640
312 Ga0496102_0258051 3300048905 Bacteria 1643
313 Ga0496102_0473642 3300048905 Bacteria 1173
314 Ga0496104_0002209 3300048907 Bacteria 16824
315 Ga0496104_0143298 3300048907 Bacteria 2296
316 Ga0496104_0348548 3300048907 Bacteria 1393
317 Ga0496104_0353841 3300048907 Bacteria 1381
318 Ga0496105_0000448 3300048908 Bacteria 27186
319 Ga0496105_0025312 3300048908 Bacteria 4830
320 Ga0496106_0008135 3300048909 Bacteria 7745
321 Ga0496106_0025436 3300048909 Bacteria 4406
322 Ga0496106_0551921 3300048909 Bacteria 924
323 Ga0496107_0055955 3300048910 Bacteria 2849
324 Ga0496107_0194288 3300048910 Bacteria 1508
325 Ga0496107_0318962 3300048910 Bacteria 1156
326 Ga0496108_0001713 3300048911 Bacteria 17376
327 Ga0496108_0073445 3300048911 Bacteria 2887
328 Ga0496108_0080111 3300048911 Bacteria 2766
329 Ga0496108_0080713 3300048911 Bacteria 2756
330 Ga0496108_0416261 3300048911 Bacteria 1174
331 Ga0496108_0784783 3300048911 Bacteria 822
332 Ga0496109_0003407 3300048912 Bacteria 13305
333 Ga0496109_0063103 3300048912 Bacteria 3389
334 Ga0496109_0076111 3300048912 Bacteria 3086
335 Ga0496109_0196481 3300048912 Bacteria 1896
336 Ga0496109_0614132 3300048912 Bacteria 1024
337 Ga0496109_0704102 3300048912 Bacteria 947
338 Ga0496110_0000054 3300048913 Bacteria 57987
339 Ga0496110_0099189 3300048913 Bacteria 2611
340 Ga0496110_0224517 3300048913 Bacteria 1708
341 Ga0496110_0382906 3300048913 Bacteria 1282
342 Ga0496110_0538222 3300048913 Bacteria 1062
343 Ga0496111_0001858 3300048914 Bacteria 12464
344 Ga0496111_0014510 3300048914 Bacteria 5385
345 Ga0496111_0071527 3300048914 Bacteria 2524
346 Ga0496111_0197361 3300048914 Bacteria 1496
347 Ga0496112_0000204 3300048915 Bacteria 38947
348 Ga0496112_0030822 3300048915 Bacteria 5195
349 Ga0496112_0095103 3300048915 Bacteria 2950
350 Ga0496112_0190749 3300048915 Bacteria 2011
351 Ga0496112_0222034 3300048915 Bacteria 1845
352 Ga0496112_0328963 3300048915 Bacteria 1472
353 Ga0496112_0928035 3300048915 Bacteria 792
354 Ga0496113_0000302 3300048916 Bacteria 23456
355 Ga0496113_0274588 3300048916 Bacteria 1347
356 Ga0496114_0000875 3300048917 Bacteria 22544
357 Ga0496114_0020313 3300048917 Bacteria 5390
358 Ga0496114_0038997 3300048917 Bacteria 3931
359 Ga0496114_0044541 3300048917 Bacteria 3682
360 Ga0496114_0128955 3300048917 Bacteria 2182
361 Ga0496114_0146481 3300048917 Bacteria 2047
362 Ga0496114_0199464 3300048917 Bacteria 1752
363 Ga0496114_0257547 3300048917 Bacteria 1536
364 Ga0496114_0457000 3300048917 Bacteria 1130
365 Ga0496115_0021863 3300048918 Bacteria 4946
366 Ga0496115_0181379 3300048918 Bacteria 1740
367 Ga0496115_0182205 3300048918 Bacteria 1736
368 Ga0496115_0231043 3300048918 Bacteria 1525
369 Ga0501032_0196064 3300049569 Bacteria 1319
370 Ga0501034_0020301 3300049571 Bacteria 6783
371 Ga0501034_0363269 3300049571 Bacteria 1375
372 Ga0501038_0072209 3300049574 Bacteria 2925
373 Ga0501039_0084354 3300049575 Bacteria 2474
374 Ga0501039_0264773 3300049575 Bacteria 1351
375 Ga0501041_0010852 3300049577 Bacteria 5376
376 Ga0501042_0039247 3300049578 Bacteria 3364
377 Ga0501047_0371890 3300049581 Bacteria 1264
378 Ga0501048_0019995 3300049582 Bacteria 4911
379 Ga0501067_0012836 3300049583 Bacteria 4639
380 Ga0501067_0035683 3300049583 Bacteria 2761
381 Ga0501069_0009004 3300049585 Bacteria 5268
382 Ga0501069_0026095 3300049585 Bacteria 3198
383 Ga0501069_0345192 3300049585 Bacteria 877
384 Ga0501070_0001662 3300049586 Bacteria 19695
385 Ga0501070_0011251 3300049586 Bacteria 7556
386 Ga0501070_0313302 3300049586 Bacteria 1277
387 Ga0501072_0044008 3300049588 Bacteria 3510
388 Ga0501072_0401321 3300049588 Bacteria 1087
389 Ga0501073_0034776 3300049589 Bacteria 3584
390 Ga0501073_0089447 3300049589 Bacteria 2140
391 Ga0501074_0004517 3300049590 Bacteria 9961
392 Ga0501074_0226283 3300049590 Bacteria 1332
393 Ga0501076_0170653 3300049592 Bacteria 1773
394 Ga0501079_0011238 3300049741 Bacteria 6830
395 Ga0501079_0045892 3300049741 Bacteria 3372
396 Ga0501080_0014793 3300049742 Bacteria 7187
397 Ga0501080_0069723 3300049742 Bacteria 3270
398 Ga0501080_0279639 3300049742 Bacteria 1517
399 Ga0501081_0069633 3300049743 Bacteria 2451
400 Ga0501081_0744488 3300049743 Bacteria 736
401 Ga0501083_0011007 3300049744 Bacteria 6357
402 Ga0501044_0552084 3300049823 Bacteria 1049
403 Ga0501045_0029969 3300049824 Bacteria 3936
404 Ga0501045_0057904 3300049824 Bacteria 2836
405 nmdc:mga06z11_73703_c1 3300050494 Bacteria 1813
406 nmdc:mga05p37_17355_c1 3300050507 Bacteria 7781
407 nmdc:mga05p37_23556_c1 3300050507 Bacteria 7471
408 nmdc:mga05p37_84039_c1 3300050507 Bacteria 3922
409 nmdc:mga08y16_744709_c1 3300050511 Bacteria 976
410 nmdc:mga0n895_86016_c1 3300050512 Bacteria 3140
411 nmdc:mga0rr50_134396_c1 3300050513 Bacteria 1984
412 nmdc:mga0a205_12284_c1 3300050515 Bacteria 7920
413 nmdc:mga0a205_436053_c1 3300050515 Bacteria 1171
414 Ga0495601_0039311 3300053077 Bacteria 2962
415 Ga0495601_0045792 3300053077 Bacteria 2752
416 Ga0495601_0178625 3300053077 Bacteria 1388
417 Ga0495612_0108068 3300053078 Bacteria 1189
418 Ga0495612_0126695 3300053078 Bacteria 1101
419 Ga0495655_0021630 3300053083 Bacteria 1458
420 Ga0495595_0088839 3300053084 Bacteria 1481
421 Ga0495595_0124514 3300053084 Bacteria 1257
422 Ga0495619_0004589 3300053085 Bacteria 8823
423 Ga0501084_0160287 3300054114 Bacteria 1898
424 Ga0501082_0469263 3300060353 Bacteria 1100
425 Ga0466962_0004091 3300061719 Bacteria 6986
426 Ga0530510_0022449 3300061734 Bacteria 4496
427 Ga0530510_0167730 3300061734 Bacteria 1626
428 Ga0530510_0180812 3300061734 Bacteria 1564
429 Ga0105247_10439197
430 Ga0070658_10003740
431 Ga0070658_10011962
432 Ga0070658_10058321
433 Ga0070683_100091011
434 Ga0070683_100136186
435 Ga0070683_100287862
436 Ga0070683_100653357
437 Ga0070680_100013384
438 Ga0070682_100077177
439 Ga0070682_100111133
440 Ga0070682_100309375
441 Ga0070689_100436699
442 Ga0070661_100016558
443 Ga0070671_100321424
444 Ga0070673_100612739
445 Ga0070688_100113442
446 Ga0070659_100066832
447 Ga0070667_100540232
448 Ga0070709_10002809
449 Ga0070714_100021378
450 Ga0070714_100027937
451 Ga0070710_10000749
452 Ga0070710_10015289
453 Ga0070701_10300153
454 Ga0070711_100137085
455 Ga0070711_100446922
456 Ga0070708_100306721
457 Ga0070663_100255390
458 Ga0070681_10065799
459 Ga0070681_10083455
460 Ga0070681_10151483
461 Ga0070681_10275890
462 Ga0070681_10376376
463 Ga0070685_10131424
464 Ga0070706_100228355
465 Ga0070707_100052248
466 Ga0070707_100057316
467 Ga0070707_100284871
468 Ga0070707_100564808
469 Ga0070707_100933200
470 Ga0070698_100116270
471 Ga0070698_100212584
472 Ga0070679_100030959
473 Ga0070679_100038945
474 Ga0070679_100090127
475 Ga0070679_100129631
476 Ga0070679_100143664
477 Ga0070679_100287540
478 Ga0070679_100351518
479 Ga0070684_100192449
480 Ga0070697_100507688
481 Ga0068853_100321951
482 Ga0070693_100098679
483 Ga0068855_100133736
484 Ga0068855_100187686
485 Ga0068855_100674121
486 Ga0070664_100293865
487 Ga0068857_100047596
488 Ga0068857_100829961
489 Ga0068854_100124757
490 Ga0070702_100031743
491 Ga0070702_100067262
492 Ga0081455_10015879
493 Ga0081455_10100158
494 Ga0081540_1017439
495 Ga0081539_10006778
496 Ga0070717_10470302
497 Ga0075365_10110592
498 Ga0075364_10271275
499 Ga0070715_10001093
500 Ga0070716_100030131
501 Ga0070712_100020162
502 Ga0070712_100348486
503 Ga0075431_100748357
504 Ga0075433_10110496
505 Ga0075433_10196513
506 Ga0075433_10521195
507 Ga0075434_100038941
508 Ga0075436_100173179
509 Ga0075435_100027279
510 Ga0105240_10265807
511 Ga0105240_10560275
512 Ga0111539_10148333
513 Ga0111539_10580794
514 Ga0105245_10077645
515 Ga0105245_10111054
516 Ga0105245_10124001
517 Ga0105245_10575171
518 Ga0114129_10001394
519 Ga0105237_10026669
520 Ga0157373_10033797
521 Ga0157370_10820839
522 Ga0157369_10015959
523 Ga0157369_10023518
524 Ga0157369_10196970
525 Ga0157369_10596840
526 Ga0157372_11221432
527 Ga0163163_10525260
528 Ga0163163_10915427
529 Ga0182008_10035238
530 Ga0157377_10073403
531 Ga0206356_11154534
532 Ga0206354_11400608
533 Ga0206354_11507604
534 Ga0206353_10532524
535 Ga0213871_10005131
536 Ga0207653_10052427
537 Ga0207692_10001782
538 Ga0207692_10164333
539 Ga0207692_10192578
540 Ga0207699_10062925
541 Ga0207643_10117058
542 Ga0207705_10035661
543 Ga0207705_10045086
544 Ga0207705_10051539
545 Ga0207705_10280922
546 Ga0207684_10057069
547 Ga0207684_10308781
548 Ga0207654_10268526
549 Ga0207707_10017652
550 Ga0207707_10026509
551 Ga0207707_10088872
552 Ga0207693_10004412
553 Ga0207693_10022918
554 Ga0207693_10346859
555 Ga0207663_10031852
556 Ga0207663_10040390
557 Ga0207660_10015510
558 Ga0207660_10019071
559 Ga0207660_10053718
560 Ga0207662_10046423
561 Ga0207657_10001151
562 Ga0207657_10015590
563 Ga0207657_10035104
564 Ga0207657_10109259
565 Ga0207657_10299401
566 Ga0207652_10044695
567 Ga0207652_10097428
568 Ga0207652_10100936
569 Ga0207652_10193358
570 Ga0207646_10072212
571 Ga0207646_10166822
572 Ga0207646_10227565
573 Ga0207646_10400972
574 Ga0207694_10131719
575 Ga0207687_10136108
576 Ga0207700_10013343
577 Ga0207664_10005465
578 Ga0207664_10006342
579 Ga0207664_10011211
580 Ga0207664_10033233
581 Ga0207664_10039460
582 Ga0207664_10067111
583 Ga0207644_10312965
584 Ga0207690_10177718
585 Ga0207690_10488352
586 Ga0207709_10064901
587 Ga0207670_10148494
588 Ga0207665_10000146
589 Ga0207661_10268645
590 Ga0207661_10558423
591 Ga0207661_10607107
592 Ga0207679_10209559
593 Ga0207667_10026297
594 Ga0207667_10868149
595 Ga0207667_10878519
596 Ga0207712_10132020
597 Ga0207639_10965727
598 Ga0207676_10152036
599 Ga0207674_10022013
600 Ga0207674_10066057
601 Ga0207683_10264726
602 Ga0207698_11119156
603 Ga0265319_1005420
604 Ga0265318_10003907
605 Ga0265318_10019384
606 Ga0265336_10014588
607 Ga0265338_10137735
608 Ga0265330_10028444
609 Ga0265332_10146914
610 Ga0265320_10013996
611 Ga0265320_10029831
612 Ga0265339_10077289
613 Ga0265331_10047774
614 Ga0265327_10048420
615 Ga0265327_10144385
616 Ga0265316_10269781
617 Ga0265313_10077147
618 Ga0265314_10007865
619 Ga0307409_100305059
620 Ga0316583_10028969
621 Ga0373943_0021634
622 Ga0373931_0186256
623 Ga0373931_0289484
624 Ga0395899_0015762
625 Ga0395899_0016441
626 Ga0395899_0022818
627 Ga0395899_0224426
628 Ga0395900_0005060
629 Ga0395900_0005709
630 Ga0395900_0072493
631 Ga0395900_0126538
632 Ga0395900_0199993
633 Ga0395900_0217509
634 Ga0395900_0239327
635 Ga0395900_0361925
636 Ga0395900_0838512
637 Ga0395898_0017620
638 Ga0395898_0029919
639 Ga0395898_0042723
640 Ga0395898_0100648
641 Ga0395905_0012290
642 Ga0395905_0032551
643 Ga0395905_0105249
644 Ga0395905_0146678
645 Ga0395901_0011415
646 Ga0395901_0018384
647 Ga0395901_0020675
648 Ga0395901_0095264
649 Ga0395901_0097160
650 Ga0395901_0261678
651 Ga0395901_0276053
652 Ga0395901_0282111
653 Ga0395901_0413198
654 Ga0436360_0435711
655 Ga0436360_0956525
656 Ga0439456_055695
657 Ga0466965_0006684
658 Ga0466965_0211331
659 Ga0466966_0011285
660 Ga0466961_0001608
661 Ga0466961_0019797
662 Ga0466963_0001597
663 Ga0466963_0002515
664 Ga0466963_0004886
665 Ga0466963_0008397
666 Ga0466963_0014147
667 Ga0466963_0016609
668 Ga0466963_0023846
669 Ga0466971_0001582
670 Ga0466968_0007158
671 Ga0466970_0278657
672 Ga0466957_0000400
673 Ga0466957_0081436
674 Ga0466959_0021229
675 Ga0466959_0050886
676 Ga0466959_0052888
677 Ga0466959_0211627
678 Ga0451576_0285632
679 Ga0466958_0000119
680 Ga0466958_0018159
681 Ga0466967_0004005
682 Ga0466967_0009346
683 Ga0466967_0018523
684 Ga0466967_0077290
685 Ga0466967_0102847
686 Ga0466967_0135888
687 Ga0466967_0235673
688 Ga0466967_0475057
689 Ga0466967_0539220
690 Ga0466967_0607794
691 Ga0495592_0070725
692 Ga0495592_0290781
693 Ga0495603_0235599
694 Ga0495629_0099397
695 Ga0495641_0002128
696 Ga0495653_0024854
697 Ga0495653_0063502
698 Ga0495582_0000127
699 Ga0495582_0058585
700 Ga0495664_0053010
701 Ga0495664_0081345
702 Ga0495594_0208669
703 Ga0495594_0334604
704 Ga0495608_0163111
705 Ga0495618_0084658
706 Ga0495628_0068742
707 Ga0495630_0006167
708 Ga0495663_0060286
709 Ga0495652_0061729
710 Ga0495665_0000469
711 Ga0495587_0034183
712 Ga0495645_0301152
713 Ga0495645_0449335
714 Ga0495667_0058608
715 Ga0495667_0257288
716 Ga0495634_0177760
717 Ga0495658_0000744
718 Ga0495613_0002469
719 Ga0495613_0278482
720 Ga0495624_0050544
721 Ga0495581_0005553
722 Ga0495604_0064423
723 Ga0495604_0068509
724 Ga0495674_0235391
725 Ga0495676_0003082
726 Ga0495680_0003111
727 Ga0495680_0040006
728 Ga0495684_0007252
729 Ga0495684_0007936
730 Ga0495593_0048654
731 Ga0495602_0179057
732 Ga0496100_0005026
733 Ga0496100_0012259
734 Ga0496100_0191933
735 Ga0496100_0402098
736 Ga0496101_0002073
737 Ga0496101_0027145
738 Ga0496101_0124049
739 Ga0496102_0015500
740 Ga0496102_0258051
741 Ga0496102_0473642
742 Ga0496104_0002209
743 Ga0496104_0143298
744 Ga0496104_0348548
745 Ga0496104_0353841
746 Ga0496105_0000448
747 Ga0496105_0025312
748 Ga0496106_0008135
749 Ga0496106_0025436
750 Ga0496106_0551921
751 Ga0496107_0055955
752 Ga0496107_0194288
753 Ga0496107_0318962
754 Ga0496108_0001713
755 Ga0496108_0073445
756 Ga0496108_0080111
757 Ga0496108_0080713
758 Ga0496108_0416261
759 Ga0496108_0784783
760 Ga0496109_0003407
761 Ga0496109_0063103
762 Ga0496109_0076111
763 Ga0496109_0196481
764 Ga0496109_0614132
765 Ga0496109_0704102
766 Ga0496110_0000054
767 Ga0496110_0099189
768 Ga0496110_0224517
769 Ga0496110_0382906
770 Ga0496110_0538222
771 Ga0496111_0001858
772 Ga0496111_0014510
773 Ga0496111_0071527
774 Ga0496111_0197361
775 Ga0496112_0000204
776 Ga0496112_0030822
777 Ga0496112_0095103
778 Ga0496112_0190749
779 Ga0496112_0222034
780 Ga0496112_0328963
781 Ga0496112_0928035
782 Ga0496113_0000302
783 Ga0496113_0274588
784 Ga0496114_0000875
785 Ga0496114_0020313
786 Ga0496114_0038997
787 Ga0496114_0044541
788 Ga0496114_0128955
789 Ga0496114_0146481
790 Ga0496114_0199464
791 Ga0496114_0257547
792 Ga0496114_0457000
793 Ga0496115_0021863
794 Ga0496115_0181379
795 Ga0496115_0182205
796 Ga0496115_0231043
797 Ga0501032_0196064
798 Ga0501034_0020301
799 Ga0501034_0363269
800 Ga0501038_0072209
801 Ga0501039_0084354
802 Ga0501039_0264773
803 Ga0501041_0010852
804 Ga0501042_0039247
805 Ga0501047_0371890
806 Ga0501048_0019995
807 Ga0501067_0012836
808 Ga0501067_0035683
809 Ga0501069_0009004
810 Ga0501069_0026095
811 Ga0501069_0345192
812 Ga0501070_0001662
813 Ga0501070_0011251
814 Ga0501070_0313302
815 Ga0501072_0044008
816 Ga0501072_0401321
817 Ga0501073_0034776
818 Ga0501073_0089447
819 Ga0501074_0004517
820 Ga0501074_0226283
821 Ga0501076_0170653
822 Ga0501079_0011238
823 Ga0501079_0045892
824 Ga0501080_0014793
825 Ga0501080_0069723
826 Ga0501080_0279639
827 Ga0501081_0069633
828 Ga0501081_0744488
829 Ga0501083_0011007
830 Ga0501044_0552084
831 Ga0501045_0029969
832 Ga0501045_0057904
833 nmdc:mga06z11_73703_c1
834 nmdc:mga05p37_17355_c1
835 nmdc:mga05p37_23556_c1
836 nmdc:mga05p37_84039_c1
837 nmdc:mga08y16_744709_c1
838 nmdc:mga0n895_86016_c1
839 nmdc:mga0rr50_134396_c1
840 nmdc:mga0a205_12284_c1
841 nmdc:mga0a205_436053_c1
842 Ga0495601_0039311
843 Ga0495601_0045792
844 Ga0495601_0178625
845 Ga0495612_0108068
846 Ga0495612_0126695
847 Ga0495655_0021630
848 Ga0495595_0088839
849 Ga0495595_0124514
850 Ga0495619_0004589
851 Ga0501084_0160287
852 Ga0501082_0469263
853 Ga0466962_0004091
854 Ga0530510_0022449
855 Ga0530510_0167730
856 Ga0530510_0180812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

25

171

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9567 6 223
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.943 1 236
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9391 1 236
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9373 6 223
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9269 6 223
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.958 6 218 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9553 1 236 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 1 236 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9493 6 69 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9444 6 235 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X8Z9E7-F1-model_v4 ABC transporter ATP-binding protein 0.9824 6 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A3B8HPL4-F1-model_v4 ABC transporter ATP-binding protein 0.9791 143 236 GO:0005524
GO:0015658
GO:0015807
AF-A0A2E7F6C8-F1-model_v4 ABC transporter ATP-binding protein 0.9721 5 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1V4MHS7-F1-model_v4 ABC transporter ATP-binding protein 0.9703 6 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1V6JCD6-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein LivF 0.9703 37 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map