F441541

General Info

Members Datasets Scaffolds Average Seq Length
427 312 854 170

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0786876|Ga0496126_0786876_169_657
Length 162
Sequence MADAAHQIPDRITITLVVNGKRRTIDLVPWTTLLDALRDHLNMTGTKKGCDHGQCGACTVLVDGRRVNACLSLAVMKDGAEIITIEGLAGDALHPLQQAFIDHDAFQCGYCTPGQICSAVGLLAEGHARNADEIRELMSGNLCRCGAYPNIVAAVQQAMGRP

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
127 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
128 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
286 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
292 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
293 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
294 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
295 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
298 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
302 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
306 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
307 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
308 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
309 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
310 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
311 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
312 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0.23
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.71
Nodule 0.94
Rhizoplane 8.9
Rhizosphere 74.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0786876 3300048929 Bacteria 731
2 JGI25165J46597_1015008 3300003214 Bacteria 1049
3 Ga0065715_10212232 3300005293 Bacteria 1308
4 Ga0070658_10760313 3300005327 Bacteria 841
5 Ga0070676_10483704 3300005328 Bacteria 876
6 Ga0070683_100023689 3300005329 Bacteria 5494
7 Ga0070670_100132233 3300005331 Bacteria 2155
8 Ga0070682_100068428 3300005337 Bacteria 2265
9 Ga0070682_100098131 3300005337 Bacteria 1929
10 Ga0068868_100051004 3300005338 Bacteria 3252
11 Ga0070660_100154357 3300005339 Bacteria 1847
12 Ga0070661_100343369 3300005344 Bacteria 1170
13 Ga0070673_100401985 3300005364 Bacteria 1225
14 Ga0070667_101039395 3300005367 Bacteria 765
15 Ga0070709_10088358 3300005434 Bacteria 2038
16 Ga0070709_10570893 3300005434 Bacteria 868
17 Ga0070714_100070379 3300005435 Bacteria 3024
18 Ga0070714_100365367 3300005435 Bacteria 1358
19 Ga0070713_100118522 3300005436 Bacteria 2318
20 Ga0070713_100293594 3300005436 Bacteria 1495
21 Ga0070713_100358772 3300005436 Bacteria 1354
22 Ga0070713_100702309 3300005436 Bacteria 966
23 Ga0070710_10052314 3300005437 Bacteria 2296
24 Ga0070711_100151062 3300005439 Bacteria 1751
25 Ga0070711_100209724 3300005439 Bacteria 1508
26 Ga0070708_100067507 3300005445 Bacteria 3211
27 Ga0070708_100690613 3300005445 Bacteria 961
28 Ga0070663_100058942 3300005455 Bacteria 2759
29 Ga0070663_100097828 3300005455 Bacteria 2185
30 Ga0070663_100457069 3300005455 Bacteria 1053
31 Ga0070663_100531360 3300005455 Bacteria 980
32 Ga0070678_100237989 3300005456 Bacteria 1521
33 Ga0070662_100336985 3300005457 Bacteria 1233
34 Ga0070681_10451322 3300005458 Bacteria 1198
35 Ga0070706_100091594 3300005467 Bacteria 2820
36 Ga0070706_100114042 3300005467 Bacteria 2516
37 Ga0070707_100002314 3300005468 Bacteria 18203
38 Ga0070698_100061631 3300005471 Bacteria 3785
39 Ga0070698_100138693 3300005471 Bacteria 2385
40 Ga0070699_100120905 3300005518 Bacteria 2303
41 Ga0070684_100128798 3300005535 Bacteria 2282
42 Ga0070697_100030504 3300005536 Bacteria 4332
43 Ga0070697_100188980 3300005536 Bacteria 1748
44 Ga0068853_100272758 3300005539 Bacteria 1558
45 Ga0070672_100408852 3300005543 Bacteria 1164
46 Ga0070693_100462955 3300005547 Bacteria 892
47 Ga0070665_100132899 3300005548 Bacteria 2490
48 Ga0068854_100283056 3300005578 Bacteria 1336
49 Ga0068856_100286936 3300005614 Bacteria 1663
50 Ga0068856_101339320 3300005614 Bacteria 731
51 Ga0068852_100072740 3300005616 Bacteria 3022
52 Ga0068852_100321704 3300005616 Bacteria 1502
53 Ga0068859_100758530 3300005617 Bacteria 1059
54 Ga0068864_100057420 3300005618 Bacteria 3362
55 Ga0068864_101466743 3300005618 Bacteria 685
56 Ga0068870_10312865 3300005840 Bacteria 995
57 Ga0068863_100548702 3300005841 Bacteria 1141
58 Ga0068862_100383402 3300005844 Bacteria 1311
59 Ga0081540_1004835 3300005983 Bacteria 10149
60 Ga0081539_10017330 3300005985 Bacteria 5064
61 Ga0070717_10020276 3300006028 Bacteria 5225
62 Ga0075365_10001051 3300006038 Bacteria 11927
63 Ga0075365_10478431 3300006038 Bacteria 880
64 Ga0075368_10000295 3300006042 Bacteria 14352
65 Ga0075368_10120539 3300006042 Bacteria 1086
66 Ga0075363_100019552 3300006048 Bacteria 3387
67 Ga0075363_100363255 3300006048 Bacteria 847
68 Ga0075364_10055438 3300006051 Bacteria 2593
69 Ga0075364_10176633 3300006051 Bacteria 1444
70 Ga0070715_10015986 3300006163 Bacteria 2809
71 Ga0070715_10152298 3300006163 Bacteria 1134
72 Ga0070716_100148766 3300006173 Bacteria 1503
73 Ga0070712_100031324 3300006175 Bacteria 3582
74 Ga0075362_10132671 3300006177 Bacteria 1186
75 Ga0075367_10110852 3300006178 Bacteria 1684
76 Ga0075367_10203807 3300006178 Bacteria 1236
77 Ga0075369_10003291 3300006186 Bacteria 5868
78 Ga0075369_10089400 3300006186 Bacteria 1373
79 Ga0075369_10255711 3300006186 Bacteria 814
80 Ga0075366_10016323 3300006195 Bacteria 4267
81 Ga0097621_100090834 3300006237 Bacteria 2556
82 Ga0068871_100051138 3300006358 Bacteria 3345
83 Ga0075428_100016717 3300006844 Bacteria 8100
84 Ga0075428_100030270 3300006844 Bacteria 5988
85 Ga0075428_101443062 3300006844 Bacteria 722
86 Ga0075431_100051332 3300006847 Bacteria 4253
87 Ga0075431_101031326 3300006847 Bacteria 789
88 Ga0075433_10153857 3300006852 Bacteria 2046
89 Ga0097620_100758520 3300006931 Bacteria 1059
90 Ga0099795_10026420 3300007788 Bacteria 1956
91 Ga0111539_10153458 3300009094 Bacteria 2695
92 Ga0111539_11839412 3300009094 Bacteria 702
93 Ga0105245_10015471 3300009098 Bacteria 6652
94 Ga0105247_10196839 3300009101 Bacteria 1352
95 Ga0114129_10029597 3300009147 Bacteria 7755
96 Ga0114129_10098994 3300009147 Bacteria 4036
97 Ga0105243_10235233 3300009148 Bacteria 1627
98 Ga0105241_10666871 3300009174 Bacteria 946
99 Ga0105241_11109858 3300009174 Bacteria 745
100 Ga0105242_10102850 3300009176 Bacteria 2423
101 Ga0105242_11119721 3300009176 Bacteria 802
102 Ga0105248_10850155 3300009177 Bacteria 1030
103 Ga0105237_10129581 3300009545 Bacteria 2517
104 Ga0105237_10491944 3300009545 Bacteria 1233
105 Ga0105249_11499355 3300009553 Bacteria 747
106 Ga0099796_10074670 3300010159 Bacteria 1231
107 Ga0105239_10007972 3300010375 Bacteria 12098
108 Ga0105239_10059403 3300010375 Bacteria 4197
109 Ga0105239_10167047 3300010375 Bacteria 2461
110 Ga0105239_10170671 3300010375 Bacteria 2432
111 Ga0105239_11346924 3300010375 Bacteria 824
112 Ga0105246_10025723 3300011119 Bacteria 3838
113 Ga0157369_10208647 3300013105 Bacteria 2048
114 Ga0157369_10481992 3300013105 Bacteria 1284
115 Ga0157374_10014474 3300013296 Bacteria 6903
116 Ga0157374_10207125 3300013296 Bacteria 1922
117 Ga0157378_10853730 3300013297 Bacteria 939
118 Ga0163162_10002568 3300013306 Bacteria 17184
119 Ga0157372_10616653 3300013307 Bacteria 1264
120 Ga0157372_10702225 3300013307 Bacteria 1177
121 Ga0157375_11264767 3300013308 Bacteria 867
122 Ga0163163_10059741 3300014325 Bacteria 3772
123 Ga0163163_10187536 3300014325 Bacteria 2116
124 Ga0157376_10051015 3300014969 Bacteria 3435
125 Ga0157376_10486047 3300014969 Bacteria 1211
126 Ga0163161_10847972 3300017792 Bacteria 771
127 Ga0213873_10001123 3300021358 Bacteria 4372
128 Ga0213872_10139851 3300021361 Bacteria 1063
129 Ga0213871_10013058 3300021441 Bacteria 1943
130 Ga0213871_10030847 3300021441 Bacteria 1396
131 Ga0213871_10104539 3300021441 Bacteria 832
132 Ga0224712_10377901 3300022467 Bacteria 673
133 Ga0209233_1017729 3300025261 Bacteria 1932
134 Ga0207692_10061093 3300025898 Bacteria 1951
135 Ga0207688_10413120 3300025901 Bacteria 838
136 Ga0207699_10047270 3300025906 Bacteria 2522
137 Ga0207705_10044206 3300025909 Bacteria 3201
138 Ga0207705_10524266 3300025909 Bacteria 921
139 Ga0207684_10105666 3300025910 Bacteria 2408
140 Ga0207707_10206223 3300025912 Bacteria 1713
141 Ga0207707_10309374 3300025912 Bacteria 1365
142 Ga0207671_10430238 3300025914 Bacteria 1050
143 Ga0207693_10006696 3300025915 Bacteria 9514
144 Ga0207663_10046426 3300025916 Bacteria 2676
145 Ga0207663_10099299 3300025916 Bacteria 1951
146 Ga0207663_10211678 3300025916 Bacteria 1405
147 Ga0207662_10266135 3300025918 Bacteria 1130
148 Ga0207657_10051235 3300025919 Bacteria 3588
149 Ga0207657_10687141 3300025919 Bacteria 795
150 Ga0207649_10276309 3300025920 Bacteria 1220
151 Ga0207646_10481535 3300025922 Bacteria 1119
152 Ga0207694_10187572 3300025924 Bacteria 1679
153 Ga0207650_10237737 3300025925 Bacteria 1471
154 Ga0207687_10047209 3300025927 Bacteria 2984
155 Ga0207700_10226454 3300025928 Bacteria 1587
156 Ga0207700_10415770 3300025928 Bacteria 1180
157 Ga0207664_10547356 3300025929 Bacteria 1038
158 Ga0207664_10590536 3300025929 Bacteria 997
159 Ga0207644_10071588 3300025931 Bacteria 2537
160 Ga0207706_10325943 3300025933 Bacteria 1336
161 Ga0207686_10593765 3300025934 Bacteria 871
162 Ga0207709_10149641 3300025935 Bacteria 1615
163 Ga0207669_10480936 3300025937 Bacteria 990
164 Ga0207665_10007621 3300025939 Bacteria 7148
165 Ga0207691_10922680 3300025940 Bacteria 730
166 Ga0207711_10492049 3300025941 Bacteria 1143
167 Ga0207689_10349620 3300025942 Bacteria 1229
168 Ga0207679_10026351 3300025945 Bacteria 4007
169 Ga0207651_10402925 3300025960 Bacteria 1164
170 Ga0207668_10087272 3300025972 Bacteria 2281
171 Ga0207677_10136276 3300026023 Bacteria 1872
172 Ga0207677_10449665 3300026023 Bacteria 1104
173 Ga0207678_10004475 3300026067 Bacteria 12565
174 Ga0207678_10011970 3300026067 Bacteria 7618
175 Ga0207678_10282698 3300026067 Bacteria 1424
176 Ga0207676_10074499 3300026095 Bacteria 2735
177 Ga0207676_11055241 3300026095 Bacteria 802
178 Ga0207674_10198264 3300026116 Bacteria 1957
179 Ga0207683_10002920 3300026121 Bacteria 14899
180 Ga0207698_10104770 3300026142 Bacteria 2354
181 Ga0207698_10503261 3300026142 Bacteria 1179
182 Ga0209389_1000001 3300027296 Bacteria 463799
183 Ga0209489_115912 3300027361 Bacteria 4320
184 Ga0209700_100007 3300027363 Bacteria 454608
185 Ga0209813_10003097 3300027866 Bacteria 3864
186 Ga0207428_10186234 3300027907 Bacteria 1566
187 Ga0268266_10355490 3300028379 Bacteria 1377
188 Ga0268265_10699214 3300028380 Bacteria 979
189 Ga0265332_10003643 3300031238 Bacteria 7385
190 Ga0265340_10006217 3300031247 Bacteria 6581
191 Ga0265339_10002276 3300031249 Bacteria 13845
192 Ga0265316_10177357 3300031344 Bacteria 1587
193 Ga0265314_10028076 3300031711 Bacteria 4201
194 Ga0265342_10000073 3300031712 Bacteria 106620
195 Ga0307510_10046673 3300033180 Bacteria 4653
196 Ga0373923_0107631 3300035111 Bacteria 1235
197 Ga0373953_0109795 3300035117 Bacteria 1166
198 Ga0373954_0007790 3300035118 Bacteria 4689
199 Ga0373957_0032699 3300035120 Bacteria 1918
200 Ga0373943_0414091 3300035170 Bacteria 779
201 Ga0373955_0008546 3300035172 Bacteria 4759
202 Ga0373924_0006488 3300035410 Bacteria 4191
203 Ga0373931_0260569 3300035691 Bacteria 1058
204 Ga0373927_0013653 3300035695 Bacteria 5394
205 Ga0373927_0168635 3300035695 Bacteria 1435
206 Ga0373933_0000258 3300035724 Bacteria 34845
207 Ga0373947_0007628 3300035725 Bacteria 6260
208 Ga0373947_0102152 3300035725 Bacteria 1803
209 Ga0373937_0000814 3300036401 Bacteria 26684
210 Ga0373925_0017734 3300037068 Bacteria 5166
211 Ga0395900_0110146 3300037418 Bacteria 2829
212 Ga0395901_0731650 3300038443 Bacteria 984
213 Ga0436365_1060192 3300039437 Bacteria 3350
214 Ga0436360_0872758 3300039438 Bacteria 5531
215 Ga0436361_0689910 3300039447 Bacteria 1489
216 Ga0436361_1065805 3300039447 Bacteria 1735
217 Ga0436362_0194916 3300039453 Bacteria 1535
218 Ga0439453_0005886 3300041408 Bacteria 1889
219 Ga0451789_0633200 3300041443 Bacteria 698
220 Ga0439435_0029389 3300042436 Bacteria 1483
221 Ga0466972_0000247 3300044658 Bacteria 36835
222 Ga0466966_0030791 3300044684 Bacteria 3481
223 Ga0466970_0048428 3300044765 Bacteria 2266
224 Ga0466957_0235641 3300044842 Bacteria 1213
225 Ga0466959_0061600 3300045049 Bacteria 2728
226 Ga0495617_006913 3300046452 Bacteria 3961
227 Ga0495592_0003878 3300046454 Bacteria 10821
228 Ga0495603_0267119 3300046455 Bacteria 984
229 Ga0495590_0000471 3300046457 Bacteria 19966
230 Ga0495590_0026848 3300046457 Bacteria 2021
231 Ga0495629_0006214 3300046459 Bacteria 8864
232 Ga0495651_0000514 3300046462 Bacteria 30081
233 Ga0495651_0597547 3300046462 Bacteria 696
234 Ga0495653_0018643 3300046463 Bacteria 5633
235 Ga0495605_0013948 3300046474 Bacteria 4413
236 Ga0495605_0264727 3300046474 Bacteria 733
237 Ga0495664_0019823 3300046477 Bacteria 3872
238 Ga0495664_0513866 3300046477 Bacteria 715
239 Ga0495584_0051114 3300046491 Bacteria 2081
240 Ga0495585_0122909 3300046492 Bacteria 1372
241 Ga0495596_0002212 3300046500 Bacteria 10600
242 Ga0495606_0000472 3300046507 Bacteria 65989
243 Ga0495606_0002520 3300046507 Bacteria 21082
244 Ga0495606_0138739 3300046507 Bacteria 1437
245 Ga0495606_0147032 3300046507 Bacteria 1386
246 Ga0495608_0000398 3300046511 Bacteria 30359
247 Ga0495610_0001054 3300046512 Bacteria 25325
248 Ga0495618_0016275 3300046514 Bacteria 4547
249 Ga0495628_0010648 3300046516 Bacteria 7795
250 Ga0495630_0391049 3300046517 Bacteria 1065
251 Ga0495631_0014291 3300046518 Bacteria 3836
252 Ga0495632_0001023 3300046519 Bacteria 24169
253 Ga0495643_0010177 3300046522 Bacteria 5799
254 Ga0495643_0041109 3300046522 Bacteria 2522
255 Ga0495643_0116700 3300046522 Bacteria 1352
256 Ga0495648_0005763 3300046524 Bacteria 10221
257 Ga0495642_0006811 3300046528 Bacteria 4380
258 Ga0495652_0016289 3300046529 Bacteria 6649
259 Ga0495652_0222352 3300046529 Bacteria 1418
260 Ga0495652_0262594 3300046529 Bacteria 1274
261 Ga0495665_0522442 3300046531 Bacteria 597
262 Ga0495640_0008514 3300046533 Bacteria 8040
263 Ga0495587_0000599 3300046536 Bacteria 24689
264 Ga0495609_0076118 3300046538 Bacteria 1471
265 Ga0495597_0006352 3300046542 Bacteria 6119
266 Ga0495645_0014260 3300046543 Bacteria 5636
267 Ga0495622_0036477 3300046557 Bacteria 2292
268 Ga0495667_0006515 3300046559 Bacteria 7927
269 Ga0495667_0333671 3300046559 Bacteria 959
270 Ga0495668_0000480 3300046616 Bacteria 50062
271 Ga0495668_0149940 3300046616 Bacteria 1277
272 Ga0495634_0013501 3300046642 Bacteria 5900
273 Ga0495625_0002682 3300046660 Bacteria 18930
274 Ga0495625_0075920 3300046660 Bacteria 2351
275 Ga0495635_0006281 3300046663 Bacteria 8276
276 Ga0495635_0154579 3300046663 Bacteria 1562
277 Ga0495659_0170419 3300046664 Bacteria 883
278 Ga0495588_0437610 3300046674 Bacteria 686
279 Ga0495599_0014416 3300046678 Bacteria 4894
280 Ga0495623_0011910 3300046679 Bacteria 5636
281 Ga0495647_0088055 3300046681 Bacteria 1269
282 Ga0495658_0024599 3300046683 Bacteria 3209
283 Ga0495669_0001553 3300046684 Bacteria 9439
284 Ga0495613_0033082 3300046689 Bacteria 3842
285 Ga0495624_0099466 3300046690 Bacteria 1791
286 Ga0495624_0385127 3300046690 Bacteria 842
287 Ga0495670_0178721 3300046691 Bacteria 1120
288 Ga0495671_0011777 3300046692 Bacteria 4794
289 Ga0495649_0004047 3300046694 Bacteria 9652
290 Ga0495649_0105695 3300046694 Bacteria 1494
291 Ga0495589_0001054 3300046794 Bacteria 16591
292 Ga0495600_0130281 3300046809 Bacteria 1635
293 Ga0495604_0016297 3300047317 Bacteria 5938
294 Ga0495672_0012688 3300047320 Bacteria 5862
295 Ga0495680_0000313 3300047322 Bacteria 54486
296 Ga0495680_0131101 3300047322 Bacteria 1842
297 Ga0495683_0003323 3300047323 Bacteria 9404
298 Ga0495683_0151653 3300047323 Bacteria 1078
299 Ga0495687_017254 3300047443 Bacteria 3607
300 Ga0495675_0601295 3300047444 Bacteria 623
301 Ga0495677_0221572 3300047445 Bacteria 737
302 Ga0495673_0015141 3300047469 Bacteria 3984
303 Ga0495673_0023455 3300047469 Bacteria 3000
304 Ga0495684_0109026 3300047471 Bacteria 2091
305 Ga0495686_0099408 3300047472 Bacteria 1756
306 Ga0495593_0025940 3300047673 Bacteria 3241
307 Ga0495593_0243425 3300047673 Bacteria 901
308 Ga0495602_0005919 3300048088 Bacteria 12839
309 Ga0495626_0022828 3300048091 Bacteria 3088
310 Ga0496100_1123981 3300048903 Bacteria 619
311 Ga0496101_0118068 3300048904 Bacteria 2003
312 Ga0496101_0568645 3300048904 Bacteria 896
313 Ga0496102_0015287 3300048905 Bacteria 6683
314 Ga0496102_0072415 3300048905 Bacteria 3167
315 Ga0496102_0104726 3300048905 Bacteria 2632
316 Ga0496102_0809980 3300048905 Bacteria 859
317 Ga0496103_0001116 3300048906 Bacteria 18678
318 Ga0496104_0039334 3300048907 Bacteria 4428
319 Ga0496104_0464665 3300048907 Bacteria 1177
320 Ga0496105_0008782 3300048908 Bacteria 7867
321 Ga0496106_0433309 3300048909 Bacteria 1056
322 Ga0496106_0515673 3300048909 Bacteria 960
323 Ga0496107_0323560 3300048910 Bacteria 1147
324 Ga0496108_0005846 3300048911 Bacteria 9972
325 Ga0496108_0044310 3300048911 Bacteria 3715
326 Ga0496108_0151719 3300048911 Bacteria 2000
327 Ga0496109_0007216 3300048912 Bacteria 9395
328 Ga0496109_0138483 3300048912 Bacteria 2275
329 Ga0496109_0445738 3300048912 Bacteria 1223
330 Ga0496110_0018845 3300048913 Bacteria 5797
331 Ga0496110_0032630 3300048913 Bacteria 4499
332 Ga0496110_0064357 3300048913 Bacteria 3241
333 Ga0496110_0547401 3300048913 Bacteria 1052
334 Ga0496111_0012928 3300048914 Bacteria 5664
335 Ga0496111_0014001 3300048914 Bacteria 5470
336 Ga0496111_0051910 3300048914 Bacteria 2961
337 Ga0496112_0007249 3300048915 Bacteria 9828
338 Ga0496112_0014856 3300048915 Bacteria 7242
339 Ga0496112_0042749 3300048915 Bacteria 4434
340 Ga0496112_0138265 3300048915 Bacteria 2406
341 Ga0496112_0348678 3300048915 Bacteria 1423
342 Ga0496113_0000587 3300048916 Bacteria 18151
343 Ga0496113_0059993 3300048916 Bacteria 2866
344 Ga0496114_0452929 3300048917 Bacteria 1136
345 Ga0496115_0079483 3300048918 Bacteria 2669
346 Ga0496115_0727197 3300048918 Bacteria 778
347 Ga0496116_0083506 3300048919 Bacteria 1971
348 Ga0496118_0163204 3300048921 Bacteria 1374
349 Ga0496119_0128733 3300048922 Bacteria 1382
350 Ga0496121_0002544 3300048924 Bacteria 27646
351 Ga0496121_0029364 3300048924 Bacteria 5086
352 Ga0496123_0003793 3300048926 Bacteria 16547
353 Ga0496124_0187397 3300048927 Bacteria 1587
354 Ga0496125_0224260 3300048928 Bacteria 1208
355 Ga0496125_0400139 3300048928 Bacteria 803
356 Ga0495682_0001836 3300049460 Bacteria 10665
357 Ga0495682_0250961 3300049460 Bacteria 626
358 Ga0501033_0076328 3300049570 Bacteria 2460
359 Ga0501034_0086742 3300049571 Bacteria 3130
360 Ga0501040_0628124 3300049576 Bacteria 776
361 Ga0501041_0215367 3300049577 Bacteria 1205
362 Ga0501048_0627637 3300049582 Bacteria 772
363 Ga0501068_0058521 3300049584 Bacteria 2339
364 Ga0501070_0402936 3300049586 Bacteria 1106
365 Ga0501070_1137336 3300049586 Bacteria 601
366 Ga0501073_0403194 3300049589 Bacteria 945
367 Ga0501074_0708168 3300049590 Bacteria 710
368 Ga0501075_0380553 3300049591 Bacteria 1076
369 Ga0501077_0006872 3300049593 Bacteria 7004
370 Ga0501080_0004368 3300049742 Bacteria 12555
371 Ga0501081_0035431 3300049743 Bacteria 3397
372 Ga0501044_0293638 3300049823 Bacteria 1556
373 Ga0501045_0441838 3300049824 Bacteria 967
374 nmdc:mga03683_320156_c1 3300050489 Bacteria 730
375 nmdc:mga03n38_6655_c1 3300050490 Bacteria 4034
376 nmdc:mga0yw44_126919_c1 3300050492 Bacteria 1648
377 nmdc:mga0yw44_36010_c1 3300050492 Bacteria 2914
378 nmdc:mga0yw44_53569_c1 3300050492 Bacteria 2451
379 nmdc:mga0yw44_906531_c1 3300050492 Bacteria 598
380 nmdc:mga0k408_145063_c1 3300050493 Bacteria 1413
381 nmdc:mga06z11_231905_c1 3300050494 Bacteria 1082
382 nmdc:mga06z11_589_c1 3300050494 Bacteria 13291
383 nmdc:mga04h51_306_c1 3300050495 Bacteria 12357
384 nmdc:mga07m45_185376_c1 3300050496 Bacteria 1210
385 nmdc:mga05p37_21828_c1 3300050507 Bacteria 7755
386 nmdc:mga05p37_53824_c1 3300050507 Bacteria 4950
387 nmdc:mga08y16_362102_c1 3300050511 Bacteria 1489
388 nmdc:mga0a205_375498_c1 3300050515 Bacteria 1287
389 nmdc:mga0sz30_11435_c1 3300050516 Bacteria 3426
390 nmdc:mga0sz30_1357_c1 3300050516 Bacteria 8743
391 Ga0495601_0000589 3300053077 Bacteria 19331
392 Ga0495601_0475895 3300053077 Bacteria 807
393 Ga0495612_0002310 3300053078 Bacteria 7854
394 Ga0495655_0064884 3300053083 Bacteria 1006
395 Ga0495595_0000697 3300053084 Bacteria 12827
396 Ga0495619_0000201 3300053085 Bacteria 43295
397 Ga0500578_0002669 3300053086 Bacteria 14432
398 Ga0500646_0044806 3300053090 Bacteria 1257
399 Ga0500583_0381316 3300053092 Bacteria 679
400 Ga0500651_0000075 3300053093 Bacteria 63708
401 Ga0500650_0003712 3300053098 Bacteria 5375
402 Ga0500556_0000184 3300053104 Bacteria 51248
403 Ga0500557_000054 3300053105 Bacteria 50111
404 Ga0500562_001152 3300053108 Bacteria 6509
405 Ga0500562_003547 3300053108 Bacteria 3915
406 Ga0500569_003210 3300053109 Bacteria 3311
407 Ga0500642_0000136 3300053130 Bacteria 32674
408 Ga0500658_0000515 3300053134 Bacteria 16462
409 Ga0500568_0004797 3300053139 Bacteria 7146
410 Ga0500577_0013957 3300053142 Bacteria 2470
411 Ga0500604_0003046 3300053151 Bacteria 4503
412 Ga0500616_0009794 3300053153 Bacteria 5782
413 Ga0500622_0005063 3300053156 Bacteria 8023
414 Ga0500627_0052587 3300053158 Bacteria 1778
415 Ga0500625_012297 3300053729 Bacteria 3911
416 Ga0501084_0075243 3300054114 Bacteria 2829
417 Ga0501082_0045413 3300060353 Bacteria 3789
418 Ga0501082_0074402 3300060353 Bacteria 2926
419 Ga0501082_0178958 3300060353 Bacteria 1844
420 Ga0530510_0202008 3300061734 Bacteria 1476
421 2824756256 2824753945 Bacteria 9787441
422 2824765742 2824763712 Bacteria 9792355
423 2857513021 2857509624 Bacteria 7472071
424 2874635257 2874628541 Bacteria 8630250
425 2876811770 2876808645 Bacteria 8824342
426 2879116847 2879110137 Bacteria 8907982
427 2904715405 2904711408 Bacteria 9771557
428 Ga0496126_0786876
429 JGI25165J46597_1015008
430 Ga0065715_10212232
431 Ga0070658_10760313
432 Ga0070676_10483704
433 Ga0070683_100023689
434 Ga0070670_100132233
435 Ga0070682_100068428
436 Ga0070682_100098131
437 Ga0068868_100051004
438 Ga0070660_100154357
439 Ga0070661_100343369
440 Ga0070673_100401985
441 Ga0070667_101039395
442 Ga0070709_10088358
443 Ga0070709_10570893
444 Ga0070714_100070379
445 Ga0070714_100365367
446 Ga0070713_100118522
447 Ga0070713_100293594
448 Ga0070713_100358772
449 Ga0070713_100702309
450 Ga0070710_10052314
451 Ga0070711_100151062
452 Ga0070711_100209724
453 Ga0070708_100067507
454 Ga0070708_100690613
455 Ga0070663_100058942
456 Ga0070663_100097828
457 Ga0070663_100457069
458 Ga0070663_100531360
459 Ga0070678_100237989
460 Ga0070662_100336985
461 Ga0070681_10451322
462 Ga0070706_100091594
463 Ga0070706_100114042
464 Ga0070707_100002314
465 Ga0070698_100061631
466 Ga0070698_100138693
467 Ga0070699_100120905
468 Ga0070684_100128798
469 Ga0070697_100030504
470 Ga0070697_100188980
471 Ga0068853_100272758
472 Ga0070672_100408852
473 Ga0070693_100462955
474 Ga0070665_100132899
475 Ga0068854_100283056
476 Ga0068856_100286936
477 Ga0068856_101339320
478 Ga0068852_100072740
479 Ga0068852_100321704
480 Ga0068859_100758530
481 Ga0068864_100057420
482 Ga0068864_101466743
483 Ga0068870_10312865
484 Ga0068863_100548702
485 Ga0068862_100383402
486 Ga0081540_1004835
487 Ga0081539_10017330
488 Ga0070717_10020276
489 Ga0075365_10001051
490 Ga0075365_10478431
491 Ga0075368_10000295
492 Ga0075368_10120539
493 Ga0075363_100019552
494 Ga0075363_100363255
495 Ga0075364_10055438
496 Ga0075364_10176633
497 Ga0070715_10015986
498 Ga0070715_10152298
499 Ga0070716_100148766
500 Ga0070712_100031324
501 Ga0075362_10132671
502 Ga0075367_10110852
503 Ga0075367_10203807
504 Ga0075369_10003291
505 Ga0075369_10089400
506 Ga0075369_10255711
507 Ga0075366_10016323
508 Ga0097621_100090834
509 Ga0068871_100051138
510 Ga0075428_100016717
511 Ga0075428_100030270
512 Ga0075428_101443062
513 Ga0075431_100051332
514 Ga0075431_101031326
515 Ga0075433_10153857
516 Ga0097620_100758520
517 Ga0099795_10026420
518 Ga0111539_10153458
519 Ga0111539_11839412
520 Ga0105245_10015471
521 Ga0105247_10196839
522 Ga0114129_10029597
523 Ga0114129_10098994
524 Ga0105243_10235233
525 Ga0105241_10666871
526 Ga0105241_11109858
527 Ga0105242_10102850
528 Ga0105242_11119721
529 Ga0105248_10850155
530 Ga0105237_10129581
531 Ga0105237_10491944
532 Ga0105249_11499355
533 Ga0099796_10074670
534 Ga0105239_10007972
535 Ga0105239_10059403
536 Ga0105239_10167047
537 Ga0105239_10170671
538 Ga0105239_11346924
539 Ga0105246_10025723
540 Ga0157369_10208647
541 Ga0157369_10481992
542 Ga0157374_10014474
543 Ga0157374_10207125
544 Ga0157378_10853730
545 Ga0163162_10002568
546 Ga0157372_10616653
547 Ga0157372_10702225
548 Ga0157375_11264767
549 Ga0163163_10059741
550 Ga0163163_10187536
551 Ga0157376_10051015
552 Ga0157376_10486047
553 Ga0163161_10847972
554 Ga0213873_10001123
555 Ga0213872_10139851
556 Ga0213871_10013058
557 Ga0213871_10030847
558 Ga0213871_10104539
559 Ga0224712_10377901
560 Ga0209233_1017729
561 Ga0207692_10061093
562 Ga0207688_10413120
563 Ga0207699_10047270
564 Ga0207705_10044206
565 Ga0207705_10524266
566 Ga0207684_10105666
567 Ga0207707_10206223
568 Ga0207707_10309374
569 Ga0207671_10430238
570 Ga0207693_10006696
571 Ga0207663_10046426
572 Ga0207663_10099299
573 Ga0207663_10211678
574 Ga0207662_10266135
575 Ga0207657_10051235
576 Ga0207657_10687141
577 Ga0207649_10276309
578 Ga0207646_10481535
579 Ga0207694_10187572
580 Ga0207650_10237737
581 Ga0207687_10047209
582 Ga0207700_10226454
583 Ga0207700_10415770
584 Ga0207664_10547356
585 Ga0207664_10590536
586 Ga0207644_10071588
587 Ga0207706_10325943
588 Ga0207686_10593765
589 Ga0207709_10149641
590 Ga0207669_10480936
591 Ga0207665_10007621
592 Ga0207691_10922680
593 Ga0207711_10492049
594 Ga0207689_10349620
595 Ga0207679_10026351
596 Ga0207651_10402925
597 Ga0207668_10087272
598 Ga0207677_10136276
599 Ga0207677_10449665
600 Ga0207678_10004475
601 Ga0207678_10011970
602 Ga0207678_10282698
603 Ga0207676_10074499
604 Ga0207676_11055241
605 Ga0207674_10198264
606 Ga0207683_10002920
607 Ga0207698_10104770
608 Ga0207698_10503261
609 Ga0209389_1000001
610 Ga0209489_115912
611 Ga0209700_100007
612 Ga0209813_10003097
613 Ga0207428_10186234
614 Ga0268266_10355490
615 Ga0268265_10699214
616 Ga0265332_10003643
617 Ga0265340_10006217
618 Ga0265339_10002276
619 Ga0265316_10177357
620 Ga0265314_10028076
621 Ga0265342_10000073
622 Ga0307510_10046673
623 Ga0373923_0107631
624 Ga0373953_0109795
625 Ga0373954_0007790
626 Ga0373957_0032699
627 Ga0373943_0414091
628 Ga0373955_0008546
629 Ga0373924_0006488
630 Ga0373931_0260569
631 Ga0373927_0013653
632 Ga0373927_0168635
633 Ga0373933_0000258
634 Ga0373947_0007628
635 Ga0373947_0102152
636 Ga0373937_0000814
637 Ga0373925_0017734
638 Ga0395900_0110146
639 Ga0395901_0731650
640 Ga0436365_1060192
641 Ga0436360_0872758
642 Ga0436361_0689910
643 Ga0436361_1065805
644 Ga0436362_0194916
645 Ga0439453_0005886
646 Ga0451789_0633200
647 Ga0439435_0029389
648 Ga0466972_0000247
649 Ga0466966_0030791
650 Ga0466970_0048428
651 Ga0466957_0235641
652 Ga0466959_0061600
653 Ga0495617_006913
654 Ga0495592_0003878
655 Ga0495603_0267119
656 Ga0495590_0000471
657 Ga0495590_0026848
658 Ga0495629_0006214
659 Ga0495651_0000514
660 Ga0495651_0597547
661 Ga0495653_0018643
662 Ga0495605_0013948
663 Ga0495605_0264727
664 Ga0495664_0019823
665 Ga0495664_0513866
666 Ga0495584_0051114
667 Ga0495585_0122909
668 Ga0495596_0002212
669 Ga0495606_0000472
670 Ga0495606_0002520
671 Ga0495606_0138739
672 Ga0495606_0147032
673 Ga0495608_0000398
674 Ga0495610_0001054
675 Ga0495618_0016275
676 Ga0495628_0010648
677 Ga0495630_0391049
678 Ga0495631_0014291
679 Ga0495632_0001023
680 Ga0495643_0010177
681 Ga0495643_0041109
682 Ga0495643_0116700
683 Ga0495648_0005763
684 Ga0495642_0006811
685 Ga0495652_0016289
686 Ga0495652_0222352
687 Ga0495652_0262594
688 Ga0495665_0522442
689 Ga0495640_0008514
690 Ga0495587_0000599
691 Ga0495609_0076118
692 Ga0495597_0006352
693 Ga0495645_0014260
694 Ga0495622_0036477
695 Ga0495667_0006515
696 Ga0495667_0333671
697 Ga0495668_0000480
698 Ga0495668_0149940
699 Ga0495634_0013501
700 Ga0495625_0002682
701 Ga0495625_0075920
702 Ga0495635_0006281
703 Ga0495635_0154579
704 Ga0495659_0170419
705 Ga0495588_0437610
706 Ga0495599_0014416
707 Ga0495623_0011910
708 Ga0495647_0088055
709 Ga0495658_0024599
710 Ga0495669_0001553
711 Ga0495613_0033082
712 Ga0495624_0099466
713 Ga0495624_0385127
714 Ga0495670_0178721
715 Ga0495671_0011777
716 Ga0495649_0004047
717 Ga0495649_0105695
718 Ga0495589_0001054
719 Ga0495600_0130281
720 Ga0495604_0016297
721 Ga0495672_0012688
722 Ga0495680_0000313
723 Ga0495680_0131101
724 Ga0495683_0003323
725 Ga0495683_0151653
726 Ga0495687_017254
727 Ga0495675_0601295
728 Ga0495677_0221572
729 Ga0495673_0015141
730 Ga0495673_0023455
731 Ga0495684_0109026
732 Ga0495686_0099408
733 Ga0495593_0025940
734 Ga0495593_0243425
735 Ga0495602_0005919
736 Ga0495626_0022828
737 Ga0496100_1123981
738 Ga0496101_0118068
739 Ga0496101_0568645
740 Ga0496102_0015287
741 Ga0496102_0072415
742 Ga0496102_0104726
743 Ga0496102_0809980
744 Ga0496103_0001116
745 Ga0496104_0039334
746 Ga0496104_0464665
747 Ga0496105_0008782
748 Ga0496106_0433309
749 Ga0496106_0515673
750 Ga0496107_0323560
751 Ga0496108_0005846
752 Ga0496108_0044310
753 Ga0496108_0151719
754 Ga0496109_0007216
755 Ga0496109_0138483
756 Ga0496109_0445738
757 Ga0496110_0018845
758 Ga0496110_0032630
759 Ga0496110_0064357
760 Ga0496110_0547401
761 Ga0496111_0012928
762 Ga0496111_0014001
763 Ga0496111_0051910
764 Ga0496112_0007249
765 Ga0496112_0014856
766 Ga0496112_0042749
767 Ga0496112_0138265
768 Ga0496112_0348678
769 Ga0496113_0000587
770 Ga0496113_0059993
771 Ga0496114_0452929
772 Ga0496115_0079483
773 Ga0496115_0727197
774 Ga0496116_0083506
775 Ga0496118_0163204
776 Ga0496119_0128733
777 Ga0496121_0002544
778 Ga0496121_0029364
779 Ga0496123_0003793
780 Ga0496124_0187397
781 Ga0496125_0224260
782 Ga0496125_0400139
783 Ga0495682_0001836
784 Ga0495682_0250961
785 Ga0501033_0076328
786 Ga0501034_0086742
787 Ga0501040_0628124
788 Ga0501041_0215367
789 Ga0501048_0627637
790 Ga0501068_0058521
791 Ga0501070_0402936
792 Ga0501070_1137336
793 Ga0501073_0403194
794 Ga0501074_0708168
795 Ga0501075_0380553
796 Ga0501077_0006872
797 Ga0501080_0004368
798 Ga0501081_0035431
799 Ga0501044_0293638
800 Ga0501045_0441838
801 nmdc:mga03683_320156_c1
802 nmdc:mga03n38_6655_c1
803 nmdc:mga0yw44_126919_c1
804 nmdc:mga0yw44_36010_c1
805 nmdc:mga0yw44_53569_c1
806 nmdc:mga0yw44_906531_c1
807 nmdc:mga0k408_145063_c1
808 nmdc:mga06z11_231905_c1
809 nmdc:mga06z11_589_c1
810 nmdc:mga04h51_306_c1
811 nmdc:mga07m45_185376_c1
812 nmdc:mga05p37_21828_c1
813 nmdc:mga05p37_53824_c1
814 nmdc:mga08y16_362102_c1
815 nmdc:mga0a205_375498_c1
816 nmdc:mga0sz30_11435_c1
817 nmdc:mga0sz30_1357_c1
818 Ga0495601_0000589
819 Ga0495601_0475895
820 Ga0495612_0002310
821 Ga0495655_0064884
822 Ga0495595_0000697
823 Ga0495619_0000201
824 Ga0500578_0002669
825 Ga0500646_0044806
826 Ga0500583_0381316
827 Ga0500651_0000075
828 Ga0500650_0003712
829 Ga0500556_0000184
830 Ga0500557_000054
831 Ga0500562_001152
832 Ga0500562_003547
833 Ga0500569_003210
834 Ga0500642_0000136
835 Ga0500658_0000515
836 Ga0500568_0004797
837 Ga0500577_0013957
838 Ga0500604_0003046
839 Ga0500616_0009794
840 Ga0500622_0005063
841 Ga0500627_0052587
842 Ga0500625_012297
843 Ga0501084_0075243
844 Ga0501082_0045413
845 Ga0501082_0074402
846 Ga0501082_0178958
847 Ga0530510_0202008
848 2824756256
849 2824765742
850 2857513021
851 2874635257
852 2876811770
853 2879116847
854 2904715405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

84

156

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

16

84

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9559 10 160
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9426 12 160
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9413 12 160
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9405 10 160
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9395 12 160
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9395 10 86 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9298 11 86 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9296 10 84 3.10.20.30
5y6qA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9287 89 160 1.10.150.120
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9267 12 86 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A520J569-F1-model_v4 (2Fe-2S)-binding protein 0.9683 10 160 GO:0016903
GO:0046872
GO:0051537
AF-A0A3N7IGV2-F1-model_v4 (2Fe-2S)-binding protein 0.9668 11 162 GO:0016903
GO:0046872
GO:0051537
AF-A0A519S0C2-F1-model_v4 (2Fe-2S)-binding protein 0.9666 12 161 GO:0016903
GO:0046872
GO:0051537
AF-A0A7G6U906-F1-model_v4 (2Fe-2S)-binding protein 0.9656 12 161 GO:0016903
GO:0046872
GO:0051537
AF-A0A1H7QB46-F1-model_v4 Xanthine dehydrogenase YagT iron-sulfur-binding subunit 0.9634 10 161 GO:0016903
GO:0046872
GO:0051537

Map