F441609

General Info

Members Datasets Scaffolds Average Seq Length
428 218 856 131

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100806322|Ga0070673_1008063222
Length 135
Sequence MGYAVVKLVHQSAVTLSLAGFFVRGAASLAGARWVGGGRAAKTLPHVVDSVLLLSALALAWMLRLTPGNAPWLLAKVIGLIAYVGLGVLALRPGRPRGVRATAWVATLLTAGWIVSVAITKSPLGFLGYLLRLSS

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
144 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
145 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
146 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
150 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
151 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
152 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
153 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
154 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
155 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
156 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
159 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
195 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
196 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
197 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
201 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
202 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
203 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
204 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
205 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
215 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
216 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
217 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
218 2643221544 Pelomonas sp. Root1444 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.23
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.98
Nodule 0
Rhizoplane 3.74
Rhizosphere 80.84
Stem 0
Stem Tuber 0
Unclassified 9.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100806322 3300005364 Unclassified 867
2 rootH1_10113351 3300003323 Bacteria 2423
3 Ga0070676_11051147 3300005328 Bacteria 613
4 Ga0070670_100027744 3300005331 Bacteria 4870
5 Ga0070670_100138919 3300005331 Bacteria 2101
6 Ga0070670_100159148 3300005331 Bacteria 1957
7 Ga0070677_10015973 3300005333 Bacteria 2667
8 Ga0070677_10039470 3300005333 Bacteria 1853
9 Ga0070677_10039899 3300005333 Bacteria 1845
10 Ga0068869_100035191 3300005334 Bacteria 3548
11 Ga0068869_100195734 3300005334 Bacteria 1592
12 Ga0070666_10002951 3300005335 Bacteria 10302
13 Ga0068868_100001055 3300005338 Bacteria 18854
14 Ga0068868_100087235 3300005338 Bacteria 2509
15 Ga0068868_101195506 3300005338 Bacteria 703
16 Ga0070689_100145273 3300005340 Bacteria 1910
17 Ga0070689_101018093 3300005340 Unclassified 737
18 Ga0070687_100772811 3300005343 Bacteria 678
19 Ga0070687_100904158 3300005343 Bacteria 633
20 Ga0070668_100687890 3300005347 Bacteria 901
21 Ga0070669_100101538 3300005353 Bacteria 2171
22 Ga0070669_100107979 3300005353 Bacteria 2109
23 Ga0070675_100001438 3300005354 Bacteria 17494
24 Ga0070675_100046793 3300005354 Bacteria 3544
25 Ga0070675_100168101 3300005354 Bacteria 1890
26 Ga0070675_100176623 3300005354 Bacteria 1844
27 Ga0070675_100389413 3300005354 Bacteria 1242
28 Ga0070675_100393700 3300005354 Bacteria 1235
29 Ga0070675_101918187 3300005354 Unclassified 546
30 Ga0070671_100006259 3300005355 Bacteria 9482
31 Ga0070671_100017985 3300005355 Bacteria 5734
32 Ga0070671_100066240 3300005355 Bacteria 3010
33 Ga0070671_100307427 3300005355 Bacteria 1350
34 Ga0070674_100053237 3300005356 Bacteria 2794
35 Ga0070674_100272947 3300005356 Bacteria 1337
36 Ga0070673_100007023 3300005364 Bacteria 7383
37 Ga0070673_100010730 3300005364 Bacteria 6214
38 Ga0070673_100011051 3300005364 Bacteria 6150
39 Ga0070673_100148672 3300005364 Bacteria 1982
40 Ga0070673_100195666 3300005364 Bacteria 1739
41 Ga0070673_100798732 3300005364 Bacteria 871
42 Ga0070673_100815895 3300005364 Bacteria 862
43 Ga0070688_100004207 3300005365 Bacteria 7479
44 Ga0070667_100003925 3300005367 Bacteria 12634
45 Ga0070667_100110529 3300005367 Bacteria 2383
46 Ga0070678_100058414 3300005456 Bacteria 2831
47 Ga0070678_100299596 3300005456 Bacteria 1366
48 Ga0070678_100398342 3300005456 Unclassified 1195
49 Ga0070678_100566356 3300005456 Bacteria 1010
50 Ga0070662_100024922 3300005457 Bacteria 4127
51 Ga0070662_100069194 3300005457 Bacteria 2597
52 Ga0068867_100035207 3300005459 Bacteria 3631
53 Ga0068867_100099203 3300005459 Bacteria 2222
54 Ga0068867_100386842 3300005459 Bacteria 1176
55 Ga0068867_101508235 3300005459 Unclassified 626
56 Ga0070685_10526507 3300005466 Bacteria 840
57 Ga0070698_100078497 3300005471 Bacteria 3300
58 Ga0068853_100198775 3300005539 Bacteria 1824
59 Ga0070672_100004483 3300005543 Bacteria 9144
60 Ga0070672_100013581 3300005543 Bacteria 5759
61 Ga0070672_100040122 3300005543 Bacteria 3590
62 Ga0070672_100073457 3300005543 Bacteria 2726
63 Ga0070672_100208385 3300005543 Bacteria 1637
64 Ga0070693_100602799 3300005547 Unclassified 793
65 Ga0070665_100128189 3300005548 Bacteria 2540
66 Ga0070665_100262326 3300005548 Bacteria 1729
67 Ga0070664_100349149 3300005564 Bacteria 1345
68 Ga0070664_100938101 3300005564 Bacteria 812
69 Ga0070664_100944877 3300005564 Bacteria 809
70 Ga0068857_100015213 3300005577 Bacteria 6715
71 Ga0068857_100019499 3300005577 Bacteria 5957
72 Ga0068854_100227768 3300005578 Bacteria 1478
73 Ga0068852_100445384 3300005616 Bacteria 1281
74 Ga0068852_100613849 3300005616 Bacteria 1093
75 Ga0068852_100679888 3300005616 Bacteria 1038
76 Ga0068859_100010927 3300005617 Bacteria 9138
77 Ga0068859_100162984 3300005617 Bacteria 2309
78 Ga0068864_100000464 3300005618 Bacteria 35141
79 Ga0068864_100016461 3300005618 Bacteria 6154
80 Ga0068864_100028589 3300005618 Bacteria 4715
81 Ga0068864_100061875 3300005618 Bacteria 3242
82 Ga0068864_100856588 3300005618 Bacteria 896
83 Ga0068864_100862899 3300005618 Bacteria 892
84 Ga0068866_10086047 3300005718 Bacteria 1700
85 Ga0068851_10138698 3300005834 Bacteria 1321
86 Ga0068863_100008475 3300005841 Bacteria 10042
87 Ga0068863_100082845 3300005841 Bacteria 3040
88 Ga0068863_100100171 3300005841 Bacteria 2754
89 Ga0068863_100442618 3300005841 Bacteria 1274
90 Ga0068863_100670492 3300005841 Bacteria 1029
91 Ga0068858_100001151 3300005842 Bacteria 27341
92 Ga0068860_100118720 3300005843 Bacteria 2531
93 Ga0068860_100333799 3300005843 Bacteria 1490
94 Ga0068860_100366267 3300005843 Bacteria 1421
95 Ga0068862_100226181 3300005844 Bacteria 1696
96 Ga0075368_10053674 3300006042 Bacteria 1605
97 Ga0075363_100073724 3300006048 Unclassified 1857
98 Ga0075364_11152987 3300006051 Bacteria 526
99 Ga0075362_10075676 3300006177 Unclassified 1544
100 Ga0075362_10161203 3300006177 Unclassified 1080
101 Ga0075367_10004382 3300006178 Bacteria 6885
102 Ga0075367_10076669 3300006178 Bacteria 2018
103 Ga0075367_10296142 3300006178 Unclassified 1018
104 Ga0075367_10566541 3300006178 Bacteria 721
105 Ga0075369_10078668 3300006186 Bacteria 1460
106 Ga0075366_10001307 3300006195 Bacteria 12421
107 Ga0075366_10008887 3300006195 Bacteria 5597
108 Ga0075366_10014151 3300006195 Bacteria 4553
109 Ga0075366_10022764 3300006195 Bacteria 3648
110 Ga0075366_10131512 3300006195 Bacteria 1510
111 Ga0075366_10143452 3300006195 Bacteria 1444
112 Ga0075366_10144599 3300006195 Bacteria 1438
113 Ga0075366_10235812 3300006195 Bacteria 1115
114 Ga0097621_100024325 3300006237 Bacteria 4728
115 Ga0097621_100055212 3300006237 Bacteria 3243
116 Ga0097621_100561778 3300006237 Bacteria 1040
117 Ga0075370_10000830 3300006353 Bacteria 12470
118 Ga0075370_10002949 3300006353 Bacteria 7996
119 Ga0075370_10008577 3300006353 Bacteria 5267
120 Ga0075370_10009491 3300006353 Bacteria 5056
121 Ga0075370_10085182 3300006353 Bacteria 1819
122 Ga0075370_10132653 3300006353 Bacteria 1454
123 Ga0075370_10149351 3300006353 Bacteria 1369
124 Ga0068871_100037569 3300006358 Bacteria 3863
125 Ga0068871_100061606 3300006358 Bacteria 3065
126 Ga0068865_100043461 3300006881 Bacteria 3071
127 Ga0097620_100010927 3300006931 Bacteria 9138
128 Ga0097620_100162985 3300006931 Bacteria 2309
129 Ga0105240_10315071 3300009093 Bacteria 1785
130 Ga0105245_10011728 3300009098 Bacteria 7626
131 Ga0105245_10071496 3300009098 Bacteria 3150
132 Ga0105245_10150955 3300009098 Bacteria 2197
133 Ga0105245_10679014 3300009098 Unclassified 1062
134 Ga0105247_11501439 3300009101 Unclassified 549
135 Ga0105243_10043069 3300009148 Bacteria 3537
136 Ga0105241_10242198 3300009174 Bacteria 1525
137 Ga0105242_10733960 3300009176 Bacteria 970
138 Ga0105248_10009954 3300009177 Bacteria 10467
139 Ga0105248_10117199 3300009177 Bacteria 3003
140 Ga0105248_10117356 3300009177 Bacteria 3001
141 Ga0105248_10128150 3300009177 Bacteria 2863
142 Ga0105248_10159250 3300009177 Bacteria 2547
143 Ga0105237_10001878 3300009545 Bacteria 26806
144 Ga0105237_10004521 3300009545 Bacteria 16072
145 Ga0105238_12411489 3300009551 Bacteria 562
146 Ga0105249_10900910 3300009553 Bacteria 951
147 Ga0105249_10907557 3300009553 Bacteria 948
148 Ga0105239_10745641 3300010375 Bacteria 1121
149 Ga0157373_10325110 3300013100 Unclassified 1094
150 Ga0157374_10055590 3300013296 Bacteria 3694
151 Ga0157374_10830309 3300013296 Unclassified 941
152 Ga0157374_12149241 3300013296 Unclassified 585
153 Ga0157378_10266317 3300013297 Bacteria 1646
154 Ga0157378_11180287 3300013297 Unclassified 804
155 Ga0163162_10006914 3300013306 Bacteria 10999
156 Ga0163162_10043514 3300013306 Bacteria 4497
157 Ga0163162_10482960 3300013306 Bacteria 1370
158 Ga0157375_10006147 3300013308 Bacteria 10462
159 Ga0157375_10025037 3300013308 Bacteria 5535
160 Ga0157375_10085354 3300013308 Bacteria 3207
161 Ga0157375_10111444 3300013308 Bacteria 2835
162 Ga0157375_10128173 3300013308 Bacteria 2655
163 Ga0157375_10191973 3300013308 Bacteria 2197
164 Ga0157375_10715989 3300013308 Bacteria 1154
165 Ga0157375_10805137 3300013308 Bacteria 1088
166 Ga0157375_11228837 3300013308 Bacteria 879
167 Ga0157375_12055265 3300013308 Unclassified 679
168 Ga0163163_10002467 3300014325 Bacteria 15632
169 Ga0163163_10321521 3300014325 Bacteria 1601
170 Ga0163163_10434215 3300014325 Bacteria 1372
171 Ga0163163_10893225 3300014325 Bacteria 952
172 Ga0163163_11290256 3300014325 Bacteria 792
173 Ga0163163_12368688 3300014325 Bacteria 589
174 Ga0157380_10278267 3300014326 Bacteria 1530
175 Ga0157380_11707410 3300014326 Unclassified 687
176 Ga0157377_11444903 3300014745 Unclassified 544
177 Ga0157379_10002968 3300014968 Bacteria 14312
178 Ga0157379_10144815 3300014968 Bacteria 2142
179 Ga0157379_11104481 3300014968 Bacteria 760
180 Ga0157376_10051436 3300014969 Bacteria 3422
181 Ga0157376_10401563 3300014969 Bacteria 1325
182 Ga0157376_10600974 3300014969 Bacteria 1095
183 Ga0163161_10091163 3300017792 Bacteria 2255
184 Ga0163161_10092132 3300017792 Bacteria 2244
185 Ga0163161_10145802 3300017792 Bacteria 1796
186 Ga0207682_10010704 3300025893 Bacteria 3589
187 Ga0207682_10036608 3300025893 Bacteria 1986
188 Ga0207682_10175094 3300025893 Bacteria 978
189 Ga0207682_10290322 3300025893 Bacteria 766
190 Ga0207680_10002054 3300025903 Bacteria 9430
191 Ga0207680_10609447 3300025903 Bacteria 781
192 Ga0207645_10021304 3300025907 Bacteria 4227
193 Ga0207645_10086413 3300025907 Bacteria 2015
194 Ga0207705_10618240 3300025909 Bacteria 842
195 Ga0207684_10043823 3300025910 Bacteria 3794
196 Ga0207695_10534367 3300025913 Bacteria 1054
197 Ga0207671_10001494 3300025914 Bacteria 26993
198 Ga0207671_10155389 3300025914 Bacteria 1769
199 Ga0207681_10035688 3300025923 Bacteria 3278
200 Ga0207681_10129261 3300025923 Bacteria 1865
201 Ga0207650_10001449 3300025925 Bacteria 17085
202 Ga0207650_10027443 3300025925 Bacteria 4076
203 Ga0207650_10183269 3300025925 Bacteria 1670
204 Ga0207650_11458146 3300025925 Bacteria 582
205 Ga0207659_10018651 3300025926 Bacteria 4551
206 Ga0207659_10175662 3300025926 Bacteria 1693
207 Ga0207659_10370177 3300025926 Bacteria 1193
208 Ga0207659_10488819 3300025926 Bacteria 1041
209 Ga0207659_10645333 3300025926 Bacteria 904
210 Ga0207659_11030563 3300025926 Bacteria 708
211 Ga0207659_11036323 3300025926 Bacteria 706
212 Ga0207687_10047287 3300025927 Bacteria 2982
213 Ga0207687_10111196 3300025927 Bacteria 2033
214 Ga0207687_10210722 3300025927 Bacteria 1524
215 Ga0207687_10655268 3300025927 Unclassified 888
216 Ga0207644_10006232 3300025931 Bacteria 7776
217 Ga0207644_10014080 3300025931 Bacteria 5349
218 Ga0207706_10031917 3300025933 Bacteria 4692
219 Ga0207706_10145875 3300025933 Bacteria 2082
220 Ga0207706_11034442 3300025933 Bacteria 689
221 Ga0207670_10160262 3300025936 Bacteria 1679
222 Ga0207669_10081867 3300025937 Bacteria 2070
223 Ga0207669_10090522 3300025937 Bacteria 1990
224 Ga0207669_10178518 3300025937 Bacteria 1520
225 Ga0207704_10144867 3300025938 Bacteria 1667
226 Ga0207691_10002029 3300025940 Bacteria 19814
227 Ga0207691_10009318 3300025940 Bacteria 9423
228 Ga0207691_10029989 3300025940 Bacteria 5086
229 Ga0207691_10107030 3300025940 Bacteria 2490
230 Ga0207691_10132737 3300025940 Bacteria 2198
231 Ga0207711_10008052 3300025941 Bacteria 8822
232 Ga0207711_10010966 3300025941 Bacteria 7528
233 Ga0207711_10027864 3300025941 Bacteria 4748
234 Ga0207711_10045756 3300025941 Bacteria 3740
235 Ga0207711_10047418 3300025941 Bacteria 3673
236 Ga0207711_10344957 3300025941 Unclassified 1378
237 Ga0207689_10009366 3300025942 Bacteria 8462
238 Ga0207689_10203607 3300025942 Bacteria 1634
239 Ga0207679_10286729 3300025945 Bacteria 1414
240 Ga0207679_10593933 3300025945 Bacteria 997
241 Ga0207651_10007161 3300025960 Bacteria 5927
242 Ga0207651_10021604 3300025960 Bacteria 3915
243 Ga0207651_10022558 3300025960 Bacteria 3852
244 Ga0207651_10029491 3300025960 Bacteria 3477
245 Ga0207651_10079677 3300025960 Bacteria 2354
246 Ga0207651_10681404 3300025960 Bacteria 904
247 Ga0207658_10007319 3300025986 Bacteria 7529
248 Ga0207658_10046121 3300025986 Bacteria 3181
249 Ga0207677_10000685 3300026023 Bacteria 20041
250 Ga0207677_10348431 3300026023 Bacteria 1240
251 Ga0207677_10505924 3300026023 Bacteria 1045
252 Ga0207703_10000731 3300026035 Bacteria 32297
253 Ga0207639_10353357 3300026041 Bacteria 1313
254 Ga0207678_10237153 3300026067 Bacteria 1562
255 Ga0207641_10017362 3300026088 Bacteria 5891
256 Ga0207641_10172927 3300026088 Bacteria 1973
257 Ga0207641_10242594 3300026088 Bacteria 1680
258 Ga0207641_10311802 3300026088 Bacteria 1489
259 Ga0207641_10648919 3300026088 Bacteria 1036
260 Ga0207648_10003715 3300026089 Bacteria 15980
261 Ga0207648_10145704 3300026089 Bacteria 2089
262 Ga0207648_10429398 3300026089 Bacteria 1201
263 Ga0207676_10002137 3300026095 Bacteria 14293
264 Ga0207676_10004351 3300026095 Bacteria 10014
265 Ga0207676_10123750 3300026095 Bacteria 2186
266 Ga0207676_10351333 3300026095 Bacteria 1363
267 Ga0207676_10388168 3300026095 Bacteria 1301
268 Ga0207676_10748315 3300026095 Bacteria 950
269 Ga0207674_10012009 3300026116 Bacteria 9704
270 Ga0207674_10016548 3300026116 Bacteria 8068
271 Ga0207675_100244555 3300026118 Bacteria 1734
272 Ga0207683_10004194 3300026121 Bacteria 12465
273 Ga0207683_10081553 3300026121 Bacteria 2871
274 Ga0207683_10110232 3300026121 Bacteria 2464
275 Ga0207683_10640511 3300026121 Bacteria 984
276 Ga0207698_10051856 3300026142 Bacteria 3139
277 Ga0207698_10508194 3300026142 Bacteria 1174
278 Ga0207698_10835169 3300026142 Unclassified 925
279 Ga0207698_11876210 3300026142 Bacteria 614
280 Ga0207698_12018089 3300026142 Unclassified 591
281 Ga0209813_10288548 3300027866 Unclassified 634
282 Ga0268266_10264770 3300028379 Bacteria 1594
283 Ga0268266_10488230 3300028379 Bacteria 1175
284 Ga0268266_11253628 3300028379 Bacteria 717
285 Ga0268265_10165409 3300028380 Bacteria 1885
286 Ga0268265_11337662 3300028380 Bacteria 717
287 Ga0268264_10204026 3300028381 Bacteria 1810
288 Ga0268264_11166147 3300028381 Bacteria 779
289 Ga0307515_10021071 3300028794 Bacteria 11579
290 Ga0265330_10207798 3300031235 Bacteria 827
291 Ga0307513_10300496 3300031456 Bacteria 1372
292 Ga0307509_10000977 3300031507 Bacteria 48971
293 Ga0307509_10348970 3300031507 Bacteria 1204
294 Ga0307509_10673153 3300031507 Bacteria 702
295 Ga0307408_100000722 3300031548 Bacteria 26763
296 Ga0307408_101060325 3300031548 Bacteria 750
297 Ga0307508_10000376 3300031616 Bacteria 53995
298 Ga0307508_10018853 3300031616 Bacteria 6269
299 Ga0307516_10008724 3300031730 Bacteria 11402
300 Ga0307410_11431632 3300031852 Bacteria 607
301 Ga0307406_10002169 3300031901 Bacteria 10687
302 Ga0307416_101375669 3300032002 Bacteria 812
303 Ga0307414_10008497 3300032004 Bacteria 5827
304 Ga0307414_10115724 3300032004 Bacteria 2051
305 Ga0307411_10128998 3300032005 Bacteria 1845
306 Ga0307411_10182139 3300032005 Bacteria 1595
307 Ga0307411_10840457 3300032005 Bacteria 811
308 Ga0307507_10033653 3300033179 Bacteria 5316
309 Ga0307510_10409446 3300033180 Bacteria 798
310 Ga0373928_0012935 3300035084 Bacteria 1671
311 Ga0373944_0203245 3300035089 Bacteria 718
312 Ga0373932_0061326 3300035112 Bacteria 1143
313 Ga0373939_0143713 3300035114 Unclassified 862
314 Ga0373943_0196458 3300035170 Bacteria 1115
315 Ga0373946_0788048 3300035171 Bacteria 500
316 Ga0373955_0033640 3300035172 Bacteria 2701
317 Ga0373931_0152911 3300035691 Bacteria 1346
318 Ga0373935_0296802 3300035692 Bacteria 1141
319 Ga0373933_0063725 3300035724 Bacteria 2229
320 Ga0373947_0079732 3300035725 Bacteria 2024
321 Ga0373947_0505020 3300035725 Unclassified 822
322 Ga0373925_0545913 3300037068 Bacteria 953
323 Ga0395905_0052227 3300037471 Bacteria 3826
324 Ga0439461_0202641 3300041410 Unclassified 534
325 Ga0451789_0889052 3300041443 Bacteria 1931
326 Ga0451795_1139116 3300041456 Unclassified 556
327 Ga0451798_0369538 3300041458 Unclassified 722
328 Ga0451798_0783516 3300041458 Bacteria 2459
329 Ga0451800_0784518 3300041459 Bacteria 1490
330 Ga0451807_0125324 3300041486 Bacteria 796
331 Ga0451835_0860117 3300041492 Bacteria 806
332 Ga0451839_0691471 3300041496 Bacteria 683
333 Ga0451845_0950761 3300041501 Bacteria 1771
334 Ga0451849_1380662 3300041505 Bacteria 2718
335 Ga0451843_0141413 3300041509 Bacteria 1180
336 Ga0451853_1904224 3300041512 Bacteria 2345
337 Ga0451853_2066232 3300041512 Unclassified 502
338 Ga0439443_074042 3300042003 Bacteria 625
339 Ga0450917_001915 3300042120 Bacteria 1481
340 Ga0450888_000226 3300042126 Bacteria 5108
341 Ga0450890_004768 3300042127 Bacteria 1762
342 Ga0450891_000237 3300042129 Bacteria 5575
343 Ga0450892_002913 3300042130 Bacteria 1427
344 Ga0450889_001264 3300042144 Bacteria 2629
345 Ga0439459_0089147 3300042438 Bacteria 739
346 Ga0439460_0211417 3300042461 Bacteria 663
347 Ga0450916_003970 3300042530 Bacteria 1649
348 Ga0450893_0000003 3300042532 Bacteria 31469
349 Ga0451577_0003374 3300042876 Bacteria 17871
350 Ga0453684_0383467 3300044712 Bacteria 1578
351 Ga0495592_0392599 3300046454 Unclassified 881
352 Ga0495629_0171503 3300046459 Bacteria 1505
353 Ga0495580_0159592 3300046472 Bacteria 1561
354 Ga0495662_0428159 3300046476 Unclassified 649
355 Ga0495610_0022818 3300046512 Bacteria 3414
356 Ga0495620_0081036 3300046515 Bacteria 1313
357 Ga0495628_0166467 3300046516 Bacteria 1673
358 Ga0495632_0019986 3300046519 Bacteria 3637
359 Ga0495643_0112825 3300046522 Bacteria 1380
360 Ga0495648_0292181 3300046524 Bacteria 767
361 Ga0495652_0302699 3300046529 Bacteria 1162
362 Ga0495586_0204413 3300046535 Bacteria 1120
363 Ga0495598_0050456 3300046537 Bacteria 1251
364 Ga0495621_0001986 3300046539 Bacteria 5381
365 Ga0495621_0126939 3300046539 Bacteria 990
366 Ga0495621_0238184 3300046539 Unclassified 741
367 Ga0495633_0042795 3300046558 Bacteria 2150
368 Ga0495668_0039761 3300046616 Bacteria 2626
369 Ga0495625_0001579 3300046660 Bacteria 27104
370 Ga0495635_0174358 3300046663 Bacteria 1462
371 Ga0495646_0652962 3300046680 Unclassified 531
372 Ga0495658_0008197 3300046683 Bacteria 5177
373 Ga0495658_0029288 3300046683 Bacteria 2979
374 Ga0495658_0040981 3300046683 Bacteria 2577
375 Ga0495658_0101667 3300046683 Bacteria 1717
376 Ga0495613_0015390 3300046689 Bacteria 5688
377 Ga0495604_0521077 3300047317 Bacteria 769
378 Ga0495680_0199184 3300047322 Bacteria 1437
379 Ga0495686_0187599 3300047472 Bacteria 1194
380 Ga0496104_0058593 3300048907 Bacteria 3646
381 Ga0496104_1626592 3300048907 Unclassified 548
382 Ga0496105_0906245 3300048908 Unclassified 664
383 Ga0496108_0031753 3300048911 Bacteria 4384
384 Ga0496109_0262409 3300048912 Bacteria 1627
385 Ga0496112_0110765 3300048915 Unclassified 2715
386 Ga0496113_0067810 3300048916 Bacteria 2706
387 Ga0496113_0139460 3300048916 Bacteria 1907
388 Ga0496114_0106048 3300048917 Bacteria 2404
389 Ga0496114_0757648 3300048917 Bacteria 848
390 Ga0501305_077388 3300049161 Unclassified 593
391 Ga0501291_098150 3300049514 Bacteria 608
392 Ga0501298_071009 3300049521 Bacteria 752
393 Ga0501300_001525 3300049523 Bacteria 3480
394 Ga0501222_002827 3300049662 Bacteria 2400
395 Ga0501223_029769 3300049663 Bacteria 1062
396 Ga0501235_001942 3300049669 Bacteria 4420
397 Ga0501242_012987 3300049674 Bacteria 1019
398 Ga0501229_015005 3300049706 Bacteria 1001
399 Ga0501265_011292 3300049762 Bacteria 1101
400 Ga0501267_000781 3300049764 Bacteria 2575
401 Ga0501270_047393 3300049767 Bacteria 768
402 Ga0501272_002521 3300049769 Bacteria 1817
403 Ga0501272_013925 3300049769 Bacteria 925
404 nmdc:mga03683_208731_c1 3300050489 Bacteria 898
405 nmdc:mga00v17_1000938_c1 3300050491 Bacteria 526
406 nmdc:mga0k408_10605_c1 3300050493 Bacteria 4989
407 nmdc:mga0k408_205778_c1 3300050493 Bacteria 1175
408 nmdc:mga0k408_210164_c1 3300050493 Bacteria 1162
409 nmdc:mga0k408_21706_c1 3300050493 Bacteria 3609
410 nmdc:mga0k408_24976_c1 3300050493 Bacteria 3381
411 nmdc:mga0k408_40710_c1 3300050493 Bacteria 2675
412 nmdc:mga06z11_167931_c1 3300050494 Bacteria 1258
413 nmdc:mga06z11_45850_c1 3300050494 Bacteria 2212
414 nmdc:mga04h51_322604_c1 3300050495 Unclassified 633
415 nmdc:mga04h51_420866_c1 3300050495 Bacteria 562
416 nmdc:mga07m45_20828_c1 3300050496 Bacteria 3565
417 nmdc:mga07m45_262019_c1 3300050496 Unclassified 1006
418 nmdc:mga07m45_366740_c1 3300050496 Bacteria 837
419 nmdc:mga07m45_37566_c1 3300050496 Bacteria 2701
420 nmdc:mga07m45_7255_c1 3300050496 Bacteria 5653
421 nmdc:mga07m45_8829_c1 3300050496 Bacteria 5199
422 nmdc:mga0sz30_22242_c2 3300050516 Unclassified 1729
423 Ga0495601_0018336 3300053077 Bacteria 4258
424 Ga0500587_002316 3300053739 Bacteria 2709
425 Ga0500661_042708 3300055283 Unclassified 804
426 2587736350 2585428058 Bacteria 6853932
427 2587759236 2585428062 Bacteria 6842168
428 2643746231 2643221544 Bacteria 5886209
429 Ga0070673_100806322
430 rootH1_10113351
431 Ga0070676_11051147
432 Ga0070670_100027744
433 Ga0070670_100138919
434 Ga0070670_100159148
435 Ga0070677_10015973
436 Ga0070677_10039470
437 Ga0070677_10039899
438 Ga0068869_100035191
439 Ga0068869_100195734
440 Ga0070666_10002951
441 Ga0068868_100001055
442 Ga0068868_100087235
443 Ga0068868_101195506
444 Ga0070689_100145273
445 Ga0070689_101018093
446 Ga0070687_100772811
447 Ga0070687_100904158
448 Ga0070668_100687890
449 Ga0070669_100101538
450 Ga0070669_100107979
451 Ga0070675_100001438
452 Ga0070675_100046793
453 Ga0070675_100168101
454 Ga0070675_100176623
455 Ga0070675_100389413
456 Ga0070675_100393700
457 Ga0070675_101918187
458 Ga0070671_100006259
459 Ga0070671_100017985
460 Ga0070671_100066240
461 Ga0070671_100307427
462 Ga0070674_100053237
463 Ga0070674_100272947
464 Ga0070673_100007023
465 Ga0070673_100010730
466 Ga0070673_100011051
467 Ga0070673_100148672
468 Ga0070673_100195666
469 Ga0070673_100798732
470 Ga0070673_100815895
471 Ga0070688_100004207
472 Ga0070667_100003925
473 Ga0070667_100110529
474 Ga0070678_100058414
475 Ga0070678_100299596
476 Ga0070678_100398342
477 Ga0070678_100566356
478 Ga0070662_100024922
479 Ga0070662_100069194
480 Ga0068867_100035207
481 Ga0068867_100099203
482 Ga0068867_100386842
483 Ga0068867_101508235
484 Ga0070685_10526507
485 Ga0070698_100078497
486 Ga0068853_100198775
487 Ga0070672_100004483
488 Ga0070672_100013581
489 Ga0070672_100040122
490 Ga0070672_100073457
491 Ga0070672_100208385
492 Ga0070693_100602799
493 Ga0070665_100128189
494 Ga0070665_100262326
495 Ga0070664_100349149
496 Ga0070664_100938101
497 Ga0070664_100944877
498 Ga0068857_100015213
499 Ga0068857_100019499
500 Ga0068854_100227768
501 Ga0068852_100445384
502 Ga0068852_100613849
503 Ga0068852_100679888
504 Ga0068859_100010927
505 Ga0068859_100162984
506 Ga0068864_100000464
507 Ga0068864_100016461
508 Ga0068864_100028589
509 Ga0068864_100061875
510 Ga0068864_100856588
511 Ga0068864_100862899
512 Ga0068866_10086047
513 Ga0068851_10138698
514 Ga0068863_100008475
515 Ga0068863_100082845
516 Ga0068863_100100171
517 Ga0068863_100442618
518 Ga0068863_100670492
519 Ga0068858_100001151
520 Ga0068860_100118720
521 Ga0068860_100333799
522 Ga0068860_100366267
523 Ga0068862_100226181
524 Ga0075368_10053674
525 Ga0075363_100073724
526 Ga0075364_11152987
527 Ga0075362_10075676
528 Ga0075362_10161203
529 Ga0075367_10004382
530 Ga0075367_10076669
531 Ga0075367_10296142
532 Ga0075367_10566541
533 Ga0075369_10078668
534 Ga0075366_10001307
535 Ga0075366_10008887
536 Ga0075366_10014151
537 Ga0075366_10022764
538 Ga0075366_10131512
539 Ga0075366_10143452
540 Ga0075366_10144599
541 Ga0075366_10235812
542 Ga0097621_100024325
543 Ga0097621_100055212
544 Ga0097621_100561778
545 Ga0075370_10000830
546 Ga0075370_10002949
547 Ga0075370_10008577
548 Ga0075370_10009491
549 Ga0075370_10085182
550 Ga0075370_10132653
551 Ga0075370_10149351
552 Ga0068871_100037569
553 Ga0068871_100061606
554 Ga0068865_100043461
555 Ga0097620_100010927
556 Ga0097620_100162985
557 Ga0105240_10315071
558 Ga0105245_10011728
559 Ga0105245_10071496
560 Ga0105245_10150955
561 Ga0105245_10679014
562 Ga0105247_11501439
563 Ga0105243_10043069
564 Ga0105241_10242198
565 Ga0105242_10733960
566 Ga0105248_10009954
567 Ga0105248_10117199
568 Ga0105248_10117356
569 Ga0105248_10128150
570 Ga0105248_10159250
571 Ga0105237_10001878
572 Ga0105237_10004521
573 Ga0105238_12411489
574 Ga0105249_10900910
575 Ga0105249_10907557
576 Ga0105239_10745641
577 Ga0157373_10325110
578 Ga0157374_10055590
579 Ga0157374_10830309
580 Ga0157374_12149241
581 Ga0157378_10266317
582 Ga0157378_11180287
583 Ga0163162_10006914
584 Ga0163162_10043514
585 Ga0163162_10482960
586 Ga0157375_10006147
587 Ga0157375_10025037
588 Ga0157375_10085354
589 Ga0157375_10111444
590 Ga0157375_10128173
591 Ga0157375_10191973
592 Ga0157375_10715989
593 Ga0157375_10805137
594 Ga0157375_11228837
595 Ga0157375_12055265
596 Ga0163163_10002467
597 Ga0163163_10321521
598 Ga0163163_10434215
599 Ga0163163_10893225
600 Ga0163163_11290256
601 Ga0163163_12368688
602 Ga0157380_10278267
603 Ga0157380_11707410
604 Ga0157377_11444903
605 Ga0157379_10002968
606 Ga0157379_10144815
607 Ga0157379_11104481
608 Ga0157376_10051436
609 Ga0157376_10401563
610 Ga0157376_10600974
611 Ga0163161_10091163
612 Ga0163161_10092132
613 Ga0163161_10145802
614 Ga0207682_10010704
615 Ga0207682_10036608
616 Ga0207682_10175094
617 Ga0207682_10290322
618 Ga0207680_10002054
619 Ga0207680_10609447
620 Ga0207645_10021304
621 Ga0207645_10086413
622 Ga0207705_10618240
623 Ga0207684_10043823
624 Ga0207695_10534367
625 Ga0207671_10001494
626 Ga0207671_10155389
627 Ga0207681_10035688
628 Ga0207681_10129261
629 Ga0207650_10001449
630 Ga0207650_10027443
631 Ga0207650_10183269
632 Ga0207650_11458146
633 Ga0207659_10018651
634 Ga0207659_10175662
635 Ga0207659_10370177
636 Ga0207659_10488819
637 Ga0207659_10645333
638 Ga0207659_11030563
639 Ga0207659_11036323
640 Ga0207687_10047287
641 Ga0207687_10111196
642 Ga0207687_10210722
643 Ga0207687_10655268
644 Ga0207644_10006232
645 Ga0207644_10014080
646 Ga0207706_10031917
647 Ga0207706_10145875
648 Ga0207706_11034442
649 Ga0207670_10160262
650 Ga0207669_10081867
651 Ga0207669_10090522
652 Ga0207669_10178518
653 Ga0207704_10144867
654 Ga0207691_10002029
655 Ga0207691_10009318
656 Ga0207691_10029989
657 Ga0207691_10107030
658 Ga0207691_10132737
659 Ga0207711_10008052
660 Ga0207711_10010966
661 Ga0207711_10027864
662 Ga0207711_10045756
663 Ga0207711_10047418
664 Ga0207711_10344957
665 Ga0207689_10009366
666 Ga0207689_10203607
667 Ga0207679_10286729
668 Ga0207679_10593933
669 Ga0207651_10007161
670 Ga0207651_10021604
671 Ga0207651_10022558
672 Ga0207651_10029491
673 Ga0207651_10079677
674 Ga0207651_10681404
675 Ga0207658_10007319
676 Ga0207658_10046121
677 Ga0207677_10000685
678 Ga0207677_10348431
679 Ga0207677_10505924
680 Ga0207703_10000731
681 Ga0207639_10353357
682 Ga0207678_10237153
683 Ga0207641_10017362
684 Ga0207641_10172927
685 Ga0207641_10242594
686 Ga0207641_10311802
687 Ga0207641_10648919
688 Ga0207648_10003715
689 Ga0207648_10145704
690 Ga0207648_10429398
691 Ga0207676_10002137
692 Ga0207676_10004351
693 Ga0207676_10123750
694 Ga0207676_10351333
695 Ga0207676_10388168
696 Ga0207676_10748315
697 Ga0207674_10012009
698 Ga0207674_10016548
699 Ga0207675_100244555
700 Ga0207683_10004194
701 Ga0207683_10081553
702 Ga0207683_10110232
703 Ga0207683_10640511
704 Ga0207698_10051856
705 Ga0207698_10508194
706 Ga0207698_10835169
707 Ga0207698_11876210
708 Ga0207698_12018089
709 Ga0209813_10288548
710 Ga0268266_10264770
711 Ga0268266_10488230
712 Ga0268266_11253628
713 Ga0268265_10165409
714 Ga0268265_11337662
715 Ga0268264_10204026
716 Ga0268264_11166147
717 Ga0307515_10021071
718 Ga0265330_10207798
719 Ga0307513_10300496
720 Ga0307509_10000977
721 Ga0307509_10348970
722 Ga0307509_10673153
723 Ga0307408_100000722
724 Ga0307408_101060325
725 Ga0307508_10000376
726 Ga0307508_10018853
727 Ga0307516_10008724
728 Ga0307410_11431632
729 Ga0307406_10002169
730 Ga0307416_101375669
731 Ga0307414_10008497
732 Ga0307414_10115724
733 Ga0307411_10128998
734 Ga0307411_10182139
735 Ga0307411_10840457
736 Ga0307507_10033653
737 Ga0307510_10409446
738 Ga0373928_0012935
739 Ga0373944_0203245
740 Ga0373932_0061326
741 Ga0373939_0143713
742 Ga0373943_0196458
743 Ga0373946_0788048
744 Ga0373955_0033640
745 Ga0373931_0152911
746 Ga0373935_0296802
747 Ga0373933_0063725
748 Ga0373947_0079732
749 Ga0373947_0505020
750 Ga0373925_0545913
751 Ga0395905_0052227
752 Ga0439461_0202641
753 Ga0451789_0889052
754 Ga0451795_1139116
755 Ga0451798_0369538
756 Ga0451798_0783516
757 Ga0451800_0784518
758 Ga0451807_0125324
759 Ga0451835_0860117
760 Ga0451839_0691471
761 Ga0451845_0950761
762 Ga0451849_1380662
763 Ga0451843_0141413
764 Ga0451853_1904224
765 Ga0451853_2066232
766 Ga0439443_074042
767 Ga0450917_001915
768 Ga0450888_000226
769 Ga0450890_004768
770 Ga0450891_000237
771 Ga0450892_002913
772 Ga0450889_001264
773 Ga0439459_0089147
774 Ga0439460_0211417
775 Ga0450916_003970
776 Ga0450893_0000003
777 Ga0451577_0003374
778 Ga0453684_0383467
779 Ga0495592_0392599
780 Ga0495629_0171503
781 Ga0495580_0159592
782 Ga0495662_0428159
783 Ga0495610_0022818
784 Ga0495620_0081036
785 Ga0495628_0166467
786 Ga0495632_0019986
787 Ga0495643_0112825
788 Ga0495648_0292181
789 Ga0495652_0302699
790 Ga0495586_0204413
791 Ga0495598_0050456
792 Ga0495621_0001986
793 Ga0495621_0126939
794 Ga0495621_0238184
795 Ga0495633_0042795
796 Ga0495668_0039761
797 Ga0495625_0001579
798 Ga0495635_0174358
799 Ga0495646_0652962
800 Ga0495658_0008197
801 Ga0495658_0029288
802 Ga0495658_0040981
803 Ga0495658_0101667
804 Ga0495613_0015390
805 Ga0495604_0521077
806 Ga0495680_0199184
807 Ga0495686_0187599
808 Ga0496104_0058593
809 Ga0496104_1626592
810 Ga0496105_0906245
811 Ga0496108_0031753
812 Ga0496109_0262409
813 Ga0496112_0110765
814 Ga0496113_0067810
815 Ga0496113_0139460
816 Ga0496114_0106048
817 Ga0496114_0757648
818 Ga0501305_077388
819 Ga0501291_098150
820 Ga0501298_071009
821 Ga0501300_001525
822 Ga0501222_002827
823 Ga0501223_029769
824 Ga0501235_001942
825 Ga0501242_012987
826 Ga0501229_015005
827 Ga0501265_011292
828 Ga0501267_000781
829 Ga0501270_047393
830 Ga0501272_002521
831 Ga0501272_013925
832 nmdc:mga03683_208731_c1
833 nmdc:mga00v17_1000938_c1
834 nmdc:mga0k408_10605_c1
835 nmdc:mga0k408_205778_c1
836 nmdc:mga0k408_210164_c1
837 nmdc:mga0k408_21706_c1
838 nmdc:mga0k408_24976_c1
839 nmdc:mga0k408_40710_c1
840 nmdc:mga06z11_167931_c1
841 nmdc:mga06z11_45850_c1
842 nmdc:mga04h51_322604_c1
843 nmdc:mga04h51_420866_c1
844 nmdc:mga07m45_20828_c1
845 nmdc:mga07m45_262019_c1
846 nmdc:mga07m45_366740_c1
847 nmdc:mga07m45_37566_c1
848 nmdc:mga07m45_7255_c1
849 nmdc:mga07m45_8829_c1
850 nmdc:mga0sz30_22242_c2
851 Ga0495601_0018336
852 Ga0500587_002316
853 Ga0500661_042708
854 2587736350
855 2587759236
856 2643746231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04247

SirB

Invasion gene expression up-regulator, SirB

3

123

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mrc-assembly1.cif.gz_NN structure of the yeast mitochondrial ribosome - class a 0.7941 71 108
4yuu-assembly3.cif.gz_Q2 crystal structure of oxygen-evolving photosystem ii from a red alga 0.5912 10 116
4yuu-assembly2.cif.gz_q1 crystal structure of oxygen-evolving photosystem ii from a red alga 0.5911 10 116
4yuu-assembly2.cif.gz_q1 crystal structure of oxygen-evolving photosystem ii from a red alga 0.562 10 116
4yuu-assembly3.cif.gz_Q2 crystal structure of oxygen-evolving photosystem ii from a red alga 0.5356 10 116
ID Description Score Start End Superfamily
af_Q46755_4_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9505 5 122 1.20.120.550
af_Q46755_4_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8992 5 122 1.20.120.550
af_G5EGK1_517_686_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.645 3 116 1.20.1420.10
af_E7FDH3_673_793_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6295 9 121 1.20.120.230
af_A0A0R4IDZ8_1844_1969_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.617 1 111 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A8A7VFR1-F1-model_v4 deleted 0.9853 1 128
AF-A0A2M6XVJ7-F1-model_v4 Regulator SirB 0.9826 2 122 GO:0005886
AF-A0A6L3EQB5-F1-model_v4 Regulator SirB 0.9801 1 122 GO:0005886
AF-B3PJ86-F1-model_v4 Putative membrane protein 0.98 2 128 GO:0005886
AF-A0A4P5UEL8-F1-model_v4 Siroheme synthase 0.9784 1 123 GO:0005886

Map