F441545

General Info

Members Datasets Scaffolds Average Seq Length
427 231 425 216

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0044394|Ga0501038_0044394_460_1167
Length 235
Sequence VGEGRREFRYESVSALQWDTIMTLTFYYGSGSPYAWKVWLALEHKGLPYEAKRLMFDPDQTKTPDYLKINPRGRVPAIVDGDFPLYESNAIVEYLEDRYPEKPLLPKDAKARALARRLMAEADSYLGTIGGELMDATLYTKAEERDPKKIAELKAKVGEELKRWEANLTGDYFAGALGLADYATYPWARMLVRAEERGPGLGFKREELPPKLAAWLKRIEALPYYDKTVPPHWRS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
3 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 4.45
Rhizosphere 93.44
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8558565 2162886012 Bacteria 1078
2 JGI24034J26672_10030228 3300002239 Bacteria 879
3 rootL2_10145446 3300003322 Bacteria 2585
4 JGI25404J52841_10001695 3300003659 Bacteria 3967
5 Ga0065715_10124124 3300005293 Bacteria 2157
6 Ga0065715_10301983 3300005293 Bacteria 1039
7 Ga0070658_10028337 3300005327 Bacteria 4494
8 Ga0070658_10098271 3300005327 Bacteria 2418
9 Ga0070683_100407092 3300005329 Bacteria 1297
10 Ga0070690_100007631 3300005330 Bacteria 6196
11 Ga0070690_100404795 3300005330 Bacteria 1003
12 Ga0070670_100365523 3300005331 Bacteria 1269
13 Ga0070670_100435019 3300005331 Unclassified 1161
14 Ga0070677_10197697 3300005333 Bacteria 968
15 Ga0068869_100021892 3300005334 Bacteria 4399
16 Ga0068869_100062217 3300005334 Bacteria 2739
17 Ga0068869_100271403 3300005334 Bacteria 1361
18 Ga0070666_10259898 3300005335 Bacteria 1231
19 Ga0070680_100002368 3300005336 Bacteria 13929
20 Ga0070680_100164852 3300005336 Bacteria 1863
21 Ga0068868_100095044 3300005338 Bacteria 2405
22 Ga0068868_100095063 3300005338 Bacteria 2405
23 Ga0070660_100217597 3300005339 Bacteria 1552
24 Ga0070689_100012055 3300005340 Bacteria 6214
25 Ga0070689_100232763 3300005340 Bacteria 1515
26 Ga0070691_10006388 3300005341 Bacteria 5388
27 Ga0070661_100549735 3300005344 Unclassified 929
28 Ga0070668_100001234 3300005347 Bacteria 18213
29 Ga0070668_100276766 3300005347 Bacteria 1400
30 Ga0070669_100116981 3300005353 Unclassified 2029
31 Ga0070669_100418706 3300005353 Unclassified 1099
32 Ga0070671_100161842 3300005355 Bacteria 1892
33 Ga0070674_100013942 3300005356 Bacteria 4983
34 Ga0070674_100014133 3300005356 Bacteria 4957
35 Ga0070674_100104872 3300005356 Bacteria 2066
36 Ga0070674_100208070 3300005356 Bacteria 1515
37 Ga0070674_100350912 3300005356 Bacteria 1192
38 Ga0070674_100417879 3300005356 Unclassified 1099
39 Ga0070674_100442780 3300005356 Bacteria 1071
40 Ga0070673_100015599 3300005364 Bacteria 5343
41 Ga0070673_100369090 3300005364 Bacteria 1277
42 Ga0070688_100070220 3300005365 Bacteria 2239
43 Ga0070688_100074500 3300005365 Bacteria 2180
44 Ga0070659_100113199 3300005366 Bacteria 2192
45 Ga0070667_100380019 3300005367 Bacteria 1283
46 Ga0070710_10136497 3300005437 Bacteria 1500
47 Ga0070701_10124593 3300005438 Bacteria 1456
48 Ga0070701_10276442 3300005438 Unclassified 1024
49 Ga0070701_10354080 3300005438 Unclassified 918
50 Ga0070705_100331099 3300005440 Unclassified 1103
51 Ga0070700_100046178 3300005441 Bacteria 2690
52 Ga0070694_100085108 3300005444 Bacteria 2207
53 Ga0070708_100000323 3300005445 Bacteria 36020
54 Ga0070708_100246388 3300005445 Bacteria 1678
55 Ga0070663_100194905 3300005455 Bacteria 1578
56 Ga0070663_100318808 3300005455 Bacteria 1249
57 Ga0070678_100001798 3300005456 Bacteria 11554
58 Ga0070678_100261938 3300005456 Bacteria 1454
59 Ga0070678_100554200 3300005456 Unclassified 1021
60 Ga0070662_100293074 3300005457 Bacteria 1319
61 Ga0070662_100749881 3300005457 Unclassified 828
62 Ga0070681_10000602 3300005458 Bacteria 29598
63 Ga0070681_10018251 3300005458 Bacteria 7011
64 Ga0070681_10132978 3300005458 Bacteria 2419
65 Ga0070681_10345498 3300005458 Bacteria 1398
66 Ga0068867_100059597 3300005459 Bacteria 2829
67 Ga0068867_100526580 3300005459 Unclassified 1020
68 Ga0068867_100549567 3300005459 Unclassified 1000
69 Ga0068867_100597392 3300005459 Unclassified 962
70 Ga0070685_10048251 3300005466 Bacteria 2452
71 Ga0070685_10296427 3300005466 Bacteria 1088
72 Ga0070698_100192530 3300005471 Bacteria 1976
73 Ga0070699_100283134 3300005518 Bacteria 1485
74 Ga0070679_100005262 3300005530 Bacteria 11976
75 Ga0070679_100075892 3300005530 Bacteria 3351
76 Ga0070672_100046028 3300005543 Bacteria 3379
77 Ga0070672_100162353 3300005543 Bacteria 1854
78 Ga0070686_100065350 3300005544 Bacteria 2363
79 Ga0070693_100207648 3300005547 Bacteria 1276
80 Ga0070693_100233643 3300005547 Unclassified 1211
81 Ga0070665_100135367 3300005548 Bacteria 2466
82 Ga0070704_100026779 3300005549 Bacteria 3815
83 Ga0070704_100543240 3300005549 Bacteria 1014
84 Ga0068855_100049973 3300005563 Bacteria 4929
85 Ga0068855_100077118 3300005563 Bacteria 3867
86 Ga0070664_100084932 3300005564 Bacteria 2733
87 Ga0070664_100089726 3300005564 Bacteria 2660
88 Ga0068857_100059912 3300005577 Bacteria 3382
89 Ga0068857_100710783 3300005577 Bacteria 955
90 Ga0068854_100070564 3300005578 Bacteria 2553
91 Ga0068852_100008091 3300005616 Bacteria 7715
92 Ga0068852_100301457 3300005616 Bacteria 1551
93 Ga0068852_100599915 3300005616 Bacteria 1105
94 Ga0068852_100661139 3300005616 Bacteria 1053
95 Ga0068852_100995577 3300005616 Unclassified 857
96 Ga0068852_101111119 3300005616 Unclassified 811
97 Ga0068859_100048051 3300005617 Bacteria 4287
98 Ga0068859_100267811 3300005617 Bacteria 1800
99 Ga0068859_100285558 3300005617 Bacteria 1743
100 Ga0068859_100335636 3300005617 Bacteria 1606
101 Ga0068859_100446660 3300005617 Bacteria 1389
102 Ga0068859_100491938 3300005617 Unclassified 1322
103 Ga0068864_100069106 3300005618 Bacteria 3071
104 Ga0068864_100082909 3300005618 Bacteria 2815
105 Ga0068866_10606716 3300005718 Unclassified 740
106 Ga0068861_100073550 3300005719 Bacteria 2655
107 Ga0068861_100226536 3300005719 Unclassified 1583
108 Ga0068861_100274509 3300005719 Bacteria 1449
109 Ga0068861_101265956 3300005719 Bacteria 716
110 Ga0068851_10051433 3300005834 Bacteria 2094
111 Ga0068870_10002667 3300005840 Bacteria 7474
112 Ga0068863_100177975 3300005841 Bacteria 2041
113 Ga0068863_100322388 3300005841 Bacteria 1501
114 Ga0068863_100352453 3300005841 Bacteria 1433
115 Ga0068863_100375894 3300005841 Bacteria 1387
116 Ga0068863_100606224 3300005841 Bacteria 1084
117 Ga0068858_100043387 3300005842 Bacteria 4170
118 Ga0068858_100111109 3300005842 Bacteria 2559
119 Ga0068858_100153990 3300005842 Bacteria 2162
120 Ga0068860_100186050 3300005843 Bacteria 2009
121 Ga0068860_100200072 3300005843 Bacteria 1936
122 Ga0068862_100173512 3300005844 Bacteria 1931
123 Ga0068862_100229521 3300005844 Bacteria 1683
124 Ga0068862_100247168 3300005844 Bacteria 1624
125 Ga0081455_10001961 3300005937 Bacteria 24695
126 Ga0081455_10004630 3300005937 Bacteria 15337
127 Ga0081455_10013073 3300005937 Bacteria 8228
128 Ga0081455_10125869 3300005937 Bacteria 2011
129 Ga0081540_1010932 3300005983 Bacteria 6096
130 Ga0081540_1093557 3300005983 Bacteria 1316
131 Ga0081539_10215561 3300005985 Unclassified 877
132 Ga0070716_100440812 3300006173 Bacteria 947
133 Ga0097621_100011843 3300006237 Bacteria 6445
134 Ga0097621_100031376 3300006237 Bacteria 4217
135 Ga0097621_100036704 3300006237 Bacteria 3922
136 Ga0097621_100363992 3300006237 Bacteria 1289
137 Ga0097621_100503988 3300006237 Unclassified 1097
138 Ga0068871_100009861 3300006358 Bacteria 6935
139 Ga0068871_100045967 3300006358 Bacteria 3515
140 Ga0068871_100088971 3300006358 Bacteria 2570
141 Ga0068871_100219734 3300006358 Bacteria 1646
142 Ga0075428_100039313 3300006844 Bacteria 5206
143 Ga0075428_101206732 3300006844 Bacteria 797
144 Ga0075431_100398498 3300006847 Bacteria 1378
145 Ga0075433_10841130 3300006852 Bacteria 801
146 Ga0075434_100603505 3300006871 Unclassified 1117
147 Ga0068865_100078607 3300006881 Bacteria 2360
148 Ga0068865_100125002 3300006881 Bacteria 1919
149 Ga0068865_100241773 3300006881 Bacteria 1421
150 Ga0068865_100313816 3300006881 Bacteria 1259
151 Ga0068865_100667669 3300006881 Bacteria 885
152 Ga0097620_100048052 3300006931 Bacteria 4287
153 Ga0097620_100267784 3300006931 Bacteria 1800
154 Ga0097620_100285577 3300006931 Bacteria 1743
155 Ga0097620_100335656 3300006931 Bacteria 1606
156 Ga0097620_100446716 3300006931 Bacteria 1389
157 Ga0097620_100491873 3300006931 Unclassified 1322
158 Ga0105240_10008364 3300009093 Bacteria 14807
159 Ga0105240_10027254 3300009093 Bacteria 7483
160 Ga0105240_10828352 3300009093 Bacteria 1000
161 Ga0105245_10044707 3300009098 Bacteria 3954
162 Ga0105245_10068983 3300009098 Bacteria 3205
163 Ga0105245_10533883 3300009098 Bacteria 1193
164 Ga0105247_10020166 3300009101 Bacteria 4008
165 Ga0114129_10113411 3300009147 Bacteria 3738
166 Ga0114129_10668908 3300009147 Bacteria 1338
167 Ga0114129_10997145 3300009147 Unclassified 1055
168 Ga0114129_11494111 3300009147 Bacteria 830
169 Ga0105243_10021269 3300009148 Bacteria 4924
170 Ga0105243_10075904 3300009148 Bacteria 2729
171 Ga0105242_10202908 3300009176 Bacteria 1762
172 Ga0105248_10008166 3300009177 Bacteria 11498
173 Ga0105248_10043423 3300009177 Bacteria 5040
174 Ga0105248_10681504 3300009177 Bacteria 1160
175 Ga0105248_10770191 3300009177 Unclassified 1086
176 Ga0105248_11010541 3300009177 Bacteria 939
177 Ga0105237_10063272 3300009545 Bacteria 3697
178 Ga0105238_10271790 3300009551 Bacteria 1675
179 Ga0105249_10061457 3300009553 Bacteria 3447
180 Ga0105249_10883638 3300009553 Unclassified 960
181 Ga0105239_10292435 3300010375 Bacteria 1834
182 Ga0105239_10798193 3300010375 Bacteria 1081
183 Ga0105246_10023329 3300011119 Bacteria 4002
184 Ga0157369_11111327 3300013105 Bacteria 808
185 Ga0157374_10063778 3300013296 Bacteria 3456
186 Ga0157374_10208048 3300013296 Bacteria 1918
187 Ga0157374_10285991 3300013296 Bacteria 1629
188 Ga0157378_10018037 3300013297 Bacteria 6197
189 Ga0157378_10074687 3300013297 Bacteria 3051
190 Ga0157378_10108814 3300013297 Bacteria 2538
191 Ga0157378_10331452 3300013297 Bacteria 1481
192 Ga0157378_10899060 3300013297 Bacteria 916
193 Ga0157378_11091142 3300013297 Bacteria 835
194 Ga0163162_10087222 3300013306 Bacteria 3199
195 Ga0163162_10241411 3300013306 Bacteria 1938
196 Ga0163162_10287789 3300013306 Bacteria 1775
197 Ga0163162_10992021 3300013306 Unclassified 949
198 Ga0163162_11073954 3300013306 Unclassified 912
199 Ga0163162_11091976 3300013306 Unclassified 904
200 Ga0157375_10387578 3300013308 Bacteria 1564
201 Ga0157375_11291870 3300013308 Unclassified 858
202 Ga0163163_10143386 3300014325 Bacteria 2431
203 Ga0163163_10474749 3300014325 Bacteria 1311
204 Ga0163163_10532298 3300014325 Bacteria 1237
205 Ga0157380_10012519 3300014326 Bacteria 6156
206 Ga0157380_10040379 3300014326 Bacteria 3634
207 Ga0157380_10345882 3300014326 Bacteria 1389
208 Ga0157377_10053277 3300014745 Bacteria 2287
209 Ga0157377_10487141 3300014745 Unclassified 859
210 Ga0157377_10539642 3300014745 Bacteria 822
211 Ga0157379_10018354 3300014968 Bacteria 6167
212 Ga0157379_10142336 3300014968 Bacteria 2162
213 Ga0157379_10171216 3300014968 Bacteria 1960
214 Ga0157379_10814844 3300014968 Unclassified 882
215 Ga0157376_10040882 3300014969 Bacteria 3792
216 Ga0157376_10041283 3300014969 Bacteria 3776
217 Ga0157376_10048669 3300014969 Bacteria 3507
218 Ga0157376_10114426 3300014969 Bacteria 2380
219 Ga0157376_10146917 3300014969 Bacteria 2122
220 Ga0163161_10218778 3300017792 Bacteria 1474
221 Ga0209256_1052183 3300025299 Bacteria 984
222 Ga0207697_10000450 3300025315 Bacteria 23178
223 Ga0207656_10052609 3300025321 Bacteria 1764
224 Ga0207656_10059405 3300025321 Bacteria 1673
225 Ga0207682_10001065 3300025893 Bacteria 12657
226 Ga0207642_10009845 3300025899 Bacteria 3343
227 Ga0207642_10210741 3300025899 Bacteria 1079
228 Ga0207688_10005210 3300025901 Bacteria 7067
229 Ga0207680_10057065 3300025903 Bacteria 2361
230 Ga0207680_10256232 3300025903 Bacteria 1210
231 Ga0207645_10005257 3300025907 Bacteria 9428
232 Ga0207645_10252052 3300025907 Unclassified 1168
233 Ga0207643_10000429 3300025908 Bacteria 27769
234 Ga0207705_10012755 3300025909 Bacteria 6064
235 Ga0207705_10027516 3300025909 Bacteria 4055
236 Ga0207707_10017046 3300025912 Bacteria 6328
237 Ga0207707_10441140 3300025912 Bacteria 1114
238 Ga0207695_10057419 3300025913 Bacteria 4043
239 Ga0207695_10078665 3300025913 Bacteria 3345
240 Ga0207671_10249231 3300025914 Bacteria 1396
241 Ga0207663_10557122 3300025916 Bacteria 897
242 Ga0207660_10037685 3300025917 Bacteria 3371
243 Ga0207662_10025717 3300025918 Bacteria 3391
244 Ga0207657_10052097 3300025919 Bacteria 3554
245 Ga0207649_10107837 3300025920 Bacteria 1855
246 Ga0207652_10007355 3300025921 Bacteria 8878
247 Ga0207652_10055014 3300025921 Bacteria 3422
248 Ga0207681_10319054 3300025923 Bacteria 1235
249 Ga0207681_10458387 3300025923 Unclassified 1038
250 Ga0207694_10388843 3300025924 Bacteria 1159
251 Ga0207650_10000503 3300025925 Bacteria 32602
252 Ga0207650_10666725 3300025925 Bacteria 877
253 Ga0207659_10133666 3300025926 Bacteria 1918
254 Ga0207659_10290020 3300025926 Unclassified 1340
255 Ga0207659_10528528 3300025926 Bacteria 1001
256 Ga0207687_10152124 3300025927 Bacteria 1767
257 Ga0207644_10109924 3300025931 Bacteria 2083
258 Ga0207644_10361202 3300025931 Bacteria 1181
259 Ga0207706_10007746 3300025933 Bacteria 9914
260 Ga0207706_10340291 3300025933 Bacteria 1305
261 Ga0207686_10053460 3300025934 Bacteria 2525
262 Ga0207709_10123347 3300025935 Bacteria 1753
263 Ga0207670_10035360 3300025936 Bacteria 3238
264 Ga0207670_10052370 3300025936 Bacteria 2744
265 Ga0207669_10051658 3300025937 Bacteria 2464
266 Ga0207669_10139798 3300025937 Bacteria 1679
267 Ga0207669_10317309 3300025937 Unclassified 1191
268 Ga0207704_10099930 3300025938 Bacteria 1931
269 Ga0207704_10165180 3300025938 Bacteria 1580
270 Ga0207704_10180661 3300025938 Bacteria 1524
271 Ga0207665_10196794 3300025939 Bacteria 1467
272 Ga0207691_10016285 3300025940 Bacteria 7058
273 Ga0207691_10019836 3300025940 Bacteria 6359
274 Ga0207691_10063574 3300025940 Bacteria 3347
275 Ga0207691_10205771 3300025940 Bacteria 1712
276 Ga0207691_10416447 3300025940 Bacteria 1145
277 Ga0207691_10922781 3300025940 Bacteria 730
278 Ga0207711_10391942 3300025941 Bacteria 1290
279 Ga0207711_10726402 3300025941 Unclassified 926
280 Ga0207711_10785594 3300025941 Bacteria 887
281 Ga0207689_10008198 3300025942 Bacteria 9104
282 Ga0207689_10018096 3300025942 Bacteria 5950
283 Ga0207689_10239300 3300025942 Bacteria 1500
284 Ga0207661_10366093 3300025944 Bacteria 1303
285 Ga0207679_10589661 3300025945 Bacteria 1000
286 Ga0207667_10027691 3300025949 Bacteria 6165
287 Ga0207667_10073073 3300025949 Bacteria 3564
288 Ga0207651_10119921 3300025960 Bacteria 1993
289 Ga0207668_10070956 3300025972 Bacteria 2486
290 Ga0207640_10585995 3300025981 Bacteria 942
291 Ga0207658_10286705 3300025986 Bacteria 1413
292 Ga0207658_10290122 3300025986 Bacteria 1406
293 Ga0207677_10476563 3300026023 Bacteria 1074
294 Ga0207677_10934960 3300026023 Bacteria 783
295 Ga0207678_10030688 3300026067 Bacteria 4693
296 Ga0207678_10176916 3300026067 Bacteria 1822
297 Ga0207708_10002412 3300026075 Bacteria 13719
298 Ga0207702_10356838 3300026078 Bacteria 1400
299 Ga0207702_10482440 3300026078 Bacteria 1206
300 Ga0207641_10053128 3300026088 Bacteria 3433
301 Ga0207641_10080485 3300026088 Bacteria 2826
302 Ga0207641_10225373 3300026088 Bacteria 1740
303 Ga0207648_10030219 3300026089 Bacteria 4800
304 Ga0207648_10110192 3300026089 Bacteria 2417
305 Ga0207648_10232217 3300026089 Bacteria 1641
306 Ga0207648_10299998 3300026089 Bacteria 1441
307 Ga0207648_10405384 3300026089 Unclassified 1236
308 Ga0207676_10068605 3300026095 Bacteria 2837
309 Ga0207676_10185965 3300026095 Bacteria 1823
310 Ga0207676_10216066 3300026095 Bacteria 1704
311 Ga0207676_10325186 3300026095 Unclassified 1413
312 Ga0207674_10028929 3300026116 Bacteria 5841
313 Ga0207675_100029465 3300026118 Bacteria 5114
314 Ga0207675_100227033 3300026118 Bacteria 1800
315 Ga0207675_100447719 3300026118 Bacteria 1279
316 Ga0207683_10017865 3300026121 Bacteria 6049
317 Ga0207683_10020743 3300026121 Bacteria 5622
318 Ga0207683_10038992 3300026121 Bacteria 4143
319 Ga0207683_10120299 3300026121 Bacteria 2357
320 Ga0207683_10190506 3300026121 Bacteria 1862
321 Ga0207683_10380982 3300026121 Bacteria 1296
322 Ga0207698_10016411 3300026142 Bacteria 4990
323 Ga0207698_10090632 3300026142 Bacteria 2501
324 Ga0207698_10304473 3300026142 Bacteria 1485
325 Ga0268266_11007650 3300028379 Unclassified 806
326 Ga0268265_10154031 3300028380 Bacteria 1942
327 Ga0268265_10243006 3300028380 Bacteria 1590
328 Ga0268265_11236129 3300028380 Unclassified 745
329 Ga0268264_10477170 3300028381 Bacteria 1212
330 Ga0265331_10001361 3300031250 Bacteria 17957
331 Ga0307408_100392240 3300031548 Bacteria 1190
332 Ga0265313_10000079 3300031595 Bacteria 95515
333 Ga0265342_10007594 3300031712 Bacteria 7914
334 Ga0307413_10351702 3300031824 Bacteria 1137
335 Ga0307406_10024397 3300031901 Bacteria 3612
336 Ga0307406_10631740 3300031901 Bacteria 887
337 Ga0307412_10013487 3300031911 Bacteria 4795
338 Ga0307412_10338097 3300031911 Bacteria 1204
339 Ga0307416_100108643 3300032002 Bacteria 2438
340 Ga0307411_10507714 3300032005 Bacteria 1021
341 Ga0373936_0075025 3300035113 Bacteria 1400
342 Ga0373945_0125792 3300035116 Bacteria 1023
343 Ga0373946_0077233 3300035171 Bacteria 1451
344 Ga0373955_0200401 3300035172 Bacteria 1188
345 Ga0373927_0189124 3300035695 Bacteria 1351
346 Ga0373947_0014765 3300035725 Bacteria 4481
347 Ga0373937_0895055 3300036401 Bacteria 836
348 Ga0373925_0096702 3300037068 Bacteria 2264
349 Ga0395899_0013348 3300037312 Bacteria 6283
350 Ga0395900_0093991 3300037418 Bacteria 3080
351 Ga0395901_0050188 3300038443 Unclassified 4336
352 Ga0436365_0932038 3300039437 Bacteria 3020
353 Ga0436361_0597188 3300039447 Bacteria 2654
354 Ga0451853_3760387 3300041512 Bacteria 2428
355 Ga0450889_020016 3300042144 Unclassified 739
356 Ga0439435_0103065 3300042436 Bacteria 879
357 Ga0451577_0306824 3300042876 Bacteria 1438
358 Ga0495580_0121646 3300046472 Unclassified 1812
359 Ga0495598_0058122 3300046537 Bacteria 1186
360 Ga0495598_0094325 3300046537 Bacteria 981
361 Ga0495621_0079491 3300046539 Bacteria 1221
362 Ga0495645_0057791 3300046543 Bacteria 2815
363 Ga0495656_0095605 3300046615 Bacteria 1366
364 Ga0495599_0154951 3300046678 Unclassified 1418
365 Ga0496100_0027925 3300048903 Bacteria 3476
366 Ga0496102_0048596 3300048905 Bacteria 3858
367 Ga0496102_0697721 3300048905 Bacteria 938
368 Ga0496104_0004348 3300048907 Bacteria 12323
369 Ga0496104_0008354 3300048907 Bacteria 9200
370 Ga0496104_0932356 3300048907 Bacteria 773
371 Ga0496106_0124021 3300048909 Bacteria 2021
372 Ga0496107_0051192 3300048910 Bacteria 2978
373 Ga0496108_0003909 3300048911 Bacteria 11967
374 Ga0496109_0013713 3300048912 Bacteria 7040
375 Ga0496109_0175977 3300048912 Bacteria 2009
376 Ga0496110_0016519 3300048913 Bacteria 6163
377 Ga0496110_0042180 3300048913 Bacteria 3983
378 Ga0496111_0330839 3300048914 Bacteria 1128
379 Ga0496111_0340004 3300048914 Bacteria 1111
380 Ga0496112_0249428 3300048915 Bacteria 1727
381 Ga0496112_0675955 3300048915 Bacteria 961
382 Ga0496113_0220243 3300048916 Bacteria 1512
383 Ga0496114_0213876 3300048917 Bacteria 1691
384 Ga0501032_0040178 3300049569 Bacteria 3180
385 Ga0501033_0004364 3300049570 Bacteria 11336
386 Ga0501036_0011802 3300049572 Bacteria 7241
387 Ga0501037_0023177 3300049573 Bacteria 4591
388 Ga0501037_0075128 3300049573 Bacteria 2455
389 Ga0501038_0002188 3300049574 Bacteria 18177
390 Ga0501038_0044394 3300049574 Bacteria 3862
391 Ga0501046_0010435 3300049580 Bacteria 7978
392 Ga0501047_0404552 3300049581 Bacteria 1198
393 Ga0501048_0039910 3300049582 Bacteria 3365
394 Ga0501067_0002220 3300049583 Bacteria 10735
395 Ga0501067_0105511 3300049583 Bacteria 1566
396 Ga0501068_0008761 3300049584 Bacteria 5645
397 Ga0501069_0001701 3300049585 Bacteria 10958
398 Ga0501070_0001886 3300049586 Bacteria 18536
399 Ga0501070_0088968 3300049586 Bacteria 2556
400 Ga0501070_0243615 3300049586 Bacteria 1471
401 Ga0501073_0000287 3300049589 Bacteria 33235
402 Ga0501074_0001317 3300049590 Bacteria 16470
403 Ga0501076_0082486 3300049592 Bacteria 2581
404 Ga0501076_0280120 3300049592 Bacteria 1366
405 Ga0501080_0164016 3300049742 Bacteria 2051
406 Ga0501080_0398438 3300049742 Bacteria 1238
407 Ga0501080_0710356 3300049742 Bacteria 886
408 Ga0501083_0036866 3300049744 Bacteria 3332
409 Ga0501035_0037072 3300049822 Bacteria 4417
410 Ga0501035_0044435 3300049822 Bacteria 4000
411 Ga0501044_0009537 3300049823 Bacteria 10570
412 nmdc:mga05p37_112981_c1 3300050507 Bacteria 2933
413 nmdc:mga06r32_132497_c1 3300050510 Bacteria 2465
414 nmdc:mga08y16_298408_c1 3300050511 Bacteria 1661
415 nmdc:mga0n895_866962_c1 3300050512 Bacteria 890
416 Ga0495612_0057621 3300053078 Bacteria 1604
417 Ga0500644_0371496 3300053088 Bacteria 621
418 Ga0500651_0022568 3300053093 Bacteria 3931
419 Ga0500595_000606 3300053119 Bacteria 21376
420 Ga0500577_0004275 3300053142 Bacteria 3761
421 Ga0500588_0041973 3300053146 Bacteria 1383
422 Ga0501084_0024964 3300054114 Bacteria 4987
423 Ga0590071_017742 3300059421 Bacteria 1672
424 Ga0590075_002840 3300059424 Bacteria 4131
425 Ga0501082_0984103 3300060353 Unclassified 737

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053088 Ga0500644_0371496 Ga0500644_0371496_28_570 179
2 3300046539 Ga0495621_0079491 Ga0495621_0079491_604_1203 196
3 3300025925 Ga0207650_10666725 Ga0207650_106667252 197
4 3300042144 Ga0450889_020016 Ga0450889_020016_127_723 197
5 3300032002 Ga0307416_100108643 Ga0307416_1001086433 200
6 3300025299 Ga0209256_1052183 Ga0209256_10521832 201
7 3300031824 Ga0307413_10351702 Ga0307413_103517022 204
8 3300049592 Ga0501076_0280120 Ga0501076_0280120_651_1268 204
9 3300005336 Ga0070680_100002368 Ga0070680_1000023683 208
10 3300005339 Ga0070660_100217597 Ga0070660_1002175972 208
11 3300005341 Ga0070691_10006388 Ga0070691_100063885 208
12 3300005458 Ga0070681_10018251 Ga0070681_100182518 208
13 3300005530 Ga0070679_100005262 Ga0070679_10000526211 208
14 3300005563 Ga0068855_100049973 Ga0068855_1000499735 208
15 3300009093 Ga0105240_10008364 Ga0105240_100083642 208
16 3300025913 Ga0207695_10057419 Ga0207695_100574194 208
17 3300025917 Ga0207660_10037685 Ga0207660_100376853 208
18 3300025921 Ga0207652_10007355 Ga0207652_100073554 208
19 3300025949 Ga0207667_10073073 Ga0207667_100730734 208
20 3300026078 Ga0207702_10482440 Ga0207702_104824402 208
21 iso_pu_bacteria 2883291878 2883295298 208
22 iso_pu_bacteria 2883354860 2883358199 208
23 3300003659 JGI25404J52841_10001695 JGI25404J52841_100016953 209
24 3300005356 Ga0070674_100013942 Ga0070674_1000139425 209
25 3300005367 Ga0070667_100380019 Ga0070667_1003800191 209
26 3300005456 Ga0070678_100001798 Ga0070678_10000179811 209
27 3300005543 Ga0070672_100046028 Ga0070672_1000460283 209
28 3300005937 Ga0081455_10004630 Ga0081455_1000463010 209
29 3300005983 Ga0081540_1010932 Ga0081540_10109326 209
30 3300005983 Ga0081540_1093557 Ga0081540_10935572 209
31 3300006237 Ga0097621_100036704 Ga0097621_1000367043 209
32 3300006881 Ga0068865_100125002 Ga0068865_1001250023 209
33 3300009177 Ga0105248_10043423 Ga0105248_100434232 209
34 3300013306 Ga0163162_10087222 Ga0163162_100872223 209
35 3300014968 Ga0157379_10814844 Ga0157379_108148441 209
36 3300014969 Ga0157376_10040882 Ga0157376_100408823 209
37 3300025938 Ga0207704_10099930 Ga0207704_100999302 209
38 3300025940 Ga0207691_10063574 Ga0207691_100635743 209
39 3300025941 Ga0207711_10726402 Ga0207711_107264022 209
40 3300026121 Ga0207683_10017865 Ga0207683_100178655 209
41 3300005334 Ga0068869_100271403 Ga0068869_1002714031 210
42 3300005455 Ga0070663_100318808 Ga0070663_1003188081 210
43 3300005549 Ga0070704_100026779 Ga0070704_1000267794 210
44 3300005564 Ga0070664_100089726 Ga0070664_1000897263 210
45 3300005577 Ga0068857_100710783 Ga0068857_1007107832 210
46 3300005616 Ga0068852_100599915 Ga0068852_1005999151 210
47 3300005937 Ga0081455_10001961 Ga0081455_100019615 210
48 3300005937 Ga0081455_10013073 Ga0081455_100130734 210
49 3300006844 Ga0075428_101206732 Ga0075428_1012067321 210
50 3300006852 Ga0075433_10841130 Ga0075433_108411301 210
51 3300009147 Ga0114129_10997145 Ga0114129_109971452 210
52 3300013105 Ga0157369_11111327 Ga0157369_111113271 210
53 3300013296 Ga0157374_10063778 Ga0157374_100637782 210
54 3300013306 Ga0163162_10241411 Ga0163162_102414113 210
55 3300014745 Ga0157377_10539642 Ga0157377_105396421 210
56 3300025926 Ga0207659_10528528 Ga0207659_105285281 210
57 3300025942 Ga0207689_10239300 Ga0207689_102393001 210
58 3300026067 Ga0207678_10176916 Ga0207678_101769161 210
59 3300026078 Ga0207702_10356838 Ga0207702_103568383 210
60 3300048905 Ga0496102_0697721 Ga0496102_0697721_124_759 210
61 3300048907 Ga0496104_0932356 Ga0496104_0932356_31_666 210
62 3300048914 Ga0496111_0340004 Ga0496111_0340004_55_690 210
63 3300048915 Ga0496112_0675955 Ga0496112_0675955_30_665 210
64 3300050512 nmdc:mga0n895_866962_c1 nmdc:mga0n895_866962_c1_172_807 210
65 3300005344 Ga0070661_100549735 Ga0070661_1005497351 211
66 3300005356 Ga0070674_100417879 Ga0070674_1004178791 211
67 3300005438 Ga0070701_10354080 Ga0070701_103540801 211
68 3300005456 Ga0070678_100554200 Ga0070678_1005542001 211
69 3300005457 Ga0070662_100749881 Ga0070662_1007498811 211
70 3300005459 Ga0068867_100549567 Ga0068867_1005495672 211
71 3300005548 Ga0070665_100135367 Ga0070665_1001353674 211
72 3300005616 Ga0068852_100995577 Ga0068852_1009955771 211
73 3300005718 Ga0068866_10606716 Ga0068866_106067161 211
74 3300005719 Ga0068861_101265956 Ga0068861_1012659561 211
75 3300009177 Ga0105248_10770191 Ga0105248_107701911 211
76 3300010375 Ga0105239_10292435 Ga0105239_102924351 211
77 3300013296 Ga0157374_10208048 Ga0157374_102080482 211
78 3300013297 Ga0157378_10899060 Ga0157378_108990602 211
79 3300025899 Ga0207642_10210741 Ga0207642_102107412 211
80 3300025926 Ga0207659_10290020 Ga0207659_102900202 211
81 3300025937 Ga0207669_10317309 Ga0207669_103173091 211
82 3300026089 Ga0207648_10232217 Ga0207648_102322172 211
83 3300026118 Ga0207675_100227033 Ga0207675_1002270332 211
84 3300026121 Ga0207683_10190506 Ga0207683_101905061 211
85 3300028379 Ga0268266_11007650 Ga0268266_110076501 211
86 3300046615 Ga0495656_0095605 Ga0495656_0095605_504_1178 211
87 3300005327 Ga0070658_10028337 Ga0070658_100283374 212
88 3300005327 Ga0070658_10098271 Ga0070658_100982713 212
89 3300005331 Ga0070670_100365523 Ga0070670_1003655232 212
90 3300005334 Ga0068869_100021892 Ga0068869_1000218922 212
91 3300005336 Ga0070680_100164852 Ga0070680_1001648522 212
92 3300005338 Ga0068868_100095063 Ga0068868_1000950634 212
93 3300005340 Ga0070689_100232763 Ga0070689_1002327632 212
94 3300005356 Ga0070674_100350912 Ga0070674_1003509122 212
95 3300005365 Ga0070688_100074500 Ga0070688_1000745002 212
96 3300005458 Ga0070681_10000602 Ga0070681_1000060226 212
97 3300005458 Ga0070681_10132978 Ga0070681_101329783 212
98 3300005458 Ga0070681_10345498 Ga0070681_103454982 212
99 3300005466 Ga0070685_10296427 Ga0070685_102964271 212
100 3300005530 Ga0070679_100075892 Ga0070679_1000758922 212
101 3300005549 Ga0070704_100543240 Ga0070704_1005432401 212
102 3300005616 Ga0068852_100008091 Ga0068852_1000080912 212
103 3300005616 Ga0068852_100661139 Ga0068852_1006611392 212
104 3300005617 Ga0068859_100446660 Ga0068859_1004466602 212
105 3300005719 Ga0068861_100226536 Ga0068861_1002265362 212
106 3300005841 Ga0068863_100322388 Ga0068863_1003223883 212
107 3300005841 Ga0068863_100375894 Ga0068863_1003758942 212
108 3300005841 Ga0068863_100606224 Ga0068863_1006062241 212
109 3300005842 Ga0068858_100043387 Ga0068858_1000433876 212
110 3300005844 Ga0068862_100229521 Ga0068862_1002295212 212
111 3300005985 Ga0081539_10215561 Ga0081539_102155611 212
112 3300006173 Ga0070716_100440812 Ga0070716_1004408121 212
113 3300006237 Ga0097621_100011843 Ga0097621_1000118438 212
114 3300006358 Ga0068871_100088971 Ga0068871_1000889713 212
115 3300006358 Ga0068871_100219734 Ga0068871_1002197342 212
116 3300006871 Ga0075434_100603505 Ga0075434_1006035052 212
117 3300006881 Ga0068865_100241773 Ga0068865_1002417731 212
118 3300006881 Ga0068865_100667669 Ga0068865_1006676692 212
119 3300006931 Ga0097620_100446716 Ga0097620_1004467161 212
120 3300009093 Ga0105240_10027254 Ga0105240_100272545 212
121 3300009098 Ga0105245_10044707 Ga0105245_100447072 212
122 3300009101 Ga0105247_10020166 Ga0105247_100201662 212
123 3300009147 Ga0114129_11494111 Ga0114129_114941111 212
124 3300009148 Ga0105243_10075904 Ga0105243_100759042 212
125 3300009176 Ga0105242_10202908 Ga0105242_102029082 212
126 3300009177 Ga0105248_10008166 Ga0105248_100081666 212
127 3300009177 Ga0105248_11010541 Ga0105248_110105412 212
128 3300009553 Ga0105249_10883638 Ga0105249_108836382 212
129 3300010375 Ga0105239_10798193 Ga0105239_107981932 212
130 3300011119 Ga0105246_10023329 Ga0105246_100233292 212
131 3300013296 Ga0157374_10285991 Ga0157374_102859912 212
132 3300013297 Ga0157378_10018037 Ga0157378_100180374 212
133 3300013297 Ga0157378_10331452 Ga0157378_103314522 212
134 3300013297 Ga0157378_11091142 Ga0157378_110911421 212
135 3300013306 Ga0163162_10287789 Ga0163162_102877892 212
136 3300013306 Ga0163162_11091976 Ga0163162_110919761 212
137 3300014325 Ga0163163_10474749 Ga0163163_104747492 212
138 3300014326 Ga0157380_10345882 Ga0157380_103458822 212
139 3300014968 Ga0157379_10142336 Ga0157379_101423363 212
140 3300014969 Ga0157376_10114426 Ga0157376_101144264 212
141 3300014969 Ga0157376_10146917 Ga0157376_101469172 212
142 3300025321 Ga0207656_10052609 Ga0207656_100526092 212
143 3300025909 Ga0207705_10012755 Ga0207705_100127552 212
144 3300025909 Ga0207705_10027516 Ga0207705_100275162 212
145 3300025912 Ga0207707_10017046 Ga0207707_100170462 212
146 3300025912 Ga0207707_10441140 Ga0207707_104411402 212
147 3300025913 Ga0207695_10078665 Ga0207695_100786651 212
148 3300025921 Ga0207652_10055014 Ga0207652_100550143 212
149 3300025924 Ga0207694_10388843 Ga0207694_103888432 212
150 3300025927 Ga0207687_10152124 Ga0207687_101521242 212
151 3300025935 Ga0207709_10123347 Ga0207709_101233472 212
152 3300025938 Ga0207704_10180661 Ga0207704_101806612 212
153 3300025939 Ga0207665_10196794 Ga0207665_101967942 212
154 3300025940 Ga0207691_10205771 Ga0207691_102057712 212
155 3300025941 Ga0207711_10391942 Ga0207711_103919421 212
156 3300025942 Ga0207689_10018096 Ga0207689_100180966 212
157 3300025986 Ga0207658_10290122 Ga0207658_102901222 212
158 3300026023 Ga0207677_10476563 Ga0207677_104765632 212
159 3300026088 Ga0207641_10053128 Ga0207641_100531282 212
160 3300026088 Ga0207641_10225373 Ga0207641_102253732 212
161 3300026089 Ga0207648_10405384 Ga0207648_104053842 212
162 3300026118 Ga0207675_100447719 Ga0207675_1004477192 212
163 3300026121 Ga0207683_10120299 Ga0207683_101202992 212
164 3300026142 Ga0207698_10016411 Ga0207698_100164111 212
165 3300028380 Ga0268265_10243006 Ga0268265_102430062 212
166 3300031250 Ga0265331_10001361 Ga0265331_1000136112 212
167 3300031548 Ga0307408_100392240 Ga0307408_1003922402 212
168 3300031595 Ga0265313_10000079 Ga0265313_1000007939 212
169 3300031712 Ga0265342_10007594 Ga0265342_100075945 212
170 3300031901 Ga0307406_10631740 Ga0307406_106317402 212
171 3300031911 Ga0307412_10338097 Ga0307412_103380972 212
172 3300032005 Ga0307411_10507714 Ga0307411_105077142 212
173 3300036401 Ga0373937_0895055 Ga0373937_0895055_75_722 212
174 3300039447 Ga0436361_0597188 Ga0436361_0597188_624_1265 212
175 3300042436 Ga0439435_0103065 Ga0439435_0103065_35_685 212
176 3300048907 Ga0496104_0008354 Ga0496104_0008354_7309_7956 212
177 3300048912 Ga0496109_0175977 Ga0496109_0175977_506_1153 212
178 3300048913 Ga0496110_0042180 Ga0496110_0042180_109_756 212
179 3300048914 Ga0496111_0330839 Ga0496111_0330839_409_1050 212
180 3300048916 Ga0496113_0220243 Ga0496113_0220243_560_1201 212
181 3300053093 Ga0500651_0022568 Ga0500651_0022568_367_1008 212
182 3300053119 Ga0500595_000606 Ga0500595_000606_12616_13257 212
183 3300053142 Ga0500577_0004275 Ga0500577_0004275_2787_3428 212
184 3300053146 Ga0500588_0041973 Ga0500588_0041973_203_844 212
185 3300003322 rootL2_10145446 rootL2_101454462 213
186 3300005937 Ga0081455_10125869 Ga0081455_101258693 213
187 3300009093 Ga0105240_10828352 Ga0105240_108283521 213
188 3300009147 Ga0114129_10113411 Ga0114129_101134113 213
189 3300009545 Ga0105237_10063272 Ga0105237_100632726 213
190 3300025914 Ga0207671_10249231 Ga0207671_102492311 213
191 3300031901 Ga0307406_10024397 Ga0307406_100243974 213
192 3300031911 Ga0307412_10013487 Ga0307412_100134874 213
193 3300037312 Ga0395899_0013348 Ga0395899_0013348_3034_3678 213
194 3300037418 Ga0395900_0093991 Ga0395900_0093991_232_876 213
195 3300038443 Ga0395901_0050188 Ga0395901_0050188_2694_3335 213
196 3300049569 Ga0501032_0040178 Ga0501032_0040178_1805_2449 213
197 3300049570 Ga0501033_0004364 Ga0501033_0004364_7812_8456 213
198 3300049572 Ga0501036_0011802 Ga0501036_0011802_5051_5695 213
199 3300049573 Ga0501037_0023177 Ga0501037_0023177_2413_3057 213
200 3300049573 Ga0501037_0075128 Ga0501037_0075128_1749_2393 213
201 3300049574 Ga0501038_0002188 Ga0501038_0002188_14944_15588 213
202 3300049574 Ga0501038_0044394 Ga0501038_0044394_460_1167 213
203 3300049580 Ga0501046_0010435 Ga0501046_0010435_2183_2827 213
204 3300049581 Ga0501047_0404552 Ga0501047_0404552_42_749 213
205 3300049582 Ga0501048_0039910 Ga0501048_0039910_1929_2573 213
206 3300049583 Ga0501067_0002220 Ga0501067_0002220_3076_3720 213
207 3300049583 Ga0501067_0105511 Ga0501067_0105511_684_1328 213
208 3300049584 Ga0501068_0008761 Ga0501068_0008761_646_1290 213
209 3300049585 Ga0501069_0001701 Ga0501069_0001701_4430_5074 213
210 3300049586 Ga0501070_0001886 Ga0501070_0001886_2294_2938 213
211 3300049586 Ga0501070_0088968 Ga0501070_0088968_949_1656 213
212 3300049586 Ga0501070_0243615 Ga0501070_0243615_77_721 213
213 3300049589 Ga0501073_0000287 Ga0501073_0000287_14652_15296 213
214 3300049590 Ga0501074_0001317 Ga0501074_0001317_552_1196 213
215 3300049592 Ga0501076_0082486 Ga0501076_0082486_1233_1877 213
216 3300049742 Ga0501080_0164016 Ga0501080_0164016_1134_1778 213
217 3300049742 Ga0501080_0398438 Ga0501080_0398438_552_1196 213
218 3300049742 Ga0501080_0710356 Ga0501080_0710356_72_716 213
219 3300049744 Ga0501083_0036866 Ga0501083_0036866_1933_2577 213
220 3300049822 Ga0501035_0037072 Ga0501035_0037072_3189_3833 213
221 3300049822 Ga0501035_0044435 Ga0501035_0044435_1643_2287 213
222 3300049823 Ga0501044_0009537 Ga0501044_0009537_1953_2597 213
223 3300050507 nmdc:mga05p37_112981_c1 nmdc:mga05p37_112981_c1_361_1005 213
224 3300054114 Ga0501084_0024964 Ga0501084_0024964_552_1196 213
225 3300059421 Ga0590071_017742 Ga0590071_017742_977_1621 213
226 3300059424 Ga0590075_002840 Ga0590075_002840_1777_2421 213
227 3300060353 Ga0501082_0984103 Ga0501082_0984103_50_694 213
228 3300025981 Ga0207640_10585995 Ga0207640_105859951 214
229 3300039437 Ga0436365_0932038 Ga0436365_0932038_1776_2429 214
230 3300005330 Ga0070690_100404795 Ga0070690_1004047952 215
231 3300005353 Ga0070669_100418706 Ga0070669_1004187062 215
232 3300005440 Ga0070705_100331099 Ga0070705_1003310991 215
233 3300005459 Ga0068867_100526580 Ga0068867_1005265802 215
234 3300005459 Ga0068867_100597392 Ga0068867_1005973922 215
235 3300005617 Ga0068859_100491938 Ga0068859_1004919382 215
236 3300005618 Ga0068864_100082909 Ga0068864_1000829094 215
237 3300005719 Ga0068861_100274509 Ga0068861_1002745091 215
238 3300005843 Ga0068860_100200072 Ga0068860_1002000724 215
239 3300006931 Ga0097620_100491873 Ga0097620_1004918732 215
240 3300009098 Ga0105245_10068983 Ga0105245_100689834 215
241 3300013297 Ga0157378_10108814 Ga0157378_101088145 215
242 3300025907 Ga0207645_10252052 Ga0207645_102520521 215
243 3300025923 Ga0207681_10458387 Ga0207681_104583872 215
244 3300025940 Ga0207691_10922781 Ga0207691_109227811 215
245 3300026089 Ga0207648_10299998 Ga0207648_102999982 215
246 3300026095 Ga0207676_10216066 Ga0207676_102160662 215
247 3300028381 Ga0268264_10477170 Ga0268264_104771702 215
248 3300042876 Ga0451577_0306824 Ga0451577_0306824_155_808 215
249 3300005331 Ga0070670_100435019 Ga0070670_1004350192 216
250 3300005333 Ga0070677_10197697 Ga0070677_101976972 216
251 3300005356 Ga0070674_100208070 Ga0070674_1002080702 216
252 3300005364 Ga0070673_100015599 Ga0070673_1000155992 216
253 3300005365 Ga0070688_100070220 Ga0070688_1000702203 216
254 3300005437 Ga0070710_10136497 Ga0070710_101364972 216
255 3300005438 Ga0070701_10276442 Ga0070701_102764422 216
256 3300005444 Ga0070694_100085108 Ga0070694_1000851083 216
257 3300005445 Ga0070708_100246388 Ga0070708_1002463882 216
258 3300005456 Ga0070678_100261938 Ga0070678_1002619382 216
259 3300005459 Ga0068867_100059597 Ga0068867_1000595972 216
260 3300005471 Ga0070698_100192530 Ga0070698_1001925303 216
261 3300005518 Ga0070699_100283134 Ga0070699_1002831341 216
262 3300005543 Ga0070672_100162353 Ga0070672_1001623532 216
263 3300005547 Ga0070693_100233643 Ga0070693_1002336432 216
264 3300005616 Ga0068852_100301457 Ga0068852_1003014572 216
265 3300005616 Ga0068852_101111119 Ga0068852_1011111192 216
266 3300005617 Ga0068859_100048051 Ga0068859_1000480512 216
267 3300005617 Ga0068859_100285558 Ga0068859_1002855582 216
268 3300005617 Ga0068859_100335636 Ga0068859_1003356362 216
269 3300005618 Ga0068864_100069106 Ga0068864_1000691062 216
270 3300005841 Ga0068863_100177975 Ga0068863_1001779752 216
271 3300005842 Ga0068858_100111109 Ga0068858_1001111092 216
272 3300005843 Ga0068860_100186050 Ga0068860_1001860502 216
273 3300006237 Ga0097621_100031376 Ga0097621_1000313762 216
274 3300006237 Ga0097621_100503988 Ga0097621_1005039882 216
275 3300006358 Ga0068871_100009861 Ga0068871_1000098617 216
276 3300006358 Ga0068871_100045967 Ga0068871_1000459672 216
277 3300006844 Ga0075428_100039313 Ga0075428_1000393132 216
278 3300006847 Ga0075431_100398498 Ga0075431_1003984981 216
279 3300006881 Ga0068865_100313816 Ga0068865_1003138162 216
280 3300006931 Ga0097620_100048052 Ga0097620_1000480522 216
281 3300006931 Ga0097620_100285577 Ga0097620_1002855772 216
282 3300006931 Ga0097620_100335656 Ga0097620_1003356562 216
283 3300009147 Ga0114129_10668908 Ga0114129_106689082 216
284 3300009177 Ga0105248_10681504 Ga0105248_106815042 216
285 3300013297 Ga0157378_10074687 Ga0157378_100746872 216
286 3300013306 Ga0163162_10992021 Ga0163162_109920212 216
287 3300013306 Ga0163162_11073954 Ga0163162_110739541 216
288 3300013308 Ga0157375_10387578 Ga0157375_103875782 216
289 3300013308 Ga0157375_11291870 Ga0157375_112918702 216
290 3300014325 Ga0163163_10143386 Ga0163163_101433862 216
291 3300014745 Ga0157377_10487141 Ga0157377_104871412 216
292 3300014968 Ga0157379_10171216 Ga0157379_101712162 216
293 3300014969 Ga0157376_10041283 Ga0157376_100412833 216
294 3300014969 Ga0157376_10048669 Ga0157376_100486696 216
295 3300025899 Ga0207642_10009845 Ga0207642_100098453 216
296 3300025916 Ga0207663_10557122 Ga0207663_105571222 216
297 3300025923 Ga0207681_10319054 Ga0207681_103190542 216
298 3300025931 Ga0207644_10361202 Ga0207644_103612022 216
299 3300025934 Ga0207686_10053460 Ga0207686_100534602 216
300 3300025936 Ga0207670_10035360 Ga0207670_100353604 216
301 3300025937 Ga0207669_10139798 Ga0207669_101397983 216
302 3300025938 Ga0207704_10165180 Ga0207704_101651803 216
303 3300025940 Ga0207691_10019836 Ga0207691_100198367 216
304 3300025941 Ga0207711_10785594 Ga0207711_107855942 216
305 3300025960 Ga0207651_10119921 Ga0207651_101199212 216
306 3300026088 Ga0207641_10080485 Ga0207641_100804853 216
307 3300026089 Ga0207648_10110192 Ga0207648_101101922 216
308 3300026095 Ga0207676_10068605 Ga0207676_100686052 216
309 3300026095 Ga0207676_10325186 Ga0207676_103251862 216
310 3300026121 Ga0207683_10020743 Ga0207683_100207434 216
311 3300026121 Ga0207683_10380982 Ga0207683_103809822 216
312 3300026142 Ga0207698_10090632 Ga0207698_100906322 216
313 3300028380 Ga0268265_11236129 Ga0268265_112361291 216
314 3300035171 Ga0373946_0077233 Ga0373946_0077233_270_920 216
315 3300035725 Ga0373947_0014765 Ga0373947_0014765_2141_2791 216
316 3300037068 Ga0373925_0096702 Ga0373925_0096702_610_1260 216
317 3300046472 Ga0495580_0121646 Ga0495580_0121646_610_1260 216
318 3300046537 Ga0495598_0094325 Ga0495598_0094325_18_668 216
319 3300046543 Ga0495645_0057791 Ga0495645_0057791_1090_1740 216
320 3300046678 Ga0495599_0154951 Ga0495599_0154951_23_673 216
321 3300050510 nmdc:mga06r32_132497_c1 nmdc:mga06r32_132497_c1_930_1586 216
322 3300053078 Ga0495612_0057621 Ga0495612_0057621_600_1250 216
323 3300005293 Ga0065715_10124124 Ga0065715_101241243 218
324 3300005347 Ga0070668_100001234 Ga0070668_10000123413 218
325 3300005356 Ga0070674_100014133 Ga0070674_1000141332 218
326 3300005356 Ga0070674_100442780 Ga0070674_1004427801 218
327 3300005445 Ga0070708_100000323 Ga0070708_10000032316 218
328 3300005457 Ga0070662_100293074 Ga0070662_1002930742 218
329 3300005844 Ga0068862_100173512 Ga0068862_1001735122 218
330 3300014325 Ga0163163_10532298 Ga0163163_105322982 218
331 3300014326 Ga0157380_10040379 Ga0157380_100403793 218
332 3300025933 Ga0207706_10340291 Ga0207706_103402912 218
333 3300025937 Ga0207669_10051658 Ga0207669_100516581 218
334 3300025940 Ga0207691_10416447 Ga0207691_104164471 218
335 3300025972 Ga0207668_10070956 Ga0207668_100709563 218
336 3300028380 Ga0268265_10154031 Ga0268265_101540313 218
337 3300035116 Ga0373945_0125792 Ga0373945_0125792_201_857 218
338 3300035172 Ga0373955_0200401 Ga0373955_0200401_224_880 218
339 3300006237 Ga0097621_100363992 Ga0097621_1003639922 222
340 3300041512 Ga0451853_3760387 Ga0451853_3760387_488_1156 222
341 2162886012 MBSR1b_contig_8558565 MBSR1b_0681.00005990 223
342 3300002239 JGI24034J26672_10030228 JGI24034J26672_100302281 223
343 3300005293 Ga0065715_10301983 Ga0065715_103019832 223
344 3300005329 Ga0070683_100407092 Ga0070683_1004070922 223
345 3300005330 Ga0070690_100007631 Ga0070690_1000076313 223
346 3300005334 Ga0068869_100062217 Ga0068869_1000622172 223
347 3300005335 Ga0070666_10259898 Ga0070666_102598982 223
348 3300005338 Ga0068868_100095044 Ga0068868_1000950442 223
349 3300005340 Ga0070689_100012055 Ga0070689_1000120553 223
350 3300005347 Ga0070668_100276766 Ga0070668_1002767662 223
351 3300005353 Ga0070669_100116981 Ga0070669_1001169813 223
352 3300005355 Ga0070671_100161842 Ga0070671_1001618422 223
353 3300005356 Ga0070674_100104872 Ga0070674_1001048722 223
354 3300005364 Ga0070673_100369090 Ga0070673_1003690901 223
355 3300005366 Ga0070659_100113199 Ga0070659_1001131994 223
356 3300005438 Ga0070701_10124593 Ga0070701_101245931 223
357 3300005441 Ga0070700_100046178 Ga0070700_1000461782 223
358 3300005455 Ga0070663_100194905 Ga0070663_1001949052 223
359 3300005466 Ga0070685_10048251 Ga0070685_100482514 223
360 3300005544 Ga0070686_100065350 Ga0070686_1000653504 223
361 3300005547 Ga0070693_100207648 Ga0070693_1002076482 223
362 3300005563 Ga0068855_100077118 Ga0068855_1000771183 223
363 3300005564 Ga0070664_100084932 Ga0070664_1000849323 223
364 3300005577 Ga0068857_100059912 Ga0068857_1000599124 223
365 3300005578 Ga0068854_100070564 Ga0068854_1000705644 223
366 3300005617 Ga0068859_100267811 Ga0068859_1002678112 223
367 3300005719 Ga0068861_100073550 Ga0068861_1000735502 223
368 3300005834 Ga0068851_10051433 Ga0068851_100514332 223
369 3300005840 Ga0068870_10002667 Ga0068870_100026677 223
370 3300005841 Ga0068863_100352453 Ga0068863_1003524532 223
371 3300005842 Ga0068858_100153990 Ga0068858_1001539902 223
372 3300005844 Ga0068862_100247168 Ga0068862_1002471683 223
373 3300006881 Ga0068865_100078607 Ga0068865_1000786073 223
374 3300006931 Ga0097620_100267784 Ga0097620_1002677842 223
375 3300009098 Ga0105245_10533883 Ga0105245_105338832 223
376 3300009148 Ga0105243_10021269 Ga0105243_100212694 223
377 3300009551 Ga0105238_10271790 Ga0105238_102717902 223
378 3300009553 Ga0105249_10061457 Ga0105249_100614573 223
379 3300014326 Ga0157380_10012519 Ga0157380_100125194 223
380 3300014745 Ga0157377_10053277 Ga0157377_100532773 223
381 3300014968 Ga0157379_10018354 Ga0157379_100183545 223
382 3300017792 Ga0163161_10218778 Ga0163161_102187782 223
383 3300025315 Ga0207697_10000450 Ga0207697_100004504 223
384 3300025321 Ga0207656_10059405 Ga0207656_100594052 223
385 3300025893 Ga0207682_10001065 Ga0207682_100010654 223
386 3300025901 Ga0207688_10005210 Ga0207688_100052103 223
387 3300025903 Ga0207680_10057065 Ga0207680_100570652 223
388 3300025903 Ga0207680_10256232 Ga0207680_102562321 223
389 3300025907 Ga0207645_10005257 Ga0207645_100052573 223
390 3300025908 Ga0207643_10000429 Ga0207643_100004294 223
391 3300025918 Ga0207662_10025717 Ga0207662_100257174 223
392 3300025919 Ga0207657_10052097 Ga0207657_100520973 223
393 3300025920 Ga0207649_10107837 Ga0207649_101078371 223
394 3300025925 Ga0207650_10000503 Ga0207650_1000050323 223
395 3300025926 Ga0207659_10133666 Ga0207659_101336663 223
396 3300025931 Ga0207644_10109924 Ga0207644_101099242 223
397 3300025933 Ga0207706_10007746 Ga0207706_100077467 223
398 3300025936 Ga0207670_10052370 Ga0207670_100523701 223
399 3300025940 Ga0207691_10016285 Ga0207691_100162852 223
400 3300025942 Ga0207689_10008198 Ga0207689_100081985 223
401 3300025944 Ga0207661_10366093 Ga0207661_103660932 223
402 3300025945 Ga0207679_10589661 Ga0207679_105896611 223
403 3300025949 Ga0207667_10027691 Ga0207667_100276915 223
404 3300025986 Ga0207658_10286705 Ga0207658_102867052 223
405 3300026023 Ga0207677_10934960 Ga0207677_109349601 223
406 3300026067 Ga0207678_10030688 Ga0207678_100306883 223
407 3300026075 Ga0207708_10002412 Ga0207708_100024127 223
408 3300026089 Ga0207648_10030219 Ga0207648_100302192 223
409 3300026095 Ga0207676_10185965 Ga0207676_101859652 223
410 3300026116 Ga0207674_10028929 Ga0207674_100289294 223
411 3300026118 Ga0207675_100029465 Ga0207675_1000294654 223
412 3300026121 Ga0207683_10038992 Ga0207683_100389923 223
413 3300026142 Ga0207698_10304473 Ga0207698_103044732 223
414 3300035113 Ga0373936_0075025 Ga0373936_0075025_624_1295 223
415 3300035695 Ga0373927_0189124 Ga0373927_0189124_660_1331 223
416 3300046537 Ga0495598_0058122 Ga0495598_0058122_482_1153 223
417 3300048903 Ga0496100_0027925 Ga0496100_0027925_1927_2598 223
418 3300048905 Ga0496102_0048596 Ga0496102_0048596_1986_2657 223
419 3300048907 Ga0496104_0004348 Ga0496104_0004348_1120_1791 223
420 3300048909 Ga0496106_0124021 Ga0496106_0124021_1204_1875 223
421 3300048910 Ga0496107_0051192 Ga0496107_0051192_767_1438 223
422 3300048911 Ga0496108_0003909 Ga0496108_0003909_4032_4703 223
423 3300048912 Ga0496109_0013713 Ga0496109_0013713_1354_2025 223
424 3300048913 Ga0496110_0016519 Ga0496110_0016519_3814_4485 223
425 3300048915 Ga0496112_0249428 Ga0496112_0249428_120_791 223
426 3300048917 Ga0496114_0213876 Ga0496114_0213876_810_1481 223
427 3300050511 nmdc:mga08y16_298408_c1 nmdc:mga08y16_298408_c1_584_1255 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

22

97

0.98

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

31

98

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

26

103

0.92

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

131

223

0.89

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

147

218

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f05-assembly2.cif.gz_B arabidopsis thaliana gstf9, gso3 bound 0.9024 7 213
6f05-assembly6.cif.gz_H arabidopsis thaliana gstf9, gso3 bound 0.9014 7 213
6f05-assembly4.cif.gz_E arabidopsis thaliana gstf9, gso3 bound 0.8989 7 213
6f05-assembly2.cif.gz_A arabidopsis thaliana gstf9, gso3 bound 0.8986 7 213
5g5a-assembly2.cif.gz_D glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide 0.8966 6 213
ID Description Score Start End Superfamily
5zfgB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9762 7 83 3.40.30.10
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.976 10 84 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9668 9 82 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9646 10 75 3.40.30.10
4ielA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9638 6 82 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A351ST55-F1-model_v4 Glutathione S-transferase 0.9789 7 82 GO:0005737
GO:0016740
AF-A0A7C7FQU3-F1-model_v4 Glutathione S-transferase family protein 0.9763 7 75 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A7J5ZZA1-F1-model_v4 GST N-terminal domain-containing protein 0.9706 2 84 GO:0000266
GO:0005741
GO:0006626
GO:0008053
AF-A0A7Y4XZS1-F1-model_v4 Glutathione S-transferase family protein 0.9684 6 220 GO:0005737
GO:0016740
AF-A0A7Y4UMQ4-F1-model_v4 Glutathione S-transferase family protein 0.9677 6 126 GO:0016740

Feature Viewer

pLDDT pTM Quality
94.04 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map