F441545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 427 | 231 | 425 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300049574|Ga0501038_0044394|Ga0501038_0044394_460_1167 |
| Length | 235 |
| Sequence | VGEGRREFRYESVSALQWDTIMTLTFYYGSGSPYAWKVWLALEHKGLPYEAKRLMFDPDQTKTPDYLKINPRGRVPAIVDGDFPLYESNAIVEYLEDRYPEKPLLPKDAKARALARRLMAEADSYLGTIGGELMDATLYTKAEERDPKKIAELKAKVGEELKRWEANLTGDYFAGALGLADYATYPWARMLVRAEERGPGLGFKREELPPKLAAWLKRIEALPYYDKTVPPHWRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 3 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 177 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 178 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 179 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 224 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 225 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 226 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 227 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 228 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 230 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 231 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0 |
| Isolates | 0.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.41 |
| Nodule | 0 |
| Rhizoplane | 4.45 |
| Rhizosphere | 93.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_8558565 | 2162886012 | Bacteria | 1078 |
| 2 | JGI24034J26672_10030228 | 3300002239 | Bacteria | 879 |
| 3 | rootL2_10145446 | 3300003322 | Bacteria | 2585 |
| 4 | JGI25404J52841_10001695 | 3300003659 | Bacteria | 3967 |
| 5 | Ga0065715_10124124 | 3300005293 | Bacteria | 2157 |
| 6 | Ga0065715_10301983 | 3300005293 | Bacteria | 1039 |
| 7 | Ga0070658_10028337 | 3300005327 | Bacteria | 4494 |
| 8 | Ga0070658_10098271 | 3300005327 | Bacteria | 2418 |
| 9 | Ga0070683_100407092 | 3300005329 | Bacteria | 1297 |
| 10 | Ga0070690_100007631 | 3300005330 | Bacteria | 6196 |
| 11 | Ga0070690_100404795 | 3300005330 | Bacteria | 1003 |
| 12 | Ga0070670_100365523 | 3300005331 | Bacteria | 1269 |
| 13 | Ga0070670_100435019 | 3300005331 | Unclassified | 1161 |
| 14 | Ga0070677_10197697 | 3300005333 | Bacteria | 968 |
| 15 | Ga0068869_100021892 | 3300005334 | Bacteria | 4399 |
| 16 | Ga0068869_100062217 | 3300005334 | Bacteria | 2739 |
| 17 | Ga0068869_100271403 | 3300005334 | Bacteria | 1361 |
| 18 | Ga0070666_10259898 | 3300005335 | Bacteria | 1231 |
| 19 | Ga0070680_100002368 | 3300005336 | Bacteria | 13929 |
| 20 | Ga0070680_100164852 | 3300005336 | Bacteria | 1863 |
| 21 | Ga0068868_100095044 | 3300005338 | Bacteria | 2405 |
| 22 | Ga0068868_100095063 | 3300005338 | Bacteria | 2405 |
| 23 | Ga0070660_100217597 | 3300005339 | Bacteria | 1552 |
| 24 | Ga0070689_100012055 | 3300005340 | Bacteria | 6214 |
| 25 | Ga0070689_100232763 | 3300005340 | Bacteria | 1515 |
| 26 | Ga0070691_10006388 | 3300005341 | Bacteria | 5388 |
| 27 | Ga0070661_100549735 | 3300005344 | Unclassified | 929 |
| 28 | Ga0070668_100001234 | 3300005347 | Bacteria | 18213 |
| 29 | Ga0070668_100276766 | 3300005347 | Bacteria | 1400 |
| 30 | Ga0070669_100116981 | 3300005353 | Unclassified | 2029 |
| 31 | Ga0070669_100418706 | 3300005353 | Unclassified | 1099 |
| 32 | Ga0070671_100161842 | 3300005355 | Bacteria | 1892 |
| 33 | Ga0070674_100013942 | 3300005356 | Bacteria | 4983 |
| 34 | Ga0070674_100014133 | 3300005356 | Bacteria | 4957 |
| 35 | Ga0070674_100104872 | 3300005356 | Bacteria | 2066 |
| 36 | Ga0070674_100208070 | 3300005356 | Bacteria | 1515 |
| 37 | Ga0070674_100350912 | 3300005356 | Bacteria | 1192 |
| 38 | Ga0070674_100417879 | 3300005356 | Unclassified | 1099 |
| 39 | Ga0070674_100442780 | 3300005356 | Bacteria | 1071 |
| 40 | Ga0070673_100015599 | 3300005364 | Bacteria | 5343 |
| 41 | Ga0070673_100369090 | 3300005364 | Bacteria | 1277 |
| 42 | Ga0070688_100070220 | 3300005365 | Bacteria | 2239 |
| 43 | Ga0070688_100074500 | 3300005365 | Bacteria | 2180 |
| 44 | Ga0070659_100113199 | 3300005366 | Bacteria | 2192 |
| 45 | Ga0070667_100380019 | 3300005367 | Bacteria | 1283 |
| 46 | Ga0070710_10136497 | 3300005437 | Bacteria | 1500 |
| 47 | Ga0070701_10124593 | 3300005438 | Bacteria | 1456 |
| 48 | Ga0070701_10276442 | 3300005438 | Unclassified | 1024 |
| 49 | Ga0070701_10354080 | 3300005438 | Unclassified | 918 |
| 50 | Ga0070705_100331099 | 3300005440 | Unclassified | 1103 |
| 51 | Ga0070700_100046178 | 3300005441 | Bacteria | 2690 |
| 52 | Ga0070694_100085108 | 3300005444 | Bacteria | 2207 |
| 53 | Ga0070708_100000323 | 3300005445 | Bacteria | 36020 |
| 54 | Ga0070708_100246388 | 3300005445 | Bacteria | 1678 |
| 55 | Ga0070663_100194905 | 3300005455 | Bacteria | 1578 |
| 56 | Ga0070663_100318808 | 3300005455 | Bacteria | 1249 |
| 57 | Ga0070678_100001798 | 3300005456 | Bacteria | 11554 |
| 58 | Ga0070678_100261938 | 3300005456 | Bacteria | 1454 |
| 59 | Ga0070678_100554200 | 3300005456 | Unclassified | 1021 |
| 60 | Ga0070662_100293074 | 3300005457 | Bacteria | 1319 |
| 61 | Ga0070662_100749881 | 3300005457 | Unclassified | 828 |
| 62 | Ga0070681_10000602 | 3300005458 | Bacteria | 29598 |
| 63 | Ga0070681_10018251 | 3300005458 | Bacteria | 7011 |
| 64 | Ga0070681_10132978 | 3300005458 | Bacteria | 2419 |
| 65 | Ga0070681_10345498 | 3300005458 | Bacteria | 1398 |
| 66 | Ga0068867_100059597 | 3300005459 | Bacteria | 2829 |
| 67 | Ga0068867_100526580 | 3300005459 | Unclassified | 1020 |
| 68 | Ga0068867_100549567 | 3300005459 | Unclassified | 1000 |
| 69 | Ga0068867_100597392 | 3300005459 | Unclassified | 962 |
| 70 | Ga0070685_10048251 | 3300005466 | Bacteria | 2452 |
| 71 | Ga0070685_10296427 | 3300005466 | Bacteria | 1088 |
| 72 | Ga0070698_100192530 | 3300005471 | Bacteria | 1976 |
| 73 | Ga0070699_100283134 | 3300005518 | Bacteria | 1485 |
| 74 | Ga0070679_100005262 | 3300005530 | Bacteria | 11976 |
| 75 | Ga0070679_100075892 | 3300005530 | Bacteria | 3351 |
| 76 | Ga0070672_100046028 | 3300005543 | Bacteria | 3379 |
| 77 | Ga0070672_100162353 | 3300005543 | Bacteria | 1854 |
| 78 | Ga0070686_100065350 | 3300005544 | Bacteria | 2363 |
| 79 | Ga0070693_100207648 | 3300005547 | Bacteria | 1276 |
| 80 | Ga0070693_100233643 | 3300005547 | Unclassified | 1211 |
| 81 | Ga0070665_100135367 | 3300005548 | Bacteria | 2466 |
| 82 | Ga0070704_100026779 | 3300005549 | Bacteria | 3815 |
| 83 | Ga0070704_100543240 | 3300005549 | Bacteria | 1014 |
| 84 | Ga0068855_100049973 | 3300005563 | Bacteria | 4929 |
| 85 | Ga0068855_100077118 | 3300005563 | Bacteria | 3867 |
| 86 | Ga0070664_100084932 | 3300005564 | Bacteria | 2733 |
| 87 | Ga0070664_100089726 | 3300005564 | Bacteria | 2660 |
| 88 | Ga0068857_100059912 | 3300005577 | Bacteria | 3382 |
| 89 | Ga0068857_100710783 | 3300005577 | Bacteria | 955 |
| 90 | Ga0068854_100070564 | 3300005578 | Bacteria | 2553 |
| 91 | Ga0068852_100008091 | 3300005616 | Bacteria | 7715 |
| 92 | Ga0068852_100301457 | 3300005616 | Bacteria | 1551 |
| 93 | Ga0068852_100599915 | 3300005616 | Bacteria | 1105 |
| 94 | Ga0068852_100661139 | 3300005616 | Bacteria | 1053 |
| 95 | Ga0068852_100995577 | 3300005616 | Unclassified | 857 |
| 96 | Ga0068852_101111119 | 3300005616 | Unclassified | 811 |
| 97 | Ga0068859_100048051 | 3300005617 | Bacteria | 4287 |
| 98 | Ga0068859_100267811 | 3300005617 | Bacteria | 1800 |
| 99 | Ga0068859_100285558 | 3300005617 | Bacteria | 1743 |
| 100 | Ga0068859_100335636 | 3300005617 | Bacteria | 1606 |
| 101 | Ga0068859_100446660 | 3300005617 | Bacteria | 1389 |
| 102 | Ga0068859_100491938 | 3300005617 | Unclassified | 1322 |
| 103 | Ga0068864_100069106 | 3300005618 | Bacteria | 3071 |
| 104 | Ga0068864_100082909 | 3300005618 | Bacteria | 2815 |
| 105 | Ga0068866_10606716 | 3300005718 | Unclassified | 740 |
| 106 | Ga0068861_100073550 | 3300005719 | Bacteria | 2655 |
| 107 | Ga0068861_100226536 | 3300005719 | Unclassified | 1583 |
| 108 | Ga0068861_100274509 | 3300005719 | Bacteria | 1449 |
| 109 | Ga0068861_101265956 | 3300005719 | Bacteria | 716 |
| 110 | Ga0068851_10051433 | 3300005834 | Bacteria | 2094 |
| 111 | Ga0068870_10002667 | 3300005840 | Bacteria | 7474 |
| 112 | Ga0068863_100177975 | 3300005841 | Bacteria | 2041 |
| 113 | Ga0068863_100322388 | 3300005841 | Bacteria | 1501 |
| 114 | Ga0068863_100352453 | 3300005841 | Bacteria | 1433 |
| 115 | Ga0068863_100375894 | 3300005841 | Bacteria | 1387 |
| 116 | Ga0068863_100606224 | 3300005841 | Bacteria | 1084 |
| 117 | Ga0068858_100043387 | 3300005842 | Bacteria | 4170 |
| 118 | Ga0068858_100111109 | 3300005842 | Bacteria | 2559 |
| 119 | Ga0068858_100153990 | 3300005842 | Bacteria | 2162 |
| 120 | Ga0068860_100186050 | 3300005843 | Bacteria | 2009 |
| 121 | Ga0068860_100200072 | 3300005843 | Bacteria | 1936 |
| 122 | Ga0068862_100173512 | 3300005844 | Bacteria | 1931 |
| 123 | Ga0068862_100229521 | 3300005844 | Bacteria | 1683 |
| 124 | Ga0068862_100247168 | 3300005844 | Bacteria | 1624 |
| 125 | Ga0081455_10001961 | 3300005937 | Bacteria | 24695 |
| 126 | Ga0081455_10004630 | 3300005937 | Bacteria | 15337 |
| 127 | Ga0081455_10013073 | 3300005937 | Bacteria | 8228 |
| 128 | Ga0081455_10125869 | 3300005937 | Bacteria | 2011 |
| 129 | Ga0081540_1010932 | 3300005983 | Bacteria | 6096 |
| 130 | Ga0081540_1093557 | 3300005983 | Bacteria | 1316 |
| 131 | Ga0081539_10215561 | 3300005985 | Unclassified | 877 |
| 132 | Ga0070716_100440812 | 3300006173 | Bacteria | 947 |
| 133 | Ga0097621_100011843 | 3300006237 | Bacteria | 6445 |
| 134 | Ga0097621_100031376 | 3300006237 | Bacteria | 4217 |
| 135 | Ga0097621_100036704 | 3300006237 | Bacteria | 3922 |
| 136 | Ga0097621_100363992 | 3300006237 | Bacteria | 1289 |
| 137 | Ga0097621_100503988 | 3300006237 | Unclassified | 1097 |
| 138 | Ga0068871_100009861 | 3300006358 | Bacteria | 6935 |
| 139 | Ga0068871_100045967 | 3300006358 | Bacteria | 3515 |
| 140 | Ga0068871_100088971 | 3300006358 | Bacteria | 2570 |
| 141 | Ga0068871_100219734 | 3300006358 | Bacteria | 1646 |
| 142 | Ga0075428_100039313 | 3300006844 | Bacteria | 5206 |
| 143 | Ga0075428_101206732 | 3300006844 | Bacteria | 797 |
| 144 | Ga0075431_100398498 | 3300006847 | Bacteria | 1378 |
| 145 | Ga0075433_10841130 | 3300006852 | Bacteria | 801 |
| 146 | Ga0075434_100603505 | 3300006871 | Unclassified | 1117 |
| 147 | Ga0068865_100078607 | 3300006881 | Bacteria | 2360 |
| 148 | Ga0068865_100125002 | 3300006881 | Bacteria | 1919 |
| 149 | Ga0068865_100241773 | 3300006881 | Bacteria | 1421 |
| 150 | Ga0068865_100313816 | 3300006881 | Bacteria | 1259 |
| 151 | Ga0068865_100667669 | 3300006881 | Bacteria | 885 |
| 152 | Ga0097620_100048052 | 3300006931 | Bacteria | 4287 |
| 153 | Ga0097620_100267784 | 3300006931 | Bacteria | 1800 |
| 154 | Ga0097620_100285577 | 3300006931 | Bacteria | 1743 |
| 155 | Ga0097620_100335656 | 3300006931 | Bacteria | 1606 |
| 156 | Ga0097620_100446716 | 3300006931 | Bacteria | 1389 |
| 157 | Ga0097620_100491873 | 3300006931 | Unclassified | 1322 |
| 158 | Ga0105240_10008364 | 3300009093 | Bacteria | 14807 |
| 159 | Ga0105240_10027254 | 3300009093 | Bacteria | 7483 |
| 160 | Ga0105240_10828352 | 3300009093 | Bacteria | 1000 |
| 161 | Ga0105245_10044707 | 3300009098 | Bacteria | 3954 |
| 162 | Ga0105245_10068983 | 3300009098 | Bacteria | 3205 |
| 163 | Ga0105245_10533883 | 3300009098 | Bacteria | 1193 |
| 164 | Ga0105247_10020166 | 3300009101 | Bacteria | 4008 |
| 165 | Ga0114129_10113411 | 3300009147 | Bacteria | 3738 |
| 166 | Ga0114129_10668908 | 3300009147 | Bacteria | 1338 |
| 167 | Ga0114129_10997145 | 3300009147 | Unclassified | 1055 |
| 168 | Ga0114129_11494111 | 3300009147 | Bacteria | 830 |
| 169 | Ga0105243_10021269 | 3300009148 | Bacteria | 4924 |
| 170 | Ga0105243_10075904 | 3300009148 | Bacteria | 2729 |
| 171 | Ga0105242_10202908 | 3300009176 | Bacteria | 1762 |
| 172 | Ga0105248_10008166 | 3300009177 | Bacteria | 11498 |
| 173 | Ga0105248_10043423 | 3300009177 | Bacteria | 5040 |
| 174 | Ga0105248_10681504 | 3300009177 | Bacteria | 1160 |
| 175 | Ga0105248_10770191 | 3300009177 | Unclassified | 1086 |
| 176 | Ga0105248_11010541 | 3300009177 | Bacteria | 939 |
| 177 | Ga0105237_10063272 | 3300009545 | Bacteria | 3697 |
| 178 | Ga0105238_10271790 | 3300009551 | Bacteria | 1675 |
| 179 | Ga0105249_10061457 | 3300009553 | Bacteria | 3447 |
| 180 | Ga0105249_10883638 | 3300009553 | Unclassified | 960 |
| 181 | Ga0105239_10292435 | 3300010375 | Bacteria | 1834 |
| 182 | Ga0105239_10798193 | 3300010375 | Bacteria | 1081 |
| 183 | Ga0105246_10023329 | 3300011119 | Bacteria | 4002 |
| 184 | Ga0157369_11111327 | 3300013105 | Bacteria | 808 |
| 185 | Ga0157374_10063778 | 3300013296 | Bacteria | 3456 |
| 186 | Ga0157374_10208048 | 3300013296 | Bacteria | 1918 |
| 187 | Ga0157374_10285991 | 3300013296 | Bacteria | 1629 |
| 188 | Ga0157378_10018037 | 3300013297 | Bacteria | 6197 |
| 189 | Ga0157378_10074687 | 3300013297 | Bacteria | 3051 |
| 190 | Ga0157378_10108814 | 3300013297 | Bacteria | 2538 |
| 191 | Ga0157378_10331452 | 3300013297 | Bacteria | 1481 |
| 192 | Ga0157378_10899060 | 3300013297 | Bacteria | 916 |
| 193 | Ga0157378_11091142 | 3300013297 | Bacteria | 835 |
| 194 | Ga0163162_10087222 | 3300013306 | Bacteria | 3199 |
| 195 | Ga0163162_10241411 | 3300013306 | Bacteria | 1938 |
| 196 | Ga0163162_10287789 | 3300013306 | Bacteria | 1775 |
| 197 | Ga0163162_10992021 | 3300013306 | Unclassified | 949 |
| 198 | Ga0163162_11073954 | 3300013306 | Unclassified | 912 |
| 199 | Ga0163162_11091976 | 3300013306 | Unclassified | 904 |
| 200 | Ga0157375_10387578 | 3300013308 | Bacteria | 1564 |
| 201 | Ga0157375_11291870 | 3300013308 | Unclassified | 858 |
| 202 | Ga0163163_10143386 | 3300014325 | Bacteria | 2431 |
| 203 | Ga0163163_10474749 | 3300014325 | Bacteria | 1311 |
| 204 | Ga0163163_10532298 | 3300014325 | Bacteria | 1237 |
| 205 | Ga0157380_10012519 | 3300014326 | Bacteria | 6156 |
| 206 | Ga0157380_10040379 | 3300014326 | Bacteria | 3634 |
| 207 | Ga0157380_10345882 | 3300014326 | Bacteria | 1389 |
| 208 | Ga0157377_10053277 | 3300014745 | Bacteria | 2287 |
| 209 | Ga0157377_10487141 | 3300014745 | Unclassified | 859 |
| 210 | Ga0157377_10539642 | 3300014745 | Bacteria | 822 |
| 211 | Ga0157379_10018354 | 3300014968 | Bacteria | 6167 |
| 212 | Ga0157379_10142336 | 3300014968 | Bacteria | 2162 |
| 213 | Ga0157379_10171216 | 3300014968 | Bacteria | 1960 |
| 214 | Ga0157379_10814844 | 3300014968 | Unclassified | 882 |
| 215 | Ga0157376_10040882 | 3300014969 | Bacteria | 3792 |
| 216 | Ga0157376_10041283 | 3300014969 | Bacteria | 3776 |
| 217 | Ga0157376_10048669 | 3300014969 | Bacteria | 3507 |
| 218 | Ga0157376_10114426 | 3300014969 | Bacteria | 2380 |
| 219 | Ga0157376_10146917 | 3300014969 | Bacteria | 2122 |
| 220 | Ga0163161_10218778 | 3300017792 | Bacteria | 1474 |
| 221 | Ga0209256_1052183 | 3300025299 | Bacteria | 984 |
| 222 | Ga0207697_10000450 | 3300025315 | Bacteria | 23178 |
| 223 | Ga0207656_10052609 | 3300025321 | Bacteria | 1764 |
| 224 | Ga0207656_10059405 | 3300025321 | Bacteria | 1673 |
| 225 | Ga0207682_10001065 | 3300025893 | Bacteria | 12657 |
| 226 | Ga0207642_10009845 | 3300025899 | Bacteria | 3343 |
| 227 | Ga0207642_10210741 | 3300025899 | Bacteria | 1079 |
| 228 | Ga0207688_10005210 | 3300025901 | Bacteria | 7067 |
| 229 | Ga0207680_10057065 | 3300025903 | Bacteria | 2361 |
| 230 | Ga0207680_10256232 | 3300025903 | Bacteria | 1210 |
| 231 | Ga0207645_10005257 | 3300025907 | Bacteria | 9428 |
| 232 | Ga0207645_10252052 | 3300025907 | Unclassified | 1168 |
| 233 | Ga0207643_10000429 | 3300025908 | Bacteria | 27769 |
| 234 | Ga0207705_10012755 | 3300025909 | Bacteria | 6064 |
| 235 | Ga0207705_10027516 | 3300025909 | Bacteria | 4055 |
| 236 | Ga0207707_10017046 | 3300025912 | Bacteria | 6328 |
| 237 | Ga0207707_10441140 | 3300025912 | Bacteria | 1114 |
| 238 | Ga0207695_10057419 | 3300025913 | Bacteria | 4043 |
| 239 | Ga0207695_10078665 | 3300025913 | Bacteria | 3345 |
| 240 | Ga0207671_10249231 | 3300025914 | Bacteria | 1396 |
| 241 | Ga0207663_10557122 | 3300025916 | Bacteria | 897 |
| 242 | Ga0207660_10037685 | 3300025917 | Bacteria | 3371 |
| 243 | Ga0207662_10025717 | 3300025918 | Bacteria | 3391 |
| 244 | Ga0207657_10052097 | 3300025919 | Bacteria | 3554 |
| 245 | Ga0207649_10107837 | 3300025920 | Bacteria | 1855 |
| 246 | Ga0207652_10007355 | 3300025921 | Bacteria | 8878 |
| 247 | Ga0207652_10055014 | 3300025921 | Bacteria | 3422 |
| 248 | Ga0207681_10319054 | 3300025923 | Bacteria | 1235 |
| 249 | Ga0207681_10458387 | 3300025923 | Unclassified | 1038 |
| 250 | Ga0207694_10388843 | 3300025924 | Bacteria | 1159 |
| 251 | Ga0207650_10000503 | 3300025925 | Bacteria | 32602 |
| 252 | Ga0207650_10666725 | 3300025925 | Bacteria | 877 |
| 253 | Ga0207659_10133666 | 3300025926 | Bacteria | 1918 |
| 254 | Ga0207659_10290020 | 3300025926 | Unclassified | 1340 |
| 255 | Ga0207659_10528528 | 3300025926 | Bacteria | 1001 |
| 256 | Ga0207687_10152124 | 3300025927 | Bacteria | 1767 |
| 257 | Ga0207644_10109924 | 3300025931 | Bacteria | 2083 |
| 258 | Ga0207644_10361202 | 3300025931 | Bacteria | 1181 |
| 259 | Ga0207706_10007746 | 3300025933 | Bacteria | 9914 |
| 260 | Ga0207706_10340291 | 3300025933 | Bacteria | 1305 |
| 261 | Ga0207686_10053460 | 3300025934 | Bacteria | 2525 |
| 262 | Ga0207709_10123347 | 3300025935 | Bacteria | 1753 |
| 263 | Ga0207670_10035360 | 3300025936 | Bacteria | 3238 |
| 264 | Ga0207670_10052370 | 3300025936 | Bacteria | 2744 |
| 265 | Ga0207669_10051658 | 3300025937 | Bacteria | 2464 |
| 266 | Ga0207669_10139798 | 3300025937 | Bacteria | 1679 |
| 267 | Ga0207669_10317309 | 3300025937 | Unclassified | 1191 |
| 268 | Ga0207704_10099930 | 3300025938 | Bacteria | 1931 |
| 269 | Ga0207704_10165180 | 3300025938 | Bacteria | 1580 |
| 270 | Ga0207704_10180661 | 3300025938 | Bacteria | 1524 |
| 271 | Ga0207665_10196794 | 3300025939 | Bacteria | 1467 |
| 272 | Ga0207691_10016285 | 3300025940 | Bacteria | 7058 |
| 273 | Ga0207691_10019836 | 3300025940 | Bacteria | 6359 |
| 274 | Ga0207691_10063574 | 3300025940 | Bacteria | 3347 |
| 275 | Ga0207691_10205771 | 3300025940 | Bacteria | 1712 |
| 276 | Ga0207691_10416447 | 3300025940 | Bacteria | 1145 |
| 277 | Ga0207691_10922781 | 3300025940 | Bacteria | 730 |
| 278 | Ga0207711_10391942 | 3300025941 | Bacteria | 1290 |
| 279 | Ga0207711_10726402 | 3300025941 | Unclassified | 926 |
| 280 | Ga0207711_10785594 | 3300025941 | Bacteria | 887 |
| 281 | Ga0207689_10008198 | 3300025942 | Bacteria | 9104 |
| 282 | Ga0207689_10018096 | 3300025942 | Bacteria | 5950 |
| 283 | Ga0207689_10239300 | 3300025942 | Bacteria | 1500 |
| 284 | Ga0207661_10366093 | 3300025944 | Bacteria | 1303 |
| 285 | Ga0207679_10589661 | 3300025945 | Bacteria | 1000 |
| 286 | Ga0207667_10027691 | 3300025949 | Bacteria | 6165 |
| 287 | Ga0207667_10073073 | 3300025949 | Bacteria | 3564 |
| 288 | Ga0207651_10119921 | 3300025960 | Bacteria | 1993 |
| 289 | Ga0207668_10070956 | 3300025972 | Bacteria | 2486 |
| 290 | Ga0207640_10585995 | 3300025981 | Bacteria | 942 |
| 291 | Ga0207658_10286705 | 3300025986 | Bacteria | 1413 |
| 292 | Ga0207658_10290122 | 3300025986 | Bacteria | 1406 |
| 293 | Ga0207677_10476563 | 3300026023 | Bacteria | 1074 |
| 294 | Ga0207677_10934960 | 3300026023 | Bacteria | 783 |
| 295 | Ga0207678_10030688 | 3300026067 | Bacteria | 4693 |
| 296 | Ga0207678_10176916 | 3300026067 | Bacteria | 1822 |
| 297 | Ga0207708_10002412 | 3300026075 | Bacteria | 13719 |
| 298 | Ga0207702_10356838 | 3300026078 | Bacteria | 1400 |
| 299 | Ga0207702_10482440 | 3300026078 | Bacteria | 1206 |
| 300 | Ga0207641_10053128 | 3300026088 | Bacteria | 3433 |
| 301 | Ga0207641_10080485 | 3300026088 | Bacteria | 2826 |
| 302 | Ga0207641_10225373 | 3300026088 | Bacteria | 1740 |
| 303 | Ga0207648_10030219 | 3300026089 | Bacteria | 4800 |
| 304 | Ga0207648_10110192 | 3300026089 | Bacteria | 2417 |
| 305 | Ga0207648_10232217 | 3300026089 | Bacteria | 1641 |
| 306 | Ga0207648_10299998 | 3300026089 | Bacteria | 1441 |
| 307 | Ga0207648_10405384 | 3300026089 | Unclassified | 1236 |
| 308 | Ga0207676_10068605 | 3300026095 | Bacteria | 2837 |
| 309 | Ga0207676_10185965 | 3300026095 | Bacteria | 1823 |
| 310 | Ga0207676_10216066 | 3300026095 | Bacteria | 1704 |
| 311 | Ga0207676_10325186 | 3300026095 | Unclassified | 1413 |
| 312 | Ga0207674_10028929 | 3300026116 | Bacteria | 5841 |
| 313 | Ga0207675_100029465 | 3300026118 | Bacteria | 5114 |
| 314 | Ga0207675_100227033 | 3300026118 | Bacteria | 1800 |
| 315 | Ga0207675_100447719 | 3300026118 | Bacteria | 1279 |
| 316 | Ga0207683_10017865 | 3300026121 | Bacteria | 6049 |
| 317 | Ga0207683_10020743 | 3300026121 | Bacteria | 5622 |
| 318 | Ga0207683_10038992 | 3300026121 | Bacteria | 4143 |
| 319 | Ga0207683_10120299 | 3300026121 | Bacteria | 2357 |
| 320 | Ga0207683_10190506 | 3300026121 | Bacteria | 1862 |
| 321 | Ga0207683_10380982 | 3300026121 | Bacteria | 1296 |
| 322 | Ga0207698_10016411 | 3300026142 | Bacteria | 4990 |
| 323 | Ga0207698_10090632 | 3300026142 | Bacteria | 2501 |
| 324 | Ga0207698_10304473 | 3300026142 | Bacteria | 1485 |
| 325 | Ga0268266_11007650 | 3300028379 | Unclassified | 806 |
| 326 | Ga0268265_10154031 | 3300028380 | Bacteria | 1942 |
| 327 | Ga0268265_10243006 | 3300028380 | Bacteria | 1590 |
| 328 | Ga0268265_11236129 | 3300028380 | Unclassified | 745 |
| 329 | Ga0268264_10477170 | 3300028381 | Bacteria | 1212 |
| 330 | Ga0265331_10001361 | 3300031250 | Bacteria | 17957 |
| 331 | Ga0307408_100392240 | 3300031548 | Bacteria | 1190 |
| 332 | Ga0265313_10000079 | 3300031595 | Bacteria | 95515 |
| 333 | Ga0265342_10007594 | 3300031712 | Bacteria | 7914 |
| 334 | Ga0307413_10351702 | 3300031824 | Bacteria | 1137 |
| 335 | Ga0307406_10024397 | 3300031901 | Bacteria | 3612 |
| 336 | Ga0307406_10631740 | 3300031901 | Bacteria | 887 |
| 337 | Ga0307412_10013487 | 3300031911 | Bacteria | 4795 |
| 338 | Ga0307412_10338097 | 3300031911 | Bacteria | 1204 |
| 339 | Ga0307416_100108643 | 3300032002 | Bacteria | 2438 |
| 340 | Ga0307411_10507714 | 3300032005 | Bacteria | 1021 |
| 341 | Ga0373936_0075025 | 3300035113 | Bacteria | 1400 |
| 342 | Ga0373945_0125792 | 3300035116 | Bacteria | 1023 |
| 343 | Ga0373946_0077233 | 3300035171 | Bacteria | 1451 |
| 344 | Ga0373955_0200401 | 3300035172 | Bacteria | 1188 |
| 345 | Ga0373927_0189124 | 3300035695 | Bacteria | 1351 |
| 346 | Ga0373947_0014765 | 3300035725 | Bacteria | 4481 |
| 347 | Ga0373937_0895055 | 3300036401 | Bacteria | 836 |
| 348 | Ga0373925_0096702 | 3300037068 | Bacteria | 2264 |
| 349 | Ga0395899_0013348 | 3300037312 | Bacteria | 6283 |
| 350 | Ga0395900_0093991 | 3300037418 | Bacteria | 3080 |
| 351 | Ga0395901_0050188 | 3300038443 | Unclassified | 4336 |
| 352 | Ga0436365_0932038 | 3300039437 | Bacteria | 3020 |
| 353 | Ga0436361_0597188 | 3300039447 | Bacteria | 2654 |
| 354 | Ga0451853_3760387 | 3300041512 | Bacteria | 2428 |
| 355 | Ga0450889_020016 | 3300042144 | Unclassified | 739 |
| 356 | Ga0439435_0103065 | 3300042436 | Bacteria | 879 |
| 357 | Ga0451577_0306824 | 3300042876 | Bacteria | 1438 |
| 358 | Ga0495580_0121646 | 3300046472 | Unclassified | 1812 |
| 359 | Ga0495598_0058122 | 3300046537 | Bacteria | 1186 |
| 360 | Ga0495598_0094325 | 3300046537 | Bacteria | 981 |
| 361 | Ga0495621_0079491 | 3300046539 | Bacteria | 1221 |
| 362 | Ga0495645_0057791 | 3300046543 | Bacteria | 2815 |
| 363 | Ga0495656_0095605 | 3300046615 | Bacteria | 1366 |
| 364 | Ga0495599_0154951 | 3300046678 | Unclassified | 1418 |
| 365 | Ga0496100_0027925 | 3300048903 | Bacteria | 3476 |
| 366 | Ga0496102_0048596 | 3300048905 | Bacteria | 3858 |
| 367 | Ga0496102_0697721 | 3300048905 | Bacteria | 938 |
| 368 | Ga0496104_0004348 | 3300048907 | Bacteria | 12323 |
| 369 | Ga0496104_0008354 | 3300048907 | Bacteria | 9200 |
| 370 | Ga0496104_0932356 | 3300048907 | Bacteria | 773 |
| 371 | Ga0496106_0124021 | 3300048909 | Bacteria | 2021 |
| 372 | Ga0496107_0051192 | 3300048910 | Bacteria | 2978 |
| 373 | Ga0496108_0003909 | 3300048911 | Bacteria | 11967 |
| 374 | Ga0496109_0013713 | 3300048912 | Bacteria | 7040 |
| 375 | Ga0496109_0175977 | 3300048912 | Bacteria | 2009 |
| 376 | Ga0496110_0016519 | 3300048913 | Bacteria | 6163 |
| 377 | Ga0496110_0042180 | 3300048913 | Bacteria | 3983 |
| 378 | Ga0496111_0330839 | 3300048914 | Bacteria | 1128 |
| 379 | Ga0496111_0340004 | 3300048914 | Bacteria | 1111 |
| 380 | Ga0496112_0249428 | 3300048915 | Bacteria | 1727 |
| 381 | Ga0496112_0675955 | 3300048915 | Bacteria | 961 |
| 382 | Ga0496113_0220243 | 3300048916 | Bacteria | 1512 |
| 383 | Ga0496114_0213876 | 3300048917 | Bacteria | 1691 |
| 384 | Ga0501032_0040178 | 3300049569 | Bacteria | 3180 |
| 385 | Ga0501033_0004364 | 3300049570 | Bacteria | 11336 |
| 386 | Ga0501036_0011802 | 3300049572 | Bacteria | 7241 |
| 387 | Ga0501037_0023177 | 3300049573 | Bacteria | 4591 |
| 388 | Ga0501037_0075128 | 3300049573 | Bacteria | 2455 |
| 389 | Ga0501038_0002188 | 3300049574 | Bacteria | 18177 |
| 390 | Ga0501038_0044394 | 3300049574 | Bacteria | 3862 |
| 391 | Ga0501046_0010435 | 3300049580 | Bacteria | 7978 |
| 392 | Ga0501047_0404552 | 3300049581 | Bacteria | 1198 |
| 393 | Ga0501048_0039910 | 3300049582 | Bacteria | 3365 |
| 394 | Ga0501067_0002220 | 3300049583 | Bacteria | 10735 |
| 395 | Ga0501067_0105511 | 3300049583 | Bacteria | 1566 |
| 396 | Ga0501068_0008761 | 3300049584 | Bacteria | 5645 |
| 397 | Ga0501069_0001701 | 3300049585 | Bacteria | 10958 |
| 398 | Ga0501070_0001886 | 3300049586 | Bacteria | 18536 |
| 399 | Ga0501070_0088968 | 3300049586 | Bacteria | 2556 |
| 400 | Ga0501070_0243615 | 3300049586 | Bacteria | 1471 |
| 401 | Ga0501073_0000287 | 3300049589 | Bacteria | 33235 |
| 402 | Ga0501074_0001317 | 3300049590 | Bacteria | 16470 |
| 403 | Ga0501076_0082486 | 3300049592 | Bacteria | 2581 |
| 404 | Ga0501076_0280120 | 3300049592 | Bacteria | 1366 |
| 405 | Ga0501080_0164016 | 3300049742 | Bacteria | 2051 |
| 406 | Ga0501080_0398438 | 3300049742 | Bacteria | 1238 |
| 407 | Ga0501080_0710356 | 3300049742 | Bacteria | 886 |
| 408 | Ga0501083_0036866 | 3300049744 | Bacteria | 3332 |
| 409 | Ga0501035_0037072 | 3300049822 | Bacteria | 4417 |
| 410 | Ga0501035_0044435 | 3300049822 | Bacteria | 4000 |
| 411 | Ga0501044_0009537 | 3300049823 | Bacteria | 10570 |
| 412 | nmdc:mga05p37_112981_c1 | 3300050507 | Bacteria | 2933 |
| 413 | nmdc:mga06r32_132497_c1 | 3300050510 | Bacteria | 2465 |
| 414 | nmdc:mga08y16_298408_c1 | 3300050511 | Bacteria | 1661 |
| 415 | nmdc:mga0n895_866962_c1 | 3300050512 | Bacteria | 890 |
| 416 | Ga0495612_0057621 | 3300053078 | Bacteria | 1604 |
| 417 | Ga0500644_0371496 | 3300053088 | Bacteria | 621 |
| 418 | Ga0500651_0022568 | 3300053093 | Bacteria | 3931 |
| 419 | Ga0500595_000606 | 3300053119 | Bacteria | 21376 |
| 420 | Ga0500577_0004275 | 3300053142 | Bacteria | 3761 |
| 421 | Ga0500588_0041973 | 3300053146 | Bacteria | 1383 |
| 422 | Ga0501084_0024964 | 3300054114 | Bacteria | 4987 |
| 423 | Ga0590071_017742 | 3300059421 | Bacteria | 1672 |
| 424 | Ga0590075_002840 | 3300059424 | Bacteria | 4131 |
| 425 | Ga0501082_0984103 | 3300060353 | Unclassified | 737 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053088 | Ga0500644_0371496 | Ga0500644_0371496_28_570 | 179 |
| 2 | 3300046539 | Ga0495621_0079491 | Ga0495621_0079491_604_1203 | 196 |
| 3 | 3300025925 | Ga0207650_10666725 | Ga0207650_106667252 | 197 |
| 4 | 3300042144 | Ga0450889_020016 | Ga0450889_020016_127_723 | 197 |
| 5 | 3300032002 | Ga0307416_100108643 | Ga0307416_1001086433 | 200 |
| 6 | 3300025299 | Ga0209256_1052183 | Ga0209256_10521832 | 201 |
| 7 | 3300031824 | Ga0307413_10351702 | Ga0307413_103517022 | 204 |
| 8 | 3300049592 | Ga0501076_0280120 | Ga0501076_0280120_651_1268 | 204 |
| 9 | 3300005336 | Ga0070680_100002368 | Ga0070680_1000023683 | 208 |
| 10 | 3300005339 | Ga0070660_100217597 | Ga0070660_1002175972 | 208 |
| 11 | 3300005341 | Ga0070691_10006388 | Ga0070691_100063885 | 208 |
| 12 | 3300005458 | Ga0070681_10018251 | Ga0070681_100182518 | 208 |
| 13 | 3300005530 | Ga0070679_100005262 | Ga0070679_10000526211 | 208 |
| 14 | 3300005563 | Ga0068855_100049973 | Ga0068855_1000499735 | 208 |
| 15 | 3300009093 | Ga0105240_10008364 | Ga0105240_100083642 | 208 |
| 16 | 3300025913 | Ga0207695_10057419 | Ga0207695_100574194 | 208 |
| 17 | 3300025917 | Ga0207660_10037685 | Ga0207660_100376853 | 208 |
| 18 | 3300025921 | Ga0207652_10007355 | Ga0207652_100073554 | 208 |
| 19 | 3300025949 | Ga0207667_10073073 | Ga0207667_100730734 | 208 |
| 20 | 3300026078 | Ga0207702_10482440 | Ga0207702_104824402 | 208 |
| 21 | iso_pu_bacteria | 2883291878 | 2883295298 | 208 |
| 22 | iso_pu_bacteria | 2883354860 | 2883358199 | 208 |
| 23 | 3300003659 | JGI25404J52841_10001695 | JGI25404J52841_100016953 | 209 |
| 24 | 3300005356 | Ga0070674_100013942 | Ga0070674_1000139425 | 209 |
| 25 | 3300005367 | Ga0070667_100380019 | Ga0070667_1003800191 | 209 |
| 26 | 3300005456 | Ga0070678_100001798 | Ga0070678_10000179811 | 209 |
| 27 | 3300005543 | Ga0070672_100046028 | Ga0070672_1000460283 | 209 |
| 28 | 3300005937 | Ga0081455_10004630 | Ga0081455_1000463010 | 209 |
| 29 | 3300005983 | Ga0081540_1010932 | Ga0081540_10109326 | 209 |
| 30 | 3300005983 | Ga0081540_1093557 | Ga0081540_10935572 | 209 |
| 31 | 3300006237 | Ga0097621_100036704 | Ga0097621_1000367043 | 209 |
| 32 | 3300006881 | Ga0068865_100125002 | Ga0068865_1001250023 | 209 |
| 33 | 3300009177 | Ga0105248_10043423 | Ga0105248_100434232 | 209 |
| 34 | 3300013306 | Ga0163162_10087222 | Ga0163162_100872223 | 209 |
| 35 | 3300014968 | Ga0157379_10814844 | Ga0157379_108148441 | 209 |
| 36 | 3300014969 | Ga0157376_10040882 | Ga0157376_100408823 | 209 |
| 37 | 3300025938 | Ga0207704_10099930 | Ga0207704_100999302 | 209 |
| 38 | 3300025940 | Ga0207691_10063574 | Ga0207691_100635743 | 209 |
| 39 | 3300025941 | Ga0207711_10726402 | Ga0207711_107264022 | 209 |
| 40 | 3300026121 | Ga0207683_10017865 | Ga0207683_100178655 | 209 |
| 41 | 3300005334 | Ga0068869_100271403 | Ga0068869_1002714031 | 210 |
| 42 | 3300005455 | Ga0070663_100318808 | Ga0070663_1003188081 | 210 |
| 43 | 3300005549 | Ga0070704_100026779 | Ga0070704_1000267794 | 210 |
| 44 | 3300005564 | Ga0070664_100089726 | Ga0070664_1000897263 | 210 |
| 45 | 3300005577 | Ga0068857_100710783 | Ga0068857_1007107832 | 210 |
| 46 | 3300005616 | Ga0068852_100599915 | Ga0068852_1005999151 | 210 |
| 47 | 3300005937 | Ga0081455_10001961 | Ga0081455_100019615 | 210 |
| 48 | 3300005937 | Ga0081455_10013073 | Ga0081455_100130734 | 210 |
| 49 | 3300006844 | Ga0075428_101206732 | Ga0075428_1012067321 | 210 |
| 50 | 3300006852 | Ga0075433_10841130 | Ga0075433_108411301 | 210 |
| 51 | 3300009147 | Ga0114129_10997145 | Ga0114129_109971452 | 210 |
| 52 | 3300013105 | Ga0157369_11111327 | Ga0157369_111113271 | 210 |
| 53 | 3300013296 | Ga0157374_10063778 | Ga0157374_100637782 | 210 |
| 54 | 3300013306 | Ga0163162_10241411 | Ga0163162_102414113 | 210 |
| 55 | 3300014745 | Ga0157377_10539642 | Ga0157377_105396421 | 210 |
| 56 | 3300025926 | Ga0207659_10528528 | Ga0207659_105285281 | 210 |
| 57 | 3300025942 | Ga0207689_10239300 | Ga0207689_102393001 | 210 |
| 58 | 3300026067 | Ga0207678_10176916 | Ga0207678_101769161 | 210 |
| 59 | 3300026078 | Ga0207702_10356838 | Ga0207702_103568383 | 210 |
| 60 | 3300048905 | Ga0496102_0697721 | Ga0496102_0697721_124_759 | 210 |
| 61 | 3300048907 | Ga0496104_0932356 | Ga0496104_0932356_31_666 | 210 |
| 62 | 3300048914 | Ga0496111_0340004 | Ga0496111_0340004_55_690 | 210 |
| 63 | 3300048915 | Ga0496112_0675955 | Ga0496112_0675955_30_665 | 210 |
| 64 | 3300050512 | nmdc:mga0n895_866962_c1 | nmdc:mga0n895_866962_c1_172_807 | 210 |
| 65 | 3300005344 | Ga0070661_100549735 | Ga0070661_1005497351 | 211 |
| 66 | 3300005356 | Ga0070674_100417879 | Ga0070674_1004178791 | 211 |
| 67 | 3300005438 | Ga0070701_10354080 | Ga0070701_103540801 | 211 |
| 68 | 3300005456 | Ga0070678_100554200 | Ga0070678_1005542001 | 211 |
| 69 | 3300005457 | Ga0070662_100749881 | Ga0070662_1007498811 | 211 |
| 70 | 3300005459 | Ga0068867_100549567 | Ga0068867_1005495672 | 211 |
| 71 | 3300005548 | Ga0070665_100135367 | Ga0070665_1001353674 | 211 |
| 72 | 3300005616 | Ga0068852_100995577 | Ga0068852_1009955771 | 211 |
| 73 | 3300005718 | Ga0068866_10606716 | Ga0068866_106067161 | 211 |
| 74 | 3300005719 | Ga0068861_101265956 | Ga0068861_1012659561 | 211 |
| 75 | 3300009177 | Ga0105248_10770191 | Ga0105248_107701911 | 211 |
| 76 | 3300010375 | Ga0105239_10292435 | Ga0105239_102924351 | 211 |
| 77 | 3300013296 | Ga0157374_10208048 | Ga0157374_102080482 | 211 |
| 78 | 3300013297 | Ga0157378_10899060 | Ga0157378_108990602 | 211 |
| 79 | 3300025899 | Ga0207642_10210741 | Ga0207642_102107412 | 211 |
| 80 | 3300025926 | Ga0207659_10290020 | Ga0207659_102900202 | 211 |
| 81 | 3300025937 | Ga0207669_10317309 | Ga0207669_103173091 | 211 |
| 82 | 3300026089 | Ga0207648_10232217 | Ga0207648_102322172 | 211 |
| 83 | 3300026118 | Ga0207675_100227033 | Ga0207675_1002270332 | 211 |
| 84 | 3300026121 | Ga0207683_10190506 | Ga0207683_101905061 | 211 |
| 85 | 3300028379 | Ga0268266_11007650 | Ga0268266_110076501 | 211 |
| 86 | 3300046615 | Ga0495656_0095605 | Ga0495656_0095605_504_1178 | 211 |
| 87 | 3300005327 | Ga0070658_10028337 | Ga0070658_100283374 | 212 |
| 88 | 3300005327 | Ga0070658_10098271 | Ga0070658_100982713 | 212 |
| 89 | 3300005331 | Ga0070670_100365523 | Ga0070670_1003655232 | 212 |
| 90 | 3300005334 | Ga0068869_100021892 | Ga0068869_1000218922 | 212 |
| 91 | 3300005336 | Ga0070680_100164852 | Ga0070680_1001648522 | 212 |
| 92 | 3300005338 | Ga0068868_100095063 | Ga0068868_1000950634 | 212 |
| 93 | 3300005340 | Ga0070689_100232763 | Ga0070689_1002327632 | 212 |
| 94 | 3300005356 | Ga0070674_100350912 | Ga0070674_1003509122 | 212 |
| 95 | 3300005365 | Ga0070688_100074500 | Ga0070688_1000745002 | 212 |
| 96 | 3300005458 | Ga0070681_10000602 | Ga0070681_1000060226 | 212 |
| 97 | 3300005458 | Ga0070681_10132978 | Ga0070681_101329783 | 212 |
| 98 | 3300005458 | Ga0070681_10345498 | Ga0070681_103454982 | 212 |
| 99 | 3300005466 | Ga0070685_10296427 | Ga0070685_102964271 | 212 |
| 100 | 3300005530 | Ga0070679_100075892 | Ga0070679_1000758922 | 212 |
| 101 | 3300005549 | Ga0070704_100543240 | Ga0070704_1005432401 | 212 |
| 102 | 3300005616 | Ga0068852_100008091 | Ga0068852_1000080912 | 212 |
| 103 | 3300005616 | Ga0068852_100661139 | Ga0068852_1006611392 | 212 |
| 104 | 3300005617 | Ga0068859_100446660 | Ga0068859_1004466602 | 212 |
| 105 | 3300005719 | Ga0068861_100226536 | Ga0068861_1002265362 | 212 |
| 106 | 3300005841 | Ga0068863_100322388 | Ga0068863_1003223883 | 212 |
| 107 | 3300005841 | Ga0068863_100375894 | Ga0068863_1003758942 | 212 |
| 108 | 3300005841 | Ga0068863_100606224 | Ga0068863_1006062241 | 212 |
| 109 | 3300005842 | Ga0068858_100043387 | Ga0068858_1000433876 | 212 |
| 110 | 3300005844 | Ga0068862_100229521 | Ga0068862_1002295212 | 212 |
| 111 | 3300005985 | Ga0081539_10215561 | Ga0081539_102155611 | 212 |
| 112 | 3300006173 | Ga0070716_100440812 | Ga0070716_1004408121 | 212 |
| 113 | 3300006237 | Ga0097621_100011843 | Ga0097621_1000118438 | 212 |
| 114 | 3300006358 | Ga0068871_100088971 | Ga0068871_1000889713 | 212 |
| 115 | 3300006358 | Ga0068871_100219734 | Ga0068871_1002197342 | 212 |
| 116 | 3300006871 | Ga0075434_100603505 | Ga0075434_1006035052 | 212 |
| 117 | 3300006881 | Ga0068865_100241773 | Ga0068865_1002417731 | 212 |
| 118 | 3300006881 | Ga0068865_100667669 | Ga0068865_1006676692 | 212 |
| 119 | 3300006931 | Ga0097620_100446716 | Ga0097620_1004467161 | 212 |
| 120 | 3300009093 | Ga0105240_10027254 | Ga0105240_100272545 | 212 |
| 121 | 3300009098 | Ga0105245_10044707 | Ga0105245_100447072 | 212 |
| 122 | 3300009101 | Ga0105247_10020166 | Ga0105247_100201662 | 212 |
| 123 | 3300009147 | Ga0114129_11494111 | Ga0114129_114941111 | 212 |
| 124 | 3300009148 | Ga0105243_10075904 | Ga0105243_100759042 | 212 |
| 125 | 3300009176 | Ga0105242_10202908 | Ga0105242_102029082 | 212 |
| 126 | 3300009177 | Ga0105248_10008166 | Ga0105248_100081666 | 212 |
| 127 | 3300009177 | Ga0105248_11010541 | Ga0105248_110105412 | 212 |
| 128 | 3300009553 | Ga0105249_10883638 | Ga0105249_108836382 | 212 |
| 129 | 3300010375 | Ga0105239_10798193 | Ga0105239_107981932 | 212 |
| 130 | 3300011119 | Ga0105246_10023329 | Ga0105246_100233292 | 212 |
| 131 | 3300013296 | Ga0157374_10285991 | Ga0157374_102859912 | 212 |
| 132 | 3300013297 | Ga0157378_10018037 | Ga0157378_100180374 | 212 |
| 133 | 3300013297 | Ga0157378_10331452 | Ga0157378_103314522 | 212 |
| 134 | 3300013297 | Ga0157378_11091142 | Ga0157378_110911421 | 212 |
| 135 | 3300013306 | Ga0163162_10287789 | Ga0163162_102877892 | 212 |
| 136 | 3300013306 | Ga0163162_11091976 | Ga0163162_110919761 | 212 |
| 137 | 3300014325 | Ga0163163_10474749 | Ga0163163_104747492 | 212 |
| 138 | 3300014326 | Ga0157380_10345882 | Ga0157380_103458822 | 212 |
| 139 | 3300014968 | Ga0157379_10142336 | Ga0157379_101423363 | 212 |
| 140 | 3300014969 | Ga0157376_10114426 | Ga0157376_101144264 | 212 |
| 141 | 3300014969 | Ga0157376_10146917 | Ga0157376_101469172 | 212 |
| 142 | 3300025321 | Ga0207656_10052609 | Ga0207656_100526092 | 212 |
| 143 | 3300025909 | Ga0207705_10012755 | Ga0207705_100127552 | 212 |
| 144 | 3300025909 | Ga0207705_10027516 | Ga0207705_100275162 | 212 |
| 145 | 3300025912 | Ga0207707_10017046 | Ga0207707_100170462 | 212 |
| 146 | 3300025912 | Ga0207707_10441140 | Ga0207707_104411402 | 212 |
| 147 | 3300025913 | Ga0207695_10078665 | Ga0207695_100786651 | 212 |
| 148 | 3300025921 | Ga0207652_10055014 | Ga0207652_100550143 | 212 |
| 149 | 3300025924 | Ga0207694_10388843 | Ga0207694_103888432 | 212 |
| 150 | 3300025927 | Ga0207687_10152124 | Ga0207687_101521242 | 212 |
| 151 | 3300025935 | Ga0207709_10123347 | Ga0207709_101233472 | 212 |
| 152 | 3300025938 | Ga0207704_10180661 | Ga0207704_101806612 | 212 |
| 153 | 3300025939 | Ga0207665_10196794 | Ga0207665_101967942 | 212 |
| 154 | 3300025940 | Ga0207691_10205771 | Ga0207691_102057712 | 212 |
| 155 | 3300025941 | Ga0207711_10391942 | Ga0207711_103919421 | 212 |
| 156 | 3300025942 | Ga0207689_10018096 | Ga0207689_100180966 | 212 |
| 157 | 3300025986 | Ga0207658_10290122 | Ga0207658_102901222 | 212 |
| 158 | 3300026023 | Ga0207677_10476563 | Ga0207677_104765632 | 212 |
| 159 | 3300026088 | Ga0207641_10053128 | Ga0207641_100531282 | 212 |
| 160 | 3300026088 | Ga0207641_10225373 | Ga0207641_102253732 | 212 |
| 161 | 3300026089 | Ga0207648_10405384 | Ga0207648_104053842 | 212 |
| 162 | 3300026118 | Ga0207675_100447719 | Ga0207675_1004477192 | 212 |
| 163 | 3300026121 | Ga0207683_10120299 | Ga0207683_101202992 | 212 |
| 164 | 3300026142 | Ga0207698_10016411 | Ga0207698_100164111 | 212 |
| 165 | 3300028380 | Ga0268265_10243006 | Ga0268265_102430062 | 212 |
| 166 | 3300031250 | Ga0265331_10001361 | Ga0265331_1000136112 | 212 |
| 167 | 3300031548 | Ga0307408_100392240 | Ga0307408_1003922402 | 212 |
| 168 | 3300031595 | Ga0265313_10000079 | Ga0265313_1000007939 | 212 |
| 169 | 3300031712 | Ga0265342_10007594 | Ga0265342_100075945 | 212 |
| 170 | 3300031901 | Ga0307406_10631740 | Ga0307406_106317402 | 212 |
| 171 | 3300031911 | Ga0307412_10338097 | Ga0307412_103380972 | 212 |
| 172 | 3300032005 | Ga0307411_10507714 | Ga0307411_105077142 | 212 |
| 173 | 3300036401 | Ga0373937_0895055 | Ga0373937_0895055_75_722 | 212 |
| 174 | 3300039447 | Ga0436361_0597188 | Ga0436361_0597188_624_1265 | 212 |
| 175 | 3300042436 | Ga0439435_0103065 | Ga0439435_0103065_35_685 | 212 |
| 176 | 3300048907 | Ga0496104_0008354 | Ga0496104_0008354_7309_7956 | 212 |
| 177 | 3300048912 | Ga0496109_0175977 | Ga0496109_0175977_506_1153 | 212 |
| 178 | 3300048913 | Ga0496110_0042180 | Ga0496110_0042180_109_756 | 212 |
| 179 | 3300048914 | Ga0496111_0330839 | Ga0496111_0330839_409_1050 | 212 |
| 180 | 3300048916 | Ga0496113_0220243 | Ga0496113_0220243_560_1201 | 212 |
| 181 | 3300053093 | Ga0500651_0022568 | Ga0500651_0022568_367_1008 | 212 |
| 182 | 3300053119 | Ga0500595_000606 | Ga0500595_000606_12616_13257 | 212 |
| 183 | 3300053142 | Ga0500577_0004275 | Ga0500577_0004275_2787_3428 | 212 |
| 184 | 3300053146 | Ga0500588_0041973 | Ga0500588_0041973_203_844 | 212 |
| 185 | 3300003322 | rootL2_10145446 | rootL2_101454462 | 213 |
| 186 | 3300005937 | Ga0081455_10125869 | Ga0081455_101258693 | 213 |
| 187 | 3300009093 | Ga0105240_10828352 | Ga0105240_108283521 | 213 |
| 188 | 3300009147 | Ga0114129_10113411 | Ga0114129_101134113 | 213 |
| 189 | 3300009545 | Ga0105237_10063272 | Ga0105237_100632726 | 213 |
| 190 | 3300025914 | Ga0207671_10249231 | Ga0207671_102492311 | 213 |
| 191 | 3300031901 | Ga0307406_10024397 | Ga0307406_100243974 | 213 |
| 192 | 3300031911 | Ga0307412_10013487 | Ga0307412_100134874 | 213 |
| 193 | 3300037312 | Ga0395899_0013348 | Ga0395899_0013348_3034_3678 | 213 |
| 194 | 3300037418 | Ga0395900_0093991 | Ga0395900_0093991_232_876 | 213 |
| 195 | 3300038443 | Ga0395901_0050188 | Ga0395901_0050188_2694_3335 | 213 |
| 196 | 3300049569 | Ga0501032_0040178 | Ga0501032_0040178_1805_2449 | 213 |
| 197 | 3300049570 | Ga0501033_0004364 | Ga0501033_0004364_7812_8456 | 213 |
| 198 | 3300049572 | Ga0501036_0011802 | Ga0501036_0011802_5051_5695 | 213 |
| 199 | 3300049573 | Ga0501037_0023177 | Ga0501037_0023177_2413_3057 | 213 |
| 200 | 3300049573 | Ga0501037_0075128 | Ga0501037_0075128_1749_2393 | 213 |
| 201 | 3300049574 | Ga0501038_0002188 | Ga0501038_0002188_14944_15588 | 213 |
| 202 | 3300049574 | Ga0501038_0044394 | Ga0501038_0044394_460_1167 | 213 |
| 203 | 3300049580 | Ga0501046_0010435 | Ga0501046_0010435_2183_2827 | 213 |
| 204 | 3300049581 | Ga0501047_0404552 | Ga0501047_0404552_42_749 | 213 |
| 205 | 3300049582 | Ga0501048_0039910 | Ga0501048_0039910_1929_2573 | 213 |
| 206 | 3300049583 | Ga0501067_0002220 | Ga0501067_0002220_3076_3720 | 213 |
| 207 | 3300049583 | Ga0501067_0105511 | Ga0501067_0105511_684_1328 | 213 |
| 208 | 3300049584 | Ga0501068_0008761 | Ga0501068_0008761_646_1290 | 213 |
| 209 | 3300049585 | Ga0501069_0001701 | Ga0501069_0001701_4430_5074 | 213 |
| 210 | 3300049586 | Ga0501070_0001886 | Ga0501070_0001886_2294_2938 | 213 |
| 211 | 3300049586 | Ga0501070_0088968 | Ga0501070_0088968_949_1656 | 213 |
| 212 | 3300049586 | Ga0501070_0243615 | Ga0501070_0243615_77_721 | 213 |
| 213 | 3300049589 | Ga0501073_0000287 | Ga0501073_0000287_14652_15296 | 213 |
| 214 | 3300049590 | Ga0501074_0001317 | Ga0501074_0001317_552_1196 | 213 |
| 215 | 3300049592 | Ga0501076_0082486 | Ga0501076_0082486_1233_1877 | 213 |
| 216 | 3300049742 | Ga0501080_0164016 | Ga0501080_0164016_1134_1778 | 213 |
| 217 | 3300049742 | Ga0501080_0398438 | Ga0501080_0398438_552_1196 | 213 |
| 218 | 3300049742 | Ga0501080_0710356 | Ga0501080_0710356_72_716 | 213 |
| 219 | 3300049744 | Ga0501083_0036866 | Ga0501083_0036866_1933_2577 | 213 |
| 220 | 3300049822 | Ga0501035_0037072 | Ga0501035_0037072_3189_3833 | 213 |
| 221 | 3300049822 | Ga0501035_0044435 | Ga0501035_0044435_1643_2287 | 213 |
| 222 | 3300049823 | Ga0501044_0009537 | Ga0501044_0009537_1953_2597 | 213 |
| 223 | 3300050507 | nmdc:mga05p37_112981_c1 | nmdc:mga05p37_112981_c1_361_1005 | 213 |
| 224 | 3300054114 | Ga0501084_0024964 | Ga0501084_0024964_552_1196 | 213 |
| 225 | 3300059421 | Ga0590071_017742 | Ga0590071_017742_977_1621 | 213 |
| 226 | 3300059424 | Ga0590075_002840 | Ga0590075_002840_1777_2421 | 213 |
| 227 | 3300060353 | Ga0501082_0984103 | Ga0501082_0984103_50_694 | 213 |
| 228 | 3300025981 | Ga0207640_10585995 | Ga0207640_105859951 | 214 |
| 229 | 3300039437 | Ga0436365_0932038 | Ga0436365_0932038_1776_2429 | 214 |
| 230 | 3300005330 | Ga0070690_100404795 | Ga0070690_1004047952 | 215 |
| 231 | 3300005353 | Ga0070669_100418706 | Ga0070669_1004187062 | 215 |
| 232 | 3300005440 | Ga0070705_100331099 | Ga0070705_1003310991 | 215 |
| 233 | 3300005459 | Ga0068867_100526580 | Ga0068867_1005265802 | 215 |
| 234 | 3300005459 | Ga0068867_100597392 | Ga0068867_1005973922 | 215 |
| 235 | 3300005617 | Ga0068859_100491938 | Ga0068859_1004919382 | 215 |
| 236 | 3300005618 | Ga0068864_100082909 | Ga0068864_1000829094 | 215 |
| 237 | 3300005719 | Ga0068861_100274509 | Ga0068861_1002745091 | 215 |
| 238 | 3300005843 | Ga0068860_100200072 | Ga0068860_1002000724 | 215 |
| 239 | 3300006931 | Ga0097620_100491873 | Ga0097620_1004918732 | 215 |
| 240 | 3300009098 | Ga0105245_10068983 | Ga0105245_100689834 | 215 |
| 241 | 3300013297 | Ga0157378_10108814 | Ga0157378_101088145 | 215 |
| 242 | 3300025907 | Ga0207645_10252052 | Ga0207645_102520521 | 215 |
| 243 | 3300025923 | Ga0207681_10458387 | Ga0207681_104583872 | 215 |
| 244 | 3300025940 | Ga0207691_10922781 | Ga0207691_109227811 | 215 |
| 245 | 3300026089 | Ga0207648_10299998 | Ga0207648_102999982 | 215 |
| 246 | 3300026095 | Ga0207676_10216066 | Ga0207676_102160662 | 215 |
| 247 | 3300028381 | Ga0268264_10477170 | Ga0268264_104771702 | 215 |
| 248 | 3300042876 | Ga0451577_0306824 | Ga0451577_0306824_155_808 | 215 |
| 249 | 3300005331 | Ga0070670_100435019 | Ga0070670_1004350192 | 216 |
| 250 | 3300005333 | Ga0070677_10197697 | Ga0070677_101976972 | 216 |
| 251 | 3300005356 | Ga0070674_100208070 | Ga0070674_1002080702 | 216 |
| 252 | 3300005364 | Ga0070673_100015599 | Ga0070673_1000155992 | 216 |
| 253 | 3300005365 | Ga0070688_100070220 | Ga0070688_1000702203 | 216 |
| 254 | 3300005437 | Ga0070710_10136497 | Ga0070710_101364972 | 216 |
| 255 | 3300005438 | Ga0070701_10276442 | Ga0070701_102764422 | 216 |
| 256 | 3300005444 | Ga0070694_100085108 | Ga0070694_1000851083 | 216 |
| 257 | 3300005445 | Ga0070708_100246388 | Ga0070708_1002463882 | 216 |
| 258 | 3300005456 | Ga0070678_100261938 | Ga0070678_1002619382 | 216 |
| 259 | 3300005459 | Ga0068867_100059597 | Ga0068867_1000595972 | 216 |
| 260 | 3300005471 | Ga0070698_100192530 | Ga0070698_1001925303 | 216 |
| 261 | 3300005518 | Ga0070699_100283134 | Ga0070699_1002831341 | 216 |
| 262 | 3300005543 | Ga0070672_100162353 | Ga0070672_1001623532 | 216 |
| 263 | 3300005547 | Ga0070693_100233643 | Ga0070693_1002336432 | 216 |
| 264 | 3300005616 | Ga0068852_100301457 | Ga0068852_1003014572 | 216 |
| 265 | 3300005616 | Ga0068852_101111119 | Ga0068852_1011111192 | 216 |
| 266 | 3300005617 | Ga0068859_100048051 | Ga0068859_1000480512 | 216 |
| 267 | 3300005617 | Ga0068859_100285558 | Ga0068859_1002855582 | 216 |
| 268 | 3300005617 | Ga0068859_100335636 | Ga0068859_1003356362 | 216 |
| 269 | 3300005618 | Ga0068864_100069106 | Ga0068864_1000691062 | 216 |
| 270 | 3300005841 | Ga0068863_100177975 | Ga0068863_1001779752 | 216 |
| 271 | 3300005842 | Ga0068858_100111109 | Ga0068858_1001111092 | 216 |
| 272 | 3300005843 | Ga0068860_100186050 | Ga0068860_1001860502 | 216 |
| 273 | 3300006237 | Ga0097621_100031376 | Ga0097621_1000313762 | 216 |
| 274 | 3300006237 | Ga0097621_100503988 | Ga0097621_1005039882 | 216 |
| 275 | 3300006358 | Ga0068871_100009861 | Ga0068871_1000098617 | 216 |
| 276 | 3300006358 | Ga0068871_100045967 | Ga0068871_1000459672 | 216 |
| 277 | 3300006844 | Ga0075428_100039313 | Ga0075428_1000393132 | 216 |
| 278 | 3300006847 | Ga0075431_100398498 | Ga0075431_1003984981 | 216 |
| 279 | 3300006881 | Ga0068865_100313816 | Ga0068865_1003138162 | 216 |
| 280 | 3300006931 | Ga0097620_100048052 | Ga0097620_1000480522 | 216 |
| 281 | 3300006931 | Ga0097620_100285577 | Ga0097620_1002855772 | 216 |
| 282 | 3300006931 | Ga0097620_100335656 | Ga0097620_1003356562 | 216 |
| 283 | 3300009147 | Ga0114129_10668908 | Ga0114129_106689082 | 216 |
| 284 | 3300009177 | Ga0105248_10681504 | Ga0105248_106815042 | 216 |
| 285 | 3300013297 | Ga0157378_10074687 | Ga0157378_100746872 | 216 |
| 286 | 3300013306 | Ga0163162_10992021 | Ga0163162_109920212 | 216 |
| 287 | 3300013306 | Ga0163162_11073954 | Ga0163162_110739541 | 216 |
| 288 | 3300013308 | Ga0157375_10387578 | Ga0157375_103875782 | 216 |
| 289 | 3300013308 | Ga0157375_11291870 | Ga0157375_112918702 | 216 |
| 290 | 3300014325 | Ga0163163_10143386 | Ga0163163_101433862 | 216 |
| 291 | 3300014745 | Ga0157377_10487141 | Ga0157377_104871412 | 216 |
| 292 | 3300014968 | Ga0157379_10171216 | Ga0157379_101712162 | 216 |
| 293 | 3300014969 | Ga0157376_10041283 | Ga0157376_100412833 | 216 |
| 294 | 3300014969 | Ga0157376_10048669 | Ga0157376_100486696 | 216 |
| 295 | 3300025899 | Ga0207642_10009845 | Ga0207642_100098453 | 216 |
| 296 | 3300025916 | Ga0207663_10557122 | Ga0207663_105571222 | 216 |
| 297 | 3300025923 | Ga0207681_10319054 | Ga0207681_103190542 | 216 |
| 298 | 3300025931 | Ga0207644_10361202 | Ga0207644_103612022 | 216 |
| 299 | 3300025934 | Ga0207686_10053460 | Ga0207686_100534602 | 216 |
| 300 | 3300025936 | Ga0207670_10035360 | Ga0207670_100353604 | 216 |
| 301 | 3300025937 | Ga0207669_10139798 | Ga0207669_101397983 | 216 |
| 302 | 3300025938 | Ga0207704_10165180 | Ga0207704_101651803 | 216 |
| 303 | 3300025940 | Ga0207691_10019836 | Ga0207691_100198367 | 216 |
| 304 | 3300025941 | Ga0207711_10785594 | Ga0207711_107855942 | 216 |
| 305 | 3300025960 | Ga0207651_10119921 | Ga0207651_101199212 | 216 |
| 306 | 3300026088 | Ga0207641_10080485 | Ga0207641_100804853 | 216 |
| 307 | 3300026089 | Ga0207648_10110192 | Ga0207648_101101922 | 216 |
| 308 | 3300026095 | Ga0207676_10068605 | Ga0207676_100686052 | 216 |
| 309 | 3300026095 | Ga0207676_10325186 | Ga0207676_103251862 | 216 |
| 310 | 3300026121 | Ga0207683_10020743 | Ga0207683_100207434 | 216 |
| 311 | 3300026121 | Ga0207683_10380982 | Ga0207683_103809822 | 216 |
| 312 | 3300026142 | Ga0207698_10090632 | Ga0207698_100906322 | 216 |
| 313 | 3300028380 | Ga0268265_11236129 | Ga0268265_112361291 | 216 |
| 314 | 3300035171 | Ga0373946_0077233 | Ga0373946_0077233_270_920 | 216 |
| 315 | 3300035725 | Ga0373947_0014765 | Ga0373947_0014765_2141_2791 | 216 |
| 316 | 3300037068 | Ga0373925_0096702 | Ga0373925_0096702_610_1260 | 216 |
| 317 | 3300046472 | Ga0495580_0121646 | Ga0495580_0121646_610_1260 | 216 |
| 318 | 3300046537 | Ga0495598_0094325 | Ga0495598_0094325_18_668 | 216 |
| 319 | 3300046543 | Ga0495645_0057791 | Ga0495645_0057791_1090_1740 | 216 |
| 320 | 3300046678 | Ga0495599_0154951 | Ga0495599_0154951_23_673 | 216 |
| 321 | 3300050510 | nmdc:mga06r32_132497_c1 | nmdc:mga06r32_132497_c1_930_1586 | 216 |
| 322 | 3300053078 | Ga0495612_0057621 | Ga0495612_0057621_600_1250 | 216 |
| 323 | 3300005293 | Ga0065715_10124124 | Ga0065715_101241243 | 218 |
| 324 | 3300005347 | Ga0070668_100001234 | Ga0070668_10000123413 | 218 |
| 325 | 3300005356 | Ga0070674_100014133 | Ga0070674_1000141332 | 218 |
| 326 | 3300005356 | Ga0070674_100442780 | Ga0070674_1004427801 | 218 |
| 327 | 3300005445 | Ga0070708_100000323 | Ga0070708_10000032316 | 218 |
| 328 | 3300005457 | Ga0070662_100293074 | Ga0070662_1002930742 | 218 |
| 329 | 3300005844 | Ga0068862_100173512 | Ga0068862_1001735122 | 218 |
| 330 | 3300014325 | Ga0163163_10532298 | Ga0163163_105322982 | 218 |
| 331 | 3300014326 | Ga0157380_10040379 | Ga0157380_100403793 | 218 |
| 332 | 3300025933 | Ga0207706_10340291 | Ga0207706_103402912 | 218 |
| 333 | 3300025937 | Ga0207669_10051658 | Ga0207669_100516581 | 218 |
| 334 | 3300025940 | Ga0207691_10416447 | Ga0207691_104164471 | 218 |
| 335 | 3300025972 | Ga0207668_10070956 | Ga0207668_100709563 | 218 |
| 336 | 3300028380 | Ga0268265_10154031 | Ga0268265_101540313 | 218 |
| 337 | 3300035116 | Ga0373945_0125792 | Ga0373945_0125792_201_857 | 218 |
| 338 | 3300035172 | Ga0373955_0200401 | Ga0373955_0200401_224_880 | 218 |
| 339 | 3300006237 | Ga0097621_100363992 | Ga0097621_1003639922 | 222 |
| 340 | 3300041512 | Ga0451853_3760387 | Ga0451853_3760387_488_1156 | 222 |
| 341 | 2162886012 | MBSR1b_contig_8558565 | MBSR1b_0681.00005990 | 223 |
| 342 | 3300002239 | JGI24034J26672_10030228 | JGI24034J26672_100302281 | 223 |
| 343 | 3300005293 | Ga0065715_10301983 | Ga0065715_103019832 | 223 |
| 344 | 3300005329 | Ga0070683_100407092 | Ga0070683_1004070922 | 223 |
| 345 | 3300005330 | Ga0070690_100007631 | Ga0070690_1000076313 | 223 |
| 346 | 3300005334 | Ga0068869_100062217 | Ga0068869_1000622172 | 223 |
| 347 | 3300005335 | Ga0070666_10259898 | Ga0070666_102598982 | 223 |
| 348 | 3300005338 | Ga0068868_100095044 | Ga0068868_1000950442 | 223 |
| 349 | 3300005340 | Ga0070689_100012055 | Ga0070689_1000120553 | 223 |
| 350 | 3300005347 | Ga0070668_100276766 | Ga0070668_1002767662 | 223 |
| 351 | 3300005353 | Ga0070669_100116981 | Ga0070669_1001169813 | 223 |
| 352 | 3300005355 | Ga0070671_100161842 | Ga0070671_1001618422 | 223 |
| 353 | 3300005356 | Ga0070674_100104872 | Ga0070674_1001048722 | 223 |
| 354 | 3300005364 | Ga0070673_100369090 | Ga0070673_1003690901 | 223 |
| 355 | 3300005366 | Ga0070659_100113199 | Ga0070659_1001131994 | 223 |
| 356 | 3300005438 | Ga0070701_10124593 | Ga0070701_101245931 | 223 |
| 357 | 3300005441 | Ga0070700_100046178 | Ga0070700_1000461782 | 223 |
| 358 | 3300005455 | Ga0070663_100194905 | Ga0070663_1001949052 | 223 |
| 359 | 3300005466 | Ga0070685_10048251 | Ga0070685_100482514 | 223 |
| 360 | 3300005544 | Ga0070686_100065350 | Ga0070686_1000653504 | 223 |
| 361 | 3300005547 | Ga0070693_100207648 | Ga0070693_1002076482 | 223 |
| 362 | 3300005563 | Ga0068855_100077118 | Ga0068855_1000771183 | 223 |
| 363 | 3300005564 | Ga0070664_100084932 | Ga0070664_1000849323 | 223 |
| 364 | 3300005577 | Ga0068857_100059912 | Ga0068857_1000599124 | 223 |
| 365 | 3300005578 | Ga0068854_100070564 | Ga0068854_1000705644 | 223 |
| 366 | 3300005617 | Ga0068859_100267811 | Ga0068859_1002678112 | 223 |
| 367 | 3300005719 | Ga0068861_100073550 | Ga0068861_1000735502 | 223 |
| 368 | 3300005834 | Ga0068851_10051433 | Ga0068851_100514332 | 223 |
| 369 | 3300005840 | Ga0068870_10002667 | Ga0068870_100026677 | 223 |
| 370 | 3300005841 | Ga0068863_100352453 | Ga0068863_1003524532 | 223 |
| 371 | 3300005842 | Ga0068858_100153990 | Ga0068858_1001539902 | 223 |
| 372 | 3300005844 | Ga0068862_100247168 | Ga0068862_1002471683 | 223 |
| 373 | 3300006881 | Ga0068865_100078607 | Ga0068865_1000786073 | 223 |
| 374 | 3300006931 | Ga0097620_100267784 | Ga0097620_1002677842 | 223 |
| 375 | 3300009098 | Ga0105245_10533883 | Ga0105245_105338832 | 223 |
| 376 | 3300009148 | Ga0105243_10021269 | Ga0105243_100212694 | 223 |
| 377 | 3300009551 | Ga0105238_10271790 | Ga0105238_102717902 | 223 |
| 378 | 3300009553 | Ga0105249_10061457 | Ga0105249_100614573 | 223 |
| 379 | 3300014326 | Ga0157380_10012519 | Ga0157380_100125194 | 223 |
| 380 | 3300014745 | Ga0157377_10053277 | Ga0157377_100532773 | 223 |
| 381 | 3300014968 | Ga0157379_10018354 | Ga0157379_100183545 | 223 |
| 382 | 3300017792 | Ga0163161_10218778 | Ga0163161_102187782 | 223 |
| 383 | 3300025315 | Ga0207697_10000450 | Ga0207697_100004504 | 223 |
| 384 | 3300025321 | Ga0207656_10059405 | Ga0207656_100594052 | 223 |
| 385 | 3300025893 | Ga0207682_10001065 | Ga0207682_100010654 | 223 |
| 386 | 3300025901 | Ga0207688_10005210 | Ga0207688_100052103 | 223 |
| 387 | 3300025903 | Ga0207680_10057065 | Ga0207680_100570652 | 223 |
| 388 | 3300025903 | Ga0207680_10256232 | Ga0207680_102562321 | 223 |
| 389 | 3300025907 | Ga0207645_10005257 | Ga0207645_100052573 | 223 |
| 390 | 3300025908 | Ga0207643_10000429 | Ga0207643_100004294 | 223 |
| 391 | 3300025918 | Ga0207662_10025717 | Ga0207662_100257174 | 223 |
| 392 | 3300025919 | Ga0207657_10052097 | Ga0207657_100520973 | 223 |
| 393 | 3300025920 | Ga0207649_10107837 | Ga0207649_101078371 | 223 |
| 394 | 3300025925 | Ga0207650_10000503 | Ga0207650_1000050323 | 223 |
| 395 | 3300025926 | Ga0207659_10133666 | Ga0207659_101336663 | 223 |
| 396 | 3300025931 | Ga0207644_10109924 | Ga0207644_101099242 | 223 |
| 397 | 3300025933 | Ga0207706_10007746 | Ga0207706_100077467 | 223 |
| 398 | 3300025936 | Ga0207670_10052370 | Ga0207670_100523701 | 223 |
| 399 | 3300025940 | Ga0207691_10016285 | Ga0207691_100162852 | 223 |
| 400 | 3300025942 | Ga0207689_10008198 | Ga0207689_100081985 | 223 |
| 401 | 3300025944 | Ga0207661_10366093 | Ga0207661_103660932 | 223 |
| 402 | 3300025945 | Ga0207679_10589661 | Ga0207679_105896611 | 223 |
| 403 | 3300025949 | Ga0207667_10027691 | Ga0207667_100276915 | 223 |
| 404 | 3300025986 | Ga0207658_10286705 | Ga0207658_102867052 | 223 |
| 405 | 3300026023 | Ga0207677_10934960 | Ga0207677_109349601 | 223 |
| 406 | 3300026067 | Ga0207678_10030688 | Ga0207678_100306883 | 223 |
| 407 | 3300026075 | Ga0207708_10002412 | Ga0207708_100024127 | 223 |
| 408 | 3300026089 | Ga0207648_10030219 | Ga0207648_100302192 | 223 |
| 409 | 3300026095 | Ga0207676_10185965 | Ga0207676_101859652 | 223 |
| 410 | 3300026116 | Ga0207674_10028929 | Ga0207674_100289294 | 223 |
| 411 | 3300026118 | Ga0207675_100029465 | Ga0207675_1000294654 | 223 |
| 412 | 3300026121 | Ga0207683_10038992 | Ga0207683_100389923 | 223 |
| 413 | 3300026142 | Ga0207698_10304473 | Ga0207698_103044732 | 223 |
| 414 | 3300035113 | Ga0373936_0075025 | Ga0373936_0075025_624_1295 | 223 |
| 415 | 3300035695 | Ga0373927_0189124 | Ga0373927_0189124_660_1331 | 223 |
| 416 | 3300046537 | Ga0495598_0058122 | Ga0495598_0058122_482_1153 | 223 |
| 417 | 3300048903 | Ga0496100_0027925 | Ga0496100_0027925_1927_2598 | 223 |
| 418 | 3300048905 | Ga0496102_0048596 | Ga0496102_0048596_1986_2657 | 223 |
| 419 | 3300048907 | Ga0496104_0004348 | Ga0496104_0004348_1120_1791 | 223 |
| 420 | 3300048909 | Ga0496106_0124021 | Ga0496106_0124021_1204_1875 | 223 |
| 421 | 3300048910 | Ga0496107_0051192 | Ga0496107_0051192_767_1438 | 223 |
| 422 | 3300048911 | Ga0496108_0003909 | Ga0496108_0003909_4032_4703 | 223 |
| 423 | 3300048912 | Ga0496109_0013713 | Ga0496109_0013713_1354_2025 | 223 |
| 424 | 3300048913 | Ga0496110_0016519 | Ga0496110_0016519_3814_4485 | 223 |
| 425 | 3300048915 | Ga0496112_0249428 | Ga0496112_0249428_120_791 | 223 |
| 426 | 3300048917 | Ga0496114_0213876 | Ga0496114_0213876_810_1481 | 223 |
| 427 | 3300050511 | nmdc:mga08y16_298408_c1 | nmdc:mga08y16_298408_c1_584_1255 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6f05-assembly2.cif.gz_B | arabidopsis thaliana gstf9, gso3 bound | 0.9024 | 7 | 213 |
| 6f05-assembly6.cif.gz_H | arabidopsis thaliana gstf9, gso3 bound | 0.9014 | 7 | 213 |
| 6f05-assembly4.cif.gz_E | arabidopsis thaliana gstf9, gso3 bound | 0.8989 | 7 | 213 |
| 6f05-assembly2.cif.gz_A | arabidopsis thaliana gstf9, gso3 bound | 0.8986 | 7 | 213 |
| 5g5a-assembly2.cif.gz_D | glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide | 0.8966 | 6 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5zfgB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9762 | 7 | 83 | 3.40.30.10 |
| af_A0A0B5EC52_24_99_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.976 | 10 | 84 | 3.40.30.10 |
| af_Q7JVZ8_6_81_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9668 | 9 | 82 | 3.40.30.10 |
| af_A0A1D6HAW8_13_80_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9646 | 10 | 75 | 3.40.30.10 |
| 4ielA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9638 | 6 | 82 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351ST55-F1-model_v4 | Glutathione S-transferase | 0.9789 | 7 | 82 |
GO:0005737
GO:0016740 |
| AF-A0A7C7FQU3-F1-model_v4 | Glutathione S-transferase family protein | 0.9763 | 7 | 75 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A7J5ZZA1-F1-model_v4 | GST N-terminal domain-containing protein | 0.9706 | 2 | 84 |
GO:0000266
GO:0005741 GO:0006626 GO:0008053 |
| AF-A0A7Y4XZS1-F1-model_v4 | Glutathione S-transferase family protein | 0.9684 | 6 | 220 |
GO:0005737
GO:0016740 |
| AF-A0A7Y4UMQ4-F1-model_v4 | Glutathione S-transferase family protein | 0.9677 | 6 | 126 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar