F441637

General Info

Members Datasets Scaffolds Average Seq Length
428 127 856 292

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100395361|Ga0068860_1003953612
Length 332
Sequence MAPAAGWVSARPPGRDDAMTRDYYAVLGVATAASSAQIRRAYQRLARQYSPDVNLWQQEVVGVFEEIAEAYRVLGDPMARAVYDREPSSRERVGAPRPSGRRGDDLHLPVELAFQQAVSGLTADLLADRLSPCAECGASGAAPGSARAACTYCGGLGTVWSPQGAPRALKTARAVVGVTLPPGVDSGAQIRVEGEGHCGPYGGPRGDLIVVARVHEDPEFIRKGDNLYREVSLGIAEAVLGARFPVRGVDGLVDLVVPPGTQSGQVLRLRGRGMPRLSGGGRGDLYVTARVEIPRGLDARTQELFREIGRLLPPTPRGMADLRGTTDRTGRP

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
78 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
79 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.23
Rhizosphere 99.77
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100395361 3300005843 Bacteria 1367
2 Ga0070690_100313518 3300005330 Unclassified 1128
3 Ga0068869_100009843 3300005334 Bacteria 6208
4 Ga0070680_100009164 3300005336 Bacteria 7590
5 Ga0070692_10016600 3300005345 Bacteria 3503
6 Ga0070692_10074975 3300005345 Bacteria 1811
7 Ga0070669_100236330 3300005353 Bacteria 1450
8 Ga0070667_100310478 3300005367 Bacteria 1421
9 Ga0070705_100005104 3300005440 Bacteria 6384
10 Ga0070705_100035582 3300005440 Bacteria 2793
11 Ga0070705_100095352 3300005440 Bacteria 1865
12 Ga0070700_100079353 3300005441 Bacteria 2115
13 Ga0070700_100259419 3300005441 Bacteria 1251
14 Ga0070694_100066634 3300005444 Bacteria 2470
15 Ga0070708_100000912 3300005445 Bacteria 22380
16 Ga0070708_100011268 3300005445 Bacteria 7269
17 Ga0070708_100012031 3300005445 Bacteria 7054
18 Ga0070708_100028021 3300005445 Bacteria 4842
19 Ga0070708_100085160 3300005445 Bacteria 2868
20 Ga0070708_100094305 3300005445 Bacteria 2730
21 Ga0070708_100123823 3300005445 Bacteria 2387
22 Ga0070708_100277394 3300005445 Bacteria 1577
23 Ga0070708_100297904 3300005445 Bacteria 1518
24 Ga0070708_100297905 3300005445 Unclassified 1518
25 Ga0070662_100045109 3300005457 Bacteria 3161
26 Ga0070706_100004410 3300005467 Bacteria 13598
27 Ga0070706_100010745 3300005467 Bacteria 8496
28 Ga0070706_100014419 3300005467 Bacteria 7304
29 Ga0070706_100015988 3300005467 Bacteria 6930
30 Ga0070706_100016397 3300005467 Bacteria 6846
31 Ga0070706_100205868 3300005467 Unclassified 1837
32 Ga0070706_100322101 3300005467 Bacteria 1441
33 Ga0070706_100401800 3300005467 Bacteria 1275
34 Ga0070707_100002994 3300005468 Bacteria 16041
35 Ga0070707_100016630 3300005468 Bacteria 6906
36 Ga0070707_100017695 3300005468 Bacteria 6702
37 Ga0070707_100051646 3300005468 Bacteria 3941
38 Ga0070707_100062162 3300005468 Bacteria 3582
39 Ga0070707_100074867 3300005468 Bacteria 3265
40 Ga0070707_100127707 3300005468 Bacteria 2471
41 Ga0070707_100220083 3300005468 Unclassified 1849
42 Ga0070707_100396348 3300005468 Bacteria 1340
43 Ga0070707_100427787 3300005468 Bacteria 1284
44 Ga0070698_100003218 3300005471 Bacteria 17995
45 Ga0070698_100035863 3300005471 Bacteria 5126
46 Ga0070698_100036472 3300005471 Bacteria 5078
47 Ga0070698_100422607 3300005471 Bacteria 1267
48 Ga0070699_100002207 3300005518 Bacteria 17596
49 Ga0070699_100005962 3300005518 Bacteria 10640
50 Ga0070699_100031560 3300005518 Bacteria 4574
51 Ga0070699_100075768 3300005518 Bacteria 2928
52 Ga0070699_100097064 3300005518 Bacteria 2581
53 Ga0070699_100101394 3300005518 Bacteria 2523
54 Ga0070699_100271335 3300005518 Bacteria 1518
55 Ga0070699_100271336 3300005518 Bacteria 1518
56 Ga0070697_100000547 3300005536 Bacteria 28265
57 Ga0070697_100003778 3300005536 Bacteria 11624
58 Ga0070697_100038079 3300005536 Bacteria 3885
59 Ga0070697_100080575 3300005536 Bacteria 2682
60 Ga0070697_100221257 3300005536 Bacteria 1613
61 Ga0070695_100002520 3300005545 Bacteria 10564
62 Ga0070695_100096904 3300005545 Bacteria 1980
63 Ga0070695_100110966 3300005545 Unclassified 1861
64 Ga0070696_100029043 3300005546 Bacteria 3776
65 Ga0070696_100088785 3300005546 Bacteria 2198
66 Ga0070704_100035196 3300005549 Bacteria 3403
67 Ga0070704_100231924 3300005549 Unclassified 1506
68 Ga0068857_100095156 3300005577 Bacteria 2668
69 Ga0068859_100067717 3300005617 Bacteria 3605
70 Ga0068859_100159699 3300005617 Unclassified 2333
71 Ga0068864_100297739 3300005618 Bacteria 1509
72 Ga0068866_10215868 3300005718 Bacteria 1154
73 Ga0068861_100017976 3300005719 Bacteria 5028
74 Ga0068861_100100981 3300005719 Bacteria 2294
75 Ga0068862_100015007 3300005844 Bacteria 6433
76 Ga0068862_100047386 3300005844 Bacteria 3668
77 Ga0081455_10044322 3300005937 Bacteria 3882
78 Ga0081538_10013457 3300005981 Bacteria 6474
79 Ga0081540_1019087 3300005983 Bacteria 4183
80 Ga0081540_1035199 3300005983 Bacteria 2688
81 Ga0081539_10000210 3300005985 Bacteria 136405
82 Ga0075432_10072155 3300006058 Unclassified 1242
83 Ga0070716_100041405 3300006173 Bacteria 2566
84 Ga0075428_100000498 3300006844 Bacteria 39836
85 Ga0075428_100001281 3300006844 Bacteria 26808
86 Ga0075428_100009590 3300006844 Bacteria 10750
87 Ga0075428_100018484 3300006844 Bacteria 7706
88 Ga0075428_100054821 3300006844 Bacteria 4368
89 Ga0075428_100059144 3300006844 Bacteria 4197
90 Ga0075428_100083992 3300006844 Bacteria 3474
91 Ga0075428_100134021 3300006844 Bacteria 2694
92 Ga0075428_100136435 3300006844 Bacteria 2668
93 Ga0075428_100437439 3300006844 Bacteria 1401
94 Ga0075430_100000130 3300006846 Bacteria 47678
95 Ga0075430_100002623 3300006846 Bacteria 15024
96 Ga0075430_100003740 3300006846 Bacteria 12786
97 Ga0075430_100021884 3300006846 Bacteria 5433
98 Ga0075430_100068686 3300006846 Bacteria 2973
99 Ga0075430_100084090 3300006846 Bacteria 2665
100 Ga0075430_100365672 3300006846 Unclassified 1191
101 Ga0075431_100000330 3300006847 Bacteria 37548
102 Ga0075431_100000692 3300006847 Bacteria 29010
103 Ga0075431_100003744 3300006847 Bacteria 14772
104 Ga0075431_100004237 3300006847 Bacteria 14054
105 Ga0075431_100006126 3300006847 Bacteria 11934
106 Ga0075431_100007199 3300006847 Bacteria 11066
107 Ga0075431_100019122 3300006847 Bacteria 6980
108 Ga0075431_100019916 3300006847 Bacteria 6850
109 Ga0075431_100046464 3300006847 Bacteria 4477
110 Ga0075431_100090814 3300006847 Bacteria 3153
111 Ga0075433_10000237 3300006852 Bacteria 31546
112 Ga0075433_10001544 3300006852 Bacteria 17018
113 Ga0075433_10002533 3300006852 Bacteria 13912
114 Ga0075433_10009586 3300006852 Bacteria 7747
115 Ga0075433_10018069 3300006852 Bacteria 5853
116 Ga0075433_10022863 3300006852 Bacteria 5254
117 Ga0075433_10031293 3300006852 Bacteria 4548
118 Ga0075433_10060415 3300006852 Bacteria 3318
119 Ga0075433_10060538 3300006852 Bacteria 3316
120 Ga0075433_10072655 3300006852 Bacteria 3025
121 Ga0075433_10108368 3300006852 Bacteria 2464
122 Ga0075433_10335123 3300006852 Unclassified 1337
123 Ga0075434_100000381 3300006871 Bacteria 32406
124 Ga0075434_100003066 3300006871 Bacteria 14874
125 Ga0075434_100004957 3300006871 Bacteria 12070
126 Ga0075434_100014723 3300006871 Bacteria 7484
127 Ga0075434_100024539 3300006871 Bacteria 5895
128 Ga0075434_100047870 3300006871 Bacteria 4242
129 Ga0075434_100058354 3300006871 Bacteria 3836
130 Ga0075434_100066462 3300006871 Bacteria 3591
131 Ga0075434_100095560 3300006871 Bacteria 2977
132 Ga0075434_100110819 3300006871 Bacteria 2755
133 Ga0075434_100306956 3300006871 Unclassified 1607
134 Ga0075434_100374884 3300006871 Unclassified 1444
135 Ga0075434_100455214 3300006871 Unclassified 1301
136 Ga0075429_100000042 3300006880 Bacteria 57742
137 Ga0075429_100002443 3300006880 Bacteria 15644
138 Ga0075429_100006577 3300006880 Bacteria 10066
139 Ga0075429_100008867 3300006880 Bacteria 8745
140 Ga0075429_100012290 3300006880 Bacteria 7425
141 Ga0075429_100018618 3300006880 Bacteria 6014
142 Ga0075429_100021835 3300006880 Bacteria 5549
143 Ga0075429_100022999 3300006880 Bacteria 5403
144 Ga0075429_100429569 3300006880 Unclassified 1157
145 Ga0068865_100034365 3300006881 Bacteria 3401
146 Ga0068865_100330009 3300006881 Bacteria 1230
147 Ga0075436_100000643 3300006914 Bacteria 22957
148 Ga0075436_100009797 3300006914 Bacteria 6550
149 Ga0075436_100040235 3300006914 Bacteria 3226
150 Ga0075436_100054080 3300006914 Bacteria 2771
151 Ga0075436_100056265 3300006914 Bacteria 2717
152 Ga0075436_100209857 3300006914 Unclassified 1380
153 Ga0097620_100067708 3300006931 Bacteria 3605
154 Ga0097620_100159699 3300006931 Unclassified 2333
155 Ga0075435_100003231 3300007076 Bacteria 11031
156 Ga0075435_100006925 3300007076 Bacteria 8044
157 Ga0075435_100008508 3300007076 Bacteria 7369
158 Ga0075435_100012809 3300007076 Bacteria 6215
159 Ga0075435_100098537 3300007076 Bacteria 2420
160 Ga0075435_100162002 3300007076 Bacteria 1884
161 Ga0075435_100176102 3300007076 Bacteria 1806
162 Ga0075435_100526681 3300007076 Bacteria 1022
163 Ga0099794_10002777 3300007265 Bacteria 6542
164 Ga0099794_10029041 3300007265 Bacteria 2575
165 Ga0099794_10239751 3300007265 Bacteria 934
166 Ga0111539_10001936 3300009094 Bacteria 27603
167 Ga0111539_10001959 3300009094 Bacteria 27472
168 Ga0111539_10034731 3300009094 Bacteria 6109
169 Ga0111539_10045687 3300009094 Bacteria 5242
170 Ga0114129_10000728 3300009147 Bacteria 41762
171 Ga0114129_10001292 3300009147 Bacteria 33369
172 Ga0114129_10001993 3300009147 Bacteria 27939
173 Ga0114129_10002647 3300009147 Bacteria 24920
174 Ga0114129_10003625 3300009147 Bacteria 21723
175 Ga0114129_10003627 3300009147 Bacteria 21719
176 Ga0114129_10006877 3300009147 Bacteria 16179
177 Ga0114129_10034046 3300009147 Bacteria 7196
178 Ga0114129_10034252 3300009147 Bacteria 7173
179 Ga0114129_10063308 3300009147 Bacteria 5165
180 Ga0114129_10072795 3300009147 Bacteria 4789
181 Ga0114129_10087359 3300009147 Bacteria 4324
182 Ga0114129_10117642 3300009147 Bacteria 3662
183 Ga0114129_10133815 3300009147 Bacteria 3404
184 Ga0114129_10334933 3300009147 Bacteria 2008
185 Ga0114129_10334935 3300009147 Bacteria 2008
186 Ga0114129_10407199 3300009147 Bacteria 1792
187 Ga0114129_10636655 3300009147 Bacteria 1378
188 Ga0105243_10016778 3300009148 Bacteria 5536
189 Ga0105249_10014470 3300009553 Bacteria 6974
190 Ga0157378_10023746 3300013297 Bacteria 5395
191 Ga0157378_10065560 3300013297 Bacteria 3251
192 Ga0157378_10201793 3300013297 Bacteria 1881
193 Ga0163162_10013179 3300013306 Bacteria 8075
194 Ga0157375_10090067 3300013308 Bacteria 3125
195 Ga0207653_10045779 3300025885 Bacteria 1446
196 Ga0207642_10113445 3300025899 Bacteria 1384
197 Ga0207684_10000770 3300025910 Bacteria 37234
198 Ga0207684_10002456 3300025910 Bacteria 18699
199 Ga0207684_10002623 3300025910 Bacteria 17988
200 Ga0207684_10004468 3300025910 Bacteria 13165
201 Ga0207684_10011012 3300025910 Bacteria 7931
202 Ga0207684_10012168 3300025910 Bacteria 7489
203 Ga0207684_10026270 3300025910 Bacteria 4964
204 Ga0207684_10044451 3300025910 Bacteria 3767
205 Ga0207684_10182770 3300025910 Unclassified 1808
206 Ga0207684_10451018 3300025910 Bacteria 1104
207 Ga0207660_10021831 3300025917 Bacteria 4308
208 Ga0207652_10127692 3300025921 Bacteria 2266
209 Ga0207646_10000483 3300025922 Bacteria 53346
210 Ga0207646_10013650 3300025922 Bacteria 7758
211 Ga0207646_10017859 3300025922 Bacteria 6625
212 Ga0207646_10038009 3300025922 Bacteria 4338
213 Ga0207646_10043446 3300025922 Bacteria 4036
214 Ga0207646_10073101 3300025922 Bacteria 3063
215 Ga0207646_10093630 3300025922 Bacteria 2690
216 Ga0207646_10397397 3300025922 Unclassified 1245
217 Ga0207681_10043462 3300025923 Bacteria 3007
218 Ga0207706_10061086 3300025933 Bacteria 3319
219 Ga0207709_10009456 3300025935 Bacteria 5363
220 Ga0207704_10200641 3300025938 Bacteria 1459
221 Ga0207665_10033657 3300025939 Bacteria 3399
222 Ga0207689_10015956 3300025942 Bacteria 6358
223 Ga0207703_10151220 3300026035 Bacteria 2024
224 Ga0207708_10065752 3300026075 Bacteria 2772
225 Ga0207648_10700813 3300026089 Bacteria 938
226 Ga0207674_10026636 3300026116 Bacteria 6134
227 Ga0207675_100058917 3300026118 Bacteria 3584
228 Ga0209588_1002266 3300027671 Bacteria 5203
229 Ga0209588_1025228 3300027671 Unclassified 1879
230 Ga0209971_1014417 3300027682 Bacteria 1874
231 Ga0207428_10000095 3300027907 Bacteria 123199
232 Ga0207428_10014187 3300027907 Bacteria 6935
233 Ga0207428_10021033 3300027907 Bacteria 5531
234 Ga0207428_10272991 3300027907 Bacteria 1256
235 Ga0268265_10365807 3300028380 Bacteria 1322
236 Ga0307408_100034137 3300031548 Bacteria 3560
237 Ga0307409_100016575 3300031995 Bacteria 4880
238 Ga0307416_100045959 3300032002 Bacteria 3442
239 Ga0307416_100146442 3300032002 Bacteria 2157
240 Ga0307414_10492817 3300032004 Unclassified 1083
241 Ga0307411_10086465 3300032005 Bacteria 2175
242 Ga0373940_0051955 3300035088 Bacteria 1154
243 Ga0373941_0050749 3300035115 Unclassified 1318
244 Ga0373962_0005569 3300035242 Bacteria 3044
245 Ga0373962_0034159 3300035242 Unclassified 1407
246 Ga0373931_0013123 3300035691 Bacteria 4029
247 Ga0373931_0256429 3300035691 Unclassified 1065
248 Ga0395899_0014122 3300037312 Bacteria 6096
249 Ga0395899_0074652 3300037312 Bacteria 2477
250 Ga0395900_0023596 3300037418 Bacteria 6293
251 Ga0395900_0067755 3300037418 Bacteria 3667
252 Ga0395898_0011869 3300037466 Bacteria 9023
253 Ga0395901_0007347 3300038443 Bacteria 11120
254 Ga0451577_0002938 3300042876 Bacteria 19529
255 Ga0451577_0256803 3300042876 Bacteria 1582
256 Ga0453683_0025690 3300044673 Bacteria 3739
257 Ga0453683_0054930 3300044673 Bacteria 2493
258 Ga0451576_0038203 3300045051 Bacteria 5081
259 Ga0451576_0055526 3300045051 Bacteria 4143
260 Ga0451576_0139395 3300045051 Bacteria 2530
261 Ga0451576_0175747 3300045051 Bacteria 2235
262 Ga0495580_0000020 3300046472 Bacteria 91314
263 Ga0495580_0183151 3300046472 Unclassified 1446
264 Ga0495659_0023189 3300046664 Bacteria 2107
265 Ga0496106_0076191 3300048909 Bacteria 2571
266 Ga0501031_0339264 3300049568 Bacteria 973
267 Ga0501033_0045558 3300049570 Bacteria 3264
268 Ga0501033_0094065 3300049570 Bacteria 2192
269 Ga0501036_0056928 3300049572 Bacteria 3312
270 Ga0501036_0083665 3300049572 Bacteria 2698
271 Ga0501036_0230798 3300049572 Bacteria 1553
272 Ga0501038_0068466 3300049574 Bacteria 3017
273 Ga0501039_0019363 3300049575 Bacteria 5217
274 Ga0501039_0064467 3300049575 Bacteria 2840
275 Ga0501039_0076387 3300049575 Bacteria 2604
276 Ga0501040_0031826 3300049576 Bacteria 3566
277 Ga0501040_0066499 3300049576 Bacteria 2484
278 Ga0501040_0097717 3300049576 Bacteria 2046
279 Ga0501040_0322509 3300049576 Bacteria 1105
280 Ga0501041_0008426 3300049577 Bacteria 6065
281 Ga0501041_0049099 3300049577 Bacteria 2570
282 Ga0501041_0216761 3300049577 Unclassified 1201
283 Ga0501042_0261362 3300049578 Bacteria 1250
284 Ga0501043_0201718 3300049579 Unclassified 1544
285 Ga0501046_0145346 3300049580 Bacteria 1791
286 Ga0501046_0157498 3300049580 Bacteria 1710
287 Ga0501046_0180231 3300049580 Bacteria 1580
288 Ga0501048_0021992 3300049582 Bacteria 4668
289 Ga0501048_0100187 3300049582 Bacteria 2044
290 Ga0501048_0264281 3300049582 Unclassified 1223
291 Ga0501068_0014449 3300049584 Bacteria 4514
292 Ga0501069_0067553 3300049585 Bacteria 2000
293 Ga0501071_0044021 3300049587 Bacteria 3202
294 Ga0501071_0055258 3300049587 Bacteria 2866
295 Ga0501072_0019362 3300049588 Bacteria 5260
296 Ga0501072_0028271 3300049588 Bacteria 4377
297 Ga0501072_0084345 3300049588 Bacteria 2519
298 Ga0501072_0185451 3300049588 Unclassified 1660
299 Ga0501074_0121251 3300049590 Unclassified 1870
300 Ga0501075_0001114 3300049591 Bacteria 17297
301 Ga0501075_0085267 3300049591 Unclassified 2393
302 Ga0501075_0131420 3300049591 Unclassified 1907
303 Ga0501075_0374859 3300049591 Unclassified 1085
304 Ga0501075_0406380 3300049591 Unclassified 1038
305 Ga0501076_0062554 3300049592 Bacteria 2965
306 Ga0501076_0064244 3300049592 Bacteria 2925
307 Ga0501076_0118896 3300049592 Bacteria 2139
308 Ga0501076_0230408 3300049592 Unclassified 1514
309 Ga0501077_0011073 3300049593 Bacteria 5625
310 Ga0501077_0029406 3300049593 Bacteria 3492
311 Ga0501077_0059024 3300049593 Bacteria 2435
312 Ga0501077_0217515 3300049593 Bacteria 1214
313 Ga0501079_0004235 3300049741 Bacteria 10638
314 Ga0501079_0035150 3300049741 Bacteria 3857
315 Ga0501079_0047067 3300049741 Bacteria 3328
316 Ga0501079_0124022 3300049741 Bacteria 2009
317 Ga0501079_0143857 3300049741 Bacteria 1858
318 Ga0501079_0221074 3300049741 Bacteria 1480
319 Ga0501079_0296787 3300049741 Unclassified 1264
320 Ga0501079_0653243 3300049741 Bacteria 828
321 Ga0501080_0010460 3300049742 Bacteria 8495
322 Ga0501080_0141742 3300049742 Bacteria 2222
323 Ga0501081_0001545 3300049743 Bacteria 14161
324 Ga0501081_0003470 3300049743 Bacteria 10072
325 Ga0501081_0008431 3300049743 Bacteria 6694
326 Ga0501081_0042577 3300049743 Bacteria 3112
327 Ga0501081_0070929 3300049743 Bacteria 2428
328 Ga0501081_0077762 3300049743 Unclassified 2319
329 Ga0501081_0087031 3300049743 Bacteria 2194
330 Ga0501081_0159890 3300049743 Bacteria 1623
331 Ga0501083_0102423 3300049744 Bacteria 1888
332 Ga0501045_0136126 3300049824 Bacteria 1826
333 nmdc:mga05p37_152356_c1 3300050507 Bacteria 2827
334 nmdc:mga05p37_1619_c1 3300050507 Bacteria 26082
335 nmdc:mga05p37_176333_c1 3300050507 Bacteria 2604
336 nmdc:mga05p37_191037_c1 3300050507 Bacteria 2486
337 nmdc:mga05p37_219478_c1 3300050507 Bacteria 2295
338 nmdc:mga05p37_2276_c1 3300050507 Bacteria 22378
339 nmdc:mga05p37_320686_c1 3300050507 Bacteria 1834
340 nmdc:mga05p37_3440_c1 3300050507 Bacteria 10182
341 nmdc:mga05p37_3626_c1 3300050507 Bacteria 18046
342 nmdc:mga05p37_44666_c1 3300050507 Bacteria 5452
343 nmdc:mga05p37_5439_c1 3300050507 Bacteria 14960
344 nmdc:mga05p37_64105_c1 3300050507 Bacteria 4522
345 nmdc:mga05p37_6533_c1 3300050507 Bacteria 13753
346 nmdc:mga05p37_660_c1 3300050507 Bacteria 38072
347 nmdc:mga05p37_663050_c1 3300050507 Unclassified 1166
348 nmdc:mga05p37_69492_c1 3300050507 Bacteria 4332
349 nmdc:mga05p37_8627_c1 3300050507 Bacteria 12048
350 nmdc:mga09592_1333_c1 3300050508 Bacteria 19776
351 nmdc:mga09592_20767_c1 3300050508 Bacteria 5405
352 nmdc:mga09592_245133_c1 3300050508 Unclassified 1553
353 nmdc:mga09592_49735_c1 3300050508 Bacteria 3535
354 nmdc:mga09592_7212_c1 3300050508 Bacteria 3675
355 nmdc:mga09592_74087_c1 3300050508 Bacteria 2894
356 nmdc:mga09592_913_c1 3300050508 Bacteria 23219
357 nmdc:mga0qj67_22072_c1 3300050509 Bacteria 4886
358 nmdc:mga0qj67_50410_c1 3300050509 Bacteria 3292
359 nmdc:mga0qj67_527_c1 3300050509 Bacteria 26037
360 nmdc:mga0qj67_6056_c1 3300050509 Bacteria 8855
361 nmdc:mga0qj67_71074_c1 3300050509 Bacteria 2777
362 nmdc:mga0qj67_830_c1 3300050509 Bacteria 21163
363 nmdc:mga06r32_103494_c1 3300050510 Bacteria 2796
364 nmdc:mga06r32_1275_c1 3300050510 Bacteria 22674
365 nmdc:mga06r32_13134_c1 3300050510 Bacteria 7500
366 nmdc:mga06r32_134596_c1 3300050510 Bacteria 2446
367 nmdc:mga06r32_1804_c1 3300050510 Bacteria 19170
368 nmdc:mga06r32_2679_c1 3300050510 Bacteria 15934
369 nmdc:mga06r32_27846_c1 3300050510 Bacteria 5283
370 nmdc:mga06r32_3775_c1 3300050510 Bacteria 13550
371 nmdc:mga06r32_5112_c1 3300050510 Bacteria 11800
372 nmdc:mga06r32_74948_c1 3300050510 Bacteria 3282
373 nmdc:mga08y16_10137_c1 3300050511 Bacteria 9893
374 nmdc:mga08y16_101577_c1 3300050511 Bacteria 2994
375 nmdc:mga08y16_24745_c2 3300050511 Bacteria 4701
376 nmdc:mga08y16_3812_c1 3300050511 Bacteria 15682
377 nmdc:mga08y16_534_c1 3300050511 Bacteria 35243
378 nmdc:mga0n895_126443_c1 3300050512 Bacteria 2580
379 nmdc:mga0n895_1482_c1 3300050512 Bacteria 17603
380 nmdc:mga0n895_17733_c1 3300050512 Bacteria 6569
381 nmdc:mga0n895_221477_c1 3300050512 Bacteria 1921
382 nmdc:mga0n895_23465_c1 3300050512 Bacteria 5798
383 nmdc:mga0n895_271389_c1 3300050512 Bacteria 1721
384 nmdc:mga0n895_364035_c1 3300050512 Unclassified 1464
385 nmdc:mga0n895_4007_c1 3300050512 Bacteria 11980
386 nmdc:mga0n895_488327_c1 3300050512 Unclassified 1241
387 nmdc:mga0n895_504_c1 3300050512 Bacteria 26480
388 nmdc:mga0n895_64775_c1 3300050512 Bacteria 3616
389 nmdc:mga0n895_74339_c1 3300050512 Bacteria 3376
390 nmdc:mga0n895_7568_c1 3300050512 Bacteria 9335
391 nmdc:mga0n895_99804_c1 3300050512 Bacteria 2912
392 nmdc:mga0rr50_112913_c1 3300050513 Bacteria 2153
393 nmdc:mga0rr50_192905_c1 3300050513 Bacteria 1671
394 nmdc:mga0rr50_20206_c1 3300050513 Bacteria 4515
395 nmdc:mga0rr50_26036_c1 3300050513 Bacteria 4075
396 nmdc:mga0rr50_298643_c1 3300050513 Bacteria 1052
397 nmdc:mga0rr50_345877_c1 3300050513 Unclassified 1250
398 nmdc:mga0rr50_41335_c1 3300050513 Bacteria 3359
399 nmdc:mga0rr50_9894_c1 3300050513 Bacteria 6027
400 nmdc:mga08x19_176527_c1 3300050514 Unclassified 1457
401 nmdc:mga08x19_21615_c1 3300050514 Bacteria 3975
402 nmdc:mga08x19_477_c1 3300050514 Bacteria 26951
403 nmdc:mga08x19_5376_c1 3300050514 Bacteria 7570
404 nmdc:mga08x19_68741_c1 3300050514 Bacteria 2306
405 nmdc:mga0a205_100855_c1 3300050515 Bacteria 2786
406 nmdc:mga0a205_1102_c1 3300050515 Bacteria 13091
407 nmdc:mga0a205_121679_c1 3300050515 Bacteria 2509
408 nmdc:mga0a205_1540_c1 3300050515 Bacteria 19717
409 nmdc:mga0a205_1589_c1 3300050515 Bacteria 19493
410 nmdc:mga0a205_19473_c1 3300050515 Bacteria 6398
411 nmdc:mga0a205_27656_c1 3300050515 Bacteria 5416
412 nmdc:mga0a205_3097_c1 3300050515 Bacteria 14747
413 nmdc:mga0a205_33080_c1 3300050515 Bacteria 4959
414 nmdc:mga0a205_368884_c1 3300050515 Unclassified 1302
415 nmdc:mga0a205_7727_c1 3300050515 Bacteria 9761
416 Ga0501084_0004019 3300054114 Bacteria 11981
417 Ga0501084_0008710 3300054114 Bacteria 8390
418 Ga0501084_0013653 3300054114 Bacteria 6722
419 Ga0501084_0043584 3300054114 Bacteria 3753
420 Ga0501084_0064695 3300054114 Bacteria 3060
421 Ga0501084_0103028 3300054114 Bacteria 2397
422 Ga0590071_015509 3300059421 Bacteria 1786
423 Ga0501082_0037043 3300060353 Bacteria 4202
424 Ga0501082_0080913 3300060353 Bacteria 2803
425 Ga0530510_0000180 3300061734 Bacteria 38581
426 Ga0530510_0005542 3300061734 Bacteria 8748
427 Ga0530510_0009078 3300061734 Bacteria 6969
428 Ga0530510_0053825 3300061734 Bacteria 2908
429 Ga0068860_100395361
430 Ga0070690_100313518
431 Ga0068869_100009843
432 Ga0070680_100009164
433 Ga0070692_10016600
434 Ga0070692_10074975
435 Ga0070669_100236330
436 Ga0070667_100310478
437 Ga0070705_100005104
438 Ga0070705_100035582
439 Ga0070705_100095352
440 Ga0070700_100079353
441 Ga0070700_100259419
442 Ga0070694_100066634
443 Ga0070708_100000912
444 Ga0070708_100011268
445 Ga0070708_100012031
446 Ga0070708_100028021
447 Ga0070708_100085160
448 Ga0070708_100094305
449 Ga0070708_100123823
450 Ga0070708_100277394
451 Ga0070708_100297904
452 Ga0070708_100297905
453 Ga0070662_100045109
454 Ga0070706_100004410
455 Ga0070706_100010745
456 Ga0070706_100014419
457 Ga0070706_100015988
458 Ga0070706_100016397
459 Ga0070706_100205868
460 Ga0070706_100322101
461 Ga0070706_100401800
462 Ga0070707_100002994
463 Ga0070707_100016630
464 Ga0070707_100017695
465 Ga0070707_100051646
466 Ga0070707_100062162
467 Ga0070707_100074867
468 Ga0070707_100127707
469 Ga0070707_100220083
470 Ga0070707_100396348
471 Ga0070707_100427787
472 Ga0070698_100003218
473 Ga0070698_100035863
474 Ga0070698_100036472
475 Ga0070698_100422607
476 Ga0070699_100002207
477 Ga0070699_100005962
478 Ga0070699_100031560
479 Ga0070699_100075768
480 Ga0070699_100097064
481 Ga0070699_100101394
482 Ga0070699_100271335
483 Ga0070699_100271336
484 Ga0070697_100000547
485 Ga0070697_100003778
486 Ga0070697_100038079
487 Ga0070697_100080575
488 Ga0070697_100221257
489 Ga0070695_100002520
490 Ga0070695_100096904
491 Ga0070695_100110966
492 Ga0070696_100029043
493 Ga0070696_100088785
494 Ga0070704_100035196
495 Ga0070704_100231924
496 Ga0068857_100095156
497 Ga0068859_100067717
498 Ga0068859_100159699
499 Ga0068864_100297739
500 Ga0068866_10215868
501 Ga0068861_100017976
502 Ga0068861_100100981
503 Ga0068862_100015007
504 Ga0068862_100047386
505 Ga0081455_10044322
506 Ga0081538_10013457
507 Ga0081540_1019087
508 Ga0081540_1035199
509 Ga0081539_10000210
510 Ga0075432_10072155
511 Ga0070716_100041405
512 Ga0075428_100000498
513 Ga0075428_100001281
514 Ga0075428_100009590
515 Ga0075428_100018484
516 Ga0075428_100054821
517 Ga0075428_100059144
518 Ga0075428_100083992
519 Ga0075428_100134021
520 Ga0075428_100136435
521 Ga0075428_100437439
522 Ga0075430_100000130
523 Ga0075430_100002623
524 Ga0075430_100003740
525 Ga0075430_100021884
526 Ga0075430_100068686
527 Ga0075430_100084090
528 Ga0075430_100365672
529 Ga0075431_100000330
530 Ga0075431_100000692
531 Ga0075431_100003744
532 Ga0075431_100004237
533 Ga0075431_100006126
534 Ga0075431_100007199
535 Ga0075431_100019122
536 Ga0075431_100019916
537 Ga0075431_100046464
538 Ga0075431_100090814
539 Ga0075433_10000237
540 Ga0075433_10001544
541 Ga0075433_10002533
542 Ga0075433_10009586
543 Ga0075433_10018069
544 Ga0075433_10022863
545 Ga0075433_10031293
546 Ga0075433_10060415
547 Ga0075433_10060538
548 Ga0075433_10072655
549 Ga0075433_10108368
550 Ga0075433_10335123
551 Ga0075434_100000381
552 Ga0075434_100003066
553 Ga0075434_100004957
554 Ga0075434_100014723
555 Ga0075434_100024539
556 Ga0075434_100047870
557 Ga0075434_100058354
558 Ga0075434_100066462
559 Ga0075434_100095560
560 Ga0075434_100110819
561 Ga0075434_100306956
562 Ga0075434_100374884
563 Ga0075434_100455214
564 Ga0075429_100000042
565 Ga0075429_100002443
566 Ga0075429_100006577
567 Ga0075429_100008867
568 Ga0075429_100012290
569 Ga0075429_100018618
570 Ga0075429_100021835
571 Ga0075429_100022999
572 Ga0075429_100429569
573 Ga0068865_100034365
574 Ga0068865_100330009
575 Ga0075436_100000643
576 Ga0075436_100009797
577 Ga0075436_100040235
578 Ga0075436_100054080
579 Ga0075436_100056265
580 Ga0075436_100209857
581 Ga0097620_100067708
582 Ga0097620_100159699
583 Ga0075435_100003231
584 Ga0075435_100006925
585 Ga0075435_100008508
586 Ga0075435_100012809
587 Ga0075435_100098537
588 Ga0075435_100162002
589 Ga0075435_100176102
590 Ga0075435_100526681
591 Ga0099794_10002777
592 Ga0099794_10029041
593 Ga0099794_10239751
594 Ga0111539_10001936
595 Ga0111539_10001959
596 Ga0111539_10034731
597 Ga0111539_10045687
598 Ga0114129_10000728
599 Ga0114129_10001292
600 Ga0114129_10001993
601 Ga0114129_10002647
602 Ga0114129_10003625
603 Ga0114129_10003627
604 Ga0114129_10006877
605 Ga0114129_10034046
606 Ga0114129_10034252
607 Ga0114129_10063308
608 Ga0114129_10072795
609 Ga0114129_10087359
610 Ga0114129_10117642
611 Ga0114129_10133815
612 Ga0114129_10334933
613 Ga0114129_10334935
614 Ga0114129_10407199
615 Ga0114129_10636655
616 Ga0105243_10016778
617 Ga0105249_10014470
618 Ga0157378_10023746
619 Ga0157378_10065560
620 Ga0157378_10201793
621 Ga0163162_10013179
622 Ga0157375_10090067
623 Ga0207653_10045779
624 Ga0207642_10113445
625 Ga0207684_10000770
626 Ga0207684_10002456
627 Ga0207684_10002623
628 Ga0207684_10004468
629 Ga0207684_10011012
630 Ga0207684_10012168
631 Ga0207684_10026270
632 Ga0207684_10044451
633 Ga0207684_10182770
634 Ga0207684_10451018
635 Ga0207660_10021831
636 Ga0207652_10127692
637 Ga0207646_10000483
638 Ga0207646_10013650
639 Ga0207646_10017859
640 Ga0207646_10038009
641 Ga0207646_10043446
642 Ga0207646_10073101
643 Ga0207646_10093630
644 Ga0207646_10397397
645 Ga0207681_10043462
646 Ga0207706_10061086
647 Ga0207709_10009456
648 Ga0207704_10200641
649 Ga0207665_10033657
650 Ga0207689_10015956
651 Ga0207703_10151220
652 Ga0207708_10065752
653 Ga0207648_10700813
654 Ga0207674_10026636
655 Ga0207675_100058917
656 Ga0209588_1002266
657 Ga0209588_1025228
658 Ga0209971_1014417
659 Ga0207428_10000095
660 Ga0207428_10014187
661 Ga0207428_10021033
662 Ga0207428_10272991
663 Ga0268265_10365807
664 Ga0307408_100034137
665 Ga0307409_100016575
666 Ga0307416_100045959
667 Ga0307416_100146442
668 Ga0307414_10492817
669 Ga0307411_10086465
670 Ga0373940_0051955
671 Ga0373941_0050749
672 Ga0373962_0005569
673 Ga0373962_0034159
674 Ga0373931_0013123
675 Ga0373931_0256429
676 Ga0395899_0014122
677 Ga0395899_0074652
678 Ga0395900_0023596
679 Ga0395900_0067755
680 Ga0395898_0011869
681 Ga0395901_0007347
682 Ga0451577_0002938
683 Ga0451577_0256803
684 Ga0453683_0025690
685 Ga0453683_0054930
686 Ga0451576_0038203
687 Ga0451576_0055526
688 Ga0451576_0139395
689 Ga0451576_0175747
690 Ga0495580_0000020
691 Ga0495580_0183151
692 Ga0495659_0023189
693 Ga0496106_0076191
694 Ga0501031_0339264
695 Ga0501033_0045558
696 Ga0501033_0094065
697 Ga0501036_0056928
698 Ga0501036_0083665
699 Ga0501036_0230798
700 Ga0501038_0068466
701 Ga0501039_0019363
702 Ga0501039_0064467
703 Ga0501039_0076387
704 Ga0501040_0031826
705 Ga0501040_0066499
706 Ga0501040_0097717
707 Ga0501040_0322509
708 Ga0501041_0008426
709 Ga0501041_0049099
710 Ga0501041_0216761
711 Ga0501042_0261362
712 Ga0501043_0201718
713 Ga0501046_0145346
714 Ga0501046_0157498
715 Ga0501046_0180231
716 Ga0501048_0021992
717 Ga0501048_0100187
718 Ga0501048_0264281
719 Ga0501068_0014449
720 Ga0501069_0067553
721 Ga0501071_0044021
722 Ga0501071_0055258
723 Ga0501072_0019362
724 Ga0501072_0028271
725 Ga0501072_0084345
726 Ga0501072_0185451
727 Ga0501074_0121251
728 Ga0501075_0001114
729 Ga0501075_0085267
730 Ga0501075_0131420
731 Ga0501075_0374859
732 Ga0501075_0406380
733 Ga0501076_0062554
734 Ga0501076_0064244
735 Ga0501076_0118896
736 Ga0501076_0230408
737 Ga0501077_0011073
738 Ga0501077_0029406
739 Ga0501077_0059024
740 Ga0501077_0217515
741 Ga0501079_0004235
742 Ga0501079_0035150
743 Ga0501079_0047067
744 Ga0501079_0124022
745 Ga0501079_0143857
746 Ga0501079_0221074
747 Ga0501079_0296787
748 Ga0501079_0653243
749 Ga0501080_0010460
750 Ga0501080_0141742
751 Ga0501081_0001545
752 Ga0501081_0003470
753 Ga0501081_0008431
754 Ga0501081_0042577
755 Ga0501081_0070929
756 Ga0501081_0077762
757 Ga0501081_0087031
758 Ga0501081_0159890
759 Ga0501083_0102423
760 Ga0501045_0136126
761 nmdc:mga05p37_152356_c1
762 nmdc:mga05p37_1619_c1
763 nmdc:mga05p37_176333_c1
764 nmdc:mga05p37_191037_c1
765 nmdc:mga05p37_219478_c1
766 nmdc:mga05p37_2276_c1
767 nmdc:mga05p37_320686_c1
768 nmdc:mga05p37_3440_c1
769 nmdc:mga05p37_3626_c1
770 nmdc:mga05p37_44666_c1
771 nmdc:mga05p37_5439_c1
772 nmdc:mga05p37_64105_c1
773 nmdc:mga05p37_6533_c1
774 nmdc:mga05p37_660_c1
775 nmdc:mga05p37_663050_c1
776 nmdc:mga05p37_69492_c1
777 nmdc:mga05p37_8627_c1
778 nmdc:mga09592_1333_c1
779 nmdc:mga09592_20767_c1
780 nmdc:mga09592_245133_c1
781 nmdc:mga09592_49735_c1
782 nmdc:mga09592_7212_c1
783 nmdc:mga09592_74087_c1
784 nmdc:mga09592_913_c1
785 nmdc:mga0qj67_22072_c1
786 nmdc:mga0qj67_50410_c1
787 nmdc:mga0qj67_527_c1
788 nmdc:mga0qj67_6056_c1
789 nmdc:mga0qj67_71074_c1
790 nmdc:mga0qj67_830_c1
791 nmdc:mga06r32_103494_c1
792 nmdc:mga06r32_1275_c1
793 nmdc:mga06r32_13134_c1
794 nmdc:mga06r32_134596_c1
795 nmdc:mga06r32_1804_c1
796 nmdc:mga06r32_2679_c1
797 nmdc:mga06r32_27846_c1
798 nmdc:mga06r32_3775_c1
799 nmdc:mga06r32_5112_c1
800 nmdc:mga06r32_74948_c1
801 nmdc:mga08y16_10137_c1
802 nmdc:mga08y16_101577_c1
803 nmdc:mga08y16_24745_c2
804 nmdc:mga08y16_3812_c1
805 nmdc:mga08y16_534_c1
806 nmdc:mga0n895_126443_c1
807 nmdc:mga0n895_1482_c1
808 nmdc:mga0n895_17733_c1
809 nmdc:mga0n895_221477_c1
810 nmdc:mga0n895_23465_c1
811 nmdc:mga0n895_271389_c1
812 nmdc:mga0n895_364035_c1
813 nmdc:mga0n895_4007_c1
814 nmdc:mga0n895_488327_c1
815 nmdc:mga0n895_504_c1
816 nmdc:mga0n895_64775_c1
817 nmdc:mga0n895_74339_c1
818 nmdc:mga0n895_7568_c1
819 nmdc:mga0n895_99804_c1
820 nmdc:mga0rr50_112913_c1
821 nmdc:mga0rr50_192905_c1
822 nmdc:mga0rr50_20206_c1
823 nmdc:mga0rr50_26036_c1
824 nmdc:mga0rr50_298643_c1
825 nmdc:mga0rr50_345877_c1
826 nmdc:mga0rr50_41335_c1
827 nmdc:mga0rr50_9894_c1
828 nmdc:mga08x19_176527_c1
829 nmdc:mga08x19_21615_c1
830 nmdc:mga08x19_477_c1
831 nmdc:mga08x19_5376_c1
832 nmdc:mga08x19_68741_c1
833 nmdc:mga0a205_100855_c1
834 nmdc:mga0a205_1102_c1
835 nmdc:mga0a205_121679_c1
836 nmdc:mga0a205_1540_c1
837 nmdc:mga0a205_1589_c1
838 nmdc:mga0a205_19473_c1
839 nmdc:mga0a205_27656_c1
840 nmdc:mga0a205_3097_c1
841 nmdc:mga0a205_33080_c1
842 nmdc:mga0a205_368884_c1
843 nmdc:mga0a205_7727_c1
844 Ga0501084_0004019
845 Ga0501084_0008710
846 Ga0501084_0013653
847 Ga0501084_0043584
848 Ga0501084_0064695
849 Ga0501084_0103028
850 Ga0590071_015509
851 Ga0501082_0037043
852 Ga0501082_0080913
853 Ga0530510_0000180
854 Ga0530510_0005542
855 Ga0530510_0009078
856 Ga0530510_0053825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

22

84

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

106

294

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9488 4 68
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9468 3 62
6rzy-assembly2.cif.gz_B plasmodium falciparum pfa0660w hsp40 co-chaperone j-domain 0.9411 3 66
8glv-assembly1.cif.gz_KA 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.9377 4 68
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.935 4 68
ID Description Score Start End Superfamily
af_Q54GP6_1_104_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9745 4 69 1.10.287.110
af_Q8GUN6_21_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.966 3 70 1.10.287.110
af_Q96LL9_48_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9645 5 68 1.10.287.110
af_Q4D4S6_8_90_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9617 3 68 1.10.287.110
af_Q8RYC5_16_110_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9595 3 71 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A5N9GSS3-F1-model_v4 J domain-containing protein 0.977 167 258 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A6L8ZA96-F1-model_v4 deleted 0.965 125 258
AF-X0UV11-F1-model_v4 Chaperone DnaJ C-terminal domain-containing protein 0.9634 121 258 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A2X0RFX2-F1-model_v4 Chaperone protein DnaJ 0.9623 125 258 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-F8WLU2-F1-model_v4 Chaperone protein Hsp40 0.962 123 226 GO:0005737
GO:0031072
GO:0042026
GO:0046872
GO:0051082
GO:0051085

Map