F441433

General Info

Members Datasets Scaffolds Average Seq Length
427 200 403 122

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10920859|Ga0111539_109208592
Length 118
Sequence MTVAGQSTYLDRPSPSSLADVIDTILDKGLVIDIYVRVSLLGIELVTVDARIVVASVDTYLRFAEAVNRLDLTETQTGGIPELMEGLAESDQEGKGRGAIEAASEKVSEFLGDKRAKS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.39
Metatranscriptomes 20.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.01
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10081936 3300003203 Bacteria 988
2 Ga0006777J48905_1050010 3300003308 Bacteria 1175
3 Ga0032354_1061107 3300003693 Bacteria 919
4 Ga0006780_1037103 3300003735 Bacteria 805
5 Ga0070676_11267891 3300005328 Bacteria 562
6 Ga0070683_100013248 3300005329 Bacteria 7187
7 Ga0070680_100037272 3300005336 Bacteria 3928
8 Ga0070680_100098894 3300005336 Bacteria 2420
9 Ga0068868_100082216 3300005338 Bacteria 2583
10 Ga0070660_100423126 3300005339 Bacteria 1103
11 Ga0070660_100431515 3300005339 Bacteria 1092
12 Ga0070689_100269049 3300005340 Bacteria 1410
13 Ga0070675_100357980 3300005354 Bacteria 1295
14 Ga0070673_100236613 3300005364 Bacteria 1586
15 Ga0070688_100106563 3300005365 Bacteria 1857
16 Ga0070659_100695259 3300005366 Bacteria 879
17 Ga0070709_10322255 3300005434 Bacteria 1134
18 Ga0070714_100007122 3300005435 Bacteria 8676
19 Ga0070714_100267841 3300005435 Bacteria 1583
20 Ga0070714_100322902 3300005435 Bacteria 1444
21 Ga0070714_100391112 3300005435 Bacteria 1312
22 Ga0070713_100044639 3300005436 Bacteria 3629
23 Ga0070713_100146633 3300005436 Bacteria 2096
24 Ga0070713_100521897 3300005436 Bacteria 1122
25 Ga0070705_100434243 3300005440 Bacteria 981
26 Ga0070700_100453022 3300005441 Bacteria 977
27 Ga0070694_101113733 3300005444 Bacteria 659
28 Ga0070694_101118509 3300005444 Bacteria 658
29 Ga0070662_100109088 3300005457 Bacteria 2106
30 Ga0070681_10054858 3300005458 Bacteria 3971
31 Ga0070681_10078002 3300005458 Bacteria 3269
32 Ga0070681_10873112 3300005458 Bacteria 818
33 Ga0070679_100097748 3300005530 Bacteria 2923
34 Ga0070679_100775457 3300005530 Bacteria 902
35 Ga0070684_100008348 3300005535 Bacteria 8089
36 Ga0070684_100586668 3300005535 Bacteria 1036
37 Ga0070684_100933041 3300005535 Bacteria 814
38 Ga0070695_100425850 3300005545 Bacteria 1012
39 Ga0070693_101084432 3300005547 Bacteria 610
40 Ga0070704_100133928 3300005549 Bacteria 1925
41 Ga0070704_100438565 3300005549 Bacteria 1122
42 Ga0070704_101477459 3300005549 Bacteria 625
43 Ga0068855_100030742 3300005563 Bacteria 6420
44 Ga0070664_100345649 3300005564 Bacteria 1352
45 Ga0068854_100270080 3300005578 Unclassified 1365
46 Ga0068856_100761943 3300005614 Bacteria 988
47 Ga0068856_101099122 3300005614 Bacteria 812
48 Ga0070702_100177119 3300005615 Bacteria 1392
49 Ga0068852_102244390 3300005616 Bacteria 567
50 Ga0068860_102837488 3300005843 Bacteria 502
51 Ga0081455_10000439 3300005937 Bacteria 54636
52 Ga0081538_10039202 3300005981 Bacteria 3042
53 Ga0081539_10000639 3300005985 Bacteria 70847
54 Ga0070717_10013228 3300006028 Bacteria 6315
55 Ga0075432_10114527 3300006058 Bacteria 1008
56 Ga0070715_10079742 3300006163 Bacteria 1483
57 Ga0070716_100025827 3300006173 Bacteria 3139
58 Ga0070716_100262891 3300006173 Bacteria 1182
59 Ga0070712_100024630 3300006175 Bacteria 3990
60 Ga0070712_100085807 3300006175 Bacteria 2293
61 Ga0075431_100149394 3300006847 Bacteria 2406
62 Ga0075431_101726708 3300006847 Bacteria 583
63 Ga0075431_101821304 3300006847 Bacteria 565
64 Ga0075433_10059667 3300006852 Bacteria 3338
65 Ga0075433_10412348 3300006852 Bacteria 1191
66 Ga0075434_100004184 3300006871 Bacteria 12929
67 Ga0075434_100065387 3300006871 Bacteria 3622
68 Ga0075434_100107907 3300006871 Bacteria 2795
69 Ga0075434_100478012 3300006871 Bacteria 1267
70 Ga0075434_101582296 3300006871 Unclassified 664
71 Ga0075436_100159753 3300006914 Bacteria 1588
72 Ga0075435_100017592 3300007076 Bacteria 5415
73 Ga0075435_100019323 3300007076 Bacteria 5201
74 Ga0075435_100124026 3300007076 Bacteria 2157
75 Ga0105240_11826324 3300009093 Bacteria 633
76 Ga0111539_10083013 3300009094 Bacteria 3768
77 Ga0111539_10920859 3300009094 Bacteria 1016
78 Ga0105245_10032247 3300009098 Bacteria 4639
79 Ga0114129_10155604 3300009147 Bacteria 3126
80 Ga0105241_11317856 3300009174 Bacteria 688
81 Ga0105242_11340622 3300009176 Bacteria 741
82 Ga0105242_12431520 3300009176 Bacteria 571
83 Ga0105248_11918663 3300009177 Bacteria 672
84 Ga0105238_11194328 3300009551 Bacteria 785
85 Ga0157320_1012974 3300012481 Bacteria 676
86 Ga0157373_11061243 3300013100 Bacteria 606
87 Ga0157373_11251746 3300013100 Bacteria 560
88 Ga0157374_12932708 3300013296 Bacteria 504
89 Ga0163162_11200548 3300013306 Bacteria 861
90 Ga0157372_11032215 3300013307 Bacteria 952
91 Ga0157372_12624811 3300013307 Bacteria 578
92 Ga0157375_10084048 3300013308 Bacteria 3230
93 Ga0157375_11631780 3300013308 Bacteria 763
94 Ga0197907_10446238 3300020069 Bacteria 1240
95 Ga0206356_11519433 3300020070 Bacteria 751
96 Ga0206356_11900830 3300020070 Bacteria 1831
97 Ga0206349_1051630 3300020075 Bacteria 613
98 Ga0206349_1465640 3300020075 Bacteria 598
99 Ga0206351_10307836 3300020077 Bacteria 2768
100 Ga0206351_10711578 3300020077 Bacteria 2459
101 Ga0206351_10778341 3300020077 Bacteria 831
102 Ga0206351_10852558 3300020077 Bacteria 1063
103 Ga0206352_10246285 3300020078 Bacteria 833
104 Ga0206352_10314912 3300020078 Unclassified 960
105 Ga0206352_10363894 3300020078 Bacteria 538
106 Ga0206352_10741160 3300020078 Bacteria 1531
107 Ga0206350_10720888 3300020080 Bacteria 2959
108 Ga0206350_10851596 3300020080 Bacteria 1973
109 Ga0206354_11049990 3300020081 Bacteria 1172
110 Ga0206354_11532108 3300020081 Bacteria 1446
111 Ga0206353_10262973 3300020082 Bacteria 1126
112 Ga0206353_10833568 3300020082 Bacteria 795
113 Ga0154015_1256524 3300020610 Bacteria 725
114 Ga0224712_10011520 3300022467 Bacteria 2749
115 Ga0224712_10041961 3300022467 Bacteria 1731
116 Ga0224712_10177697 3300022467 Unclassified 957
117 Ga0207685_10055493 3300025905 Bacteria 1547
118 Ga0207699_10025262 3300025906 Bacteria 3259
119 Ga0207699_10128097 3300025906 Bacteria 1652
120 Ga0207707_10224104 3300025912 Unclassified 1636
121 Ga0207707_10474123 3300025912 Bacteria 1069
122 Ga0207707_10739925 3300025912 Bacteria 823
123 Ga0207693_10011917 3300025915 Bacteria 7027
124 Ga0207693_10042937 3300025915 Bacteria 3559
125 Ga0207663_10244598 3300025916 Bacteria 1317
126 Ga0207660_10121921 3300025917 Bacteria 1975
127 Ga0207660_10129194 3300025917 Bacteria 1921
128 Ga0207657_10138575 3300025919 Bacteria 1989
129 Ga0207657_10371354 3300025919 Bacteria 1127
130 Ga0207652_10056417 3300025921 Bacteria 3381
131 Ga0207659_11206331 3300025926 Bacteria 650
132 Ga0207687_10010410 3300025927 Bacteria 6077
133 Ga0207700_10000004 3300025928 Bacteria 443409
134 Ga0207700_11097208 3300025928 Bacteria 711
135 Ga0207664_10246242 3300025929 Bacteria 1558
136 Ga0207664_11222310 3300025929 Bacteria 670
137 Ga0207664_11601697 3300025929 Bacteria 573
138 Ga0207644_11528269 3300025931 Bacteria 560
139 Ga0207690_10585964 3300025932 Bacteria 909
140 Ga0207706_10032689 3300025933 Bacteria 4631
141 Ga0207670_10697092 3300025936 Bacteria 840
142 Ga0207689_10928601 3300025942 Bacteria 734
143 Ga0207661_10035579 3300025944 Bacteria 3882
144 Ga0207679_10604346 3300025945 Bacteria 989
145 Ga0207667_10617335 3300025949 Bacteria 1092
146 Ga0207667_10739655 3300025949 Bacteria 984
147 Ga0207667_11042745 3300025949 Bacteria 803
148 Ga0207677_10708064 3300026023 Unclassified 894
149 Ga0207677_10918886 3300026023 Bacteria 790
150 Ga0207708_10507867 3300026075 Bacteria 1011
151 Ga0207702_11032587 3300026078 Bacteria 816
152 Ga0207683_10212593 3300026121 Bacteria 1761
153 Ga0207698_10292313 3300026142 Bacteria 1513
154 Ga0207698_11856035 3300026142 Bacteria 618
155 Ga0207698_12174350 3300026142 Bacteria 568
156 Ga0207428_10125898 3300027907 Bacteria 1962
157 Ga0207428_10128386 3300027907 Bacteria 1941
158 Ga0268264_10457227 3300028381 Bacteria 1238
159 Ga0307409_100443182 3300031995 Bacteria 1252
160 Ga0307415_101592094 3300032126 Bacteria 627
161 Ga0373943_0002151 3300035170 Bacteria 8959
162 Ga0373943_0097697 3300035170 Bacteria 1531
163 Ga0373943_0416258 3300035170 Bacteria 777
164 Ga0373946_0514786 3300035171 Bacteria 615
165 Ga0373935_0052060 3300035692 Bacteria 2602
166 Ga0373935_0399154 3300035692 Bacteria 987
167 Ga0373927_0475547 3300035695 Bacteria 826
168 Ga0373947_0000346 3300035725 Bacteria 26182
169 Ga0373947_0007374 3300035725 Bacteria 6367
170 Ga0373947_0951058 3300035725 Bacteria 586
171 Ga0373925_0011633 3300037068 Bacteria 6364
172 Ga0373925_0058105 3300037068 Bacteria 2900
173 Ga0395900_1005380 3300037418 Bacteria 754
174 Ga0395898_0069707 3300037466 Bacteria 3401
175 Ga0395901_0559754 3300038443 Bacteria 1158
176 Ga0451800_0434479 3300041459 Bacteria 2140
177 Ga0451807_0309764 3300041486 Bacteria 683
178 Ga0451853_0269936 3300041512 Bacteria 4417
179 Ga0466969_0158713 3300044656 Bacteria 1040
180 Ga0466969_0228102 3300044656 Bacteria 846
181 Ga0466972_0255031 3300044658 Bacteria 820
182 Ga0466965_0177189 3300044683 Bacteria 1124
183 Ga0466965_0194585 3300044683 Bacteria 1074
184 Ga0466966_0009409 3300044684 Bacteria 6470
185 Ga0466966_0032318 3300044684 Bacteria 3392
186 Ga0466966_0348425 3300044684 Bacteria 890
187 Ga0466961_0019049 3300044693 Bacteria 4415
188 Ga0466961_0093782 3300044693 Bacteria 1894
189 Ga0466961_0122946 3300044693 Bacteria 1629
190 Ga0466961_0288422 3300044693 Bacteria 1004
191 Ga0466963_0006083 3300044694 Bacteria 7117
192 Ga0466963_0006311 3300044694 Bacteria 7011
193 Ga0466963_0007325 3300044694 Bacteria 6576
194 Ga0466963_0014533 3300044694 Bacteria 4856
195 Ga0466963_0043890 3300044694 Bacteria 2941
196 Ga0466963_0112021 3300044694 Bacteria 1874
197 Ga0466963_0138326 3300044694 Bacteria 1686
198 Ga0466963_0408105 3300044694 Bacteria 958
199 Ga0466963_0524917 3300044694 Bacteria 836
200 Ga0466963_0631590 3300044694 Bacteria 756
201 Ga0466964_0006796 3300044706 Bacteria 4266
202 Ga0466964_0012945 3300044706 Bacteria 3160
203 Ga0466964_0025241 3300044706 Bacteria 2320
204 Ga0466964_0189522 3300044706 Bacteria 980
205 Ga0466971_0012678 3300044719 Bacteria 3697
206 Ga0466971_0429940 3300044719 Bacteria 646
207 Ga0466968_0144116 3300044735 Bacteria 1091
208 Ga0466968_0265412 3300044735 Bacteria 818
209 Ga0466968_0351942 3300044735 Bacteria 716
210 Ga0466968_0503630 3300044735 Bacteria 604
211 Ga0466970_0129654 3300044765 Bacteria 1385
212 Ga0466970_0261168 3300044765 Bacteria 971
213 Ga0466970_0315253 3300044765 Bacteria 883
214 Ga0466957_0087813 3300044842 Bacteria 1945
215 Ga0466957_0113141 3300044842 Bacteria 1723
216 Ga0466957_0152975 3300044842 Bacteria 1493
217 Ga0466957_0252412 3300044842 Bacteria 1173
218 Ga0466957_0329861 3300044842 Bacteria 1031
219 Ga0466957_0719819 3300044842 Bacteria 705
220 Ga0466957_1272098 3300044842 Bacteria 533
221 Ga0466959_0009724 3300045049 Bacteria 6848
222 Ga0466959_0084343 3300045049 Bacteria 2287
223 Ga0466959_0087125 3300045049 Bacteria 2246
224 Ga0466959_0125700 3300045049 Bacteria 1820
225 Ga0466959_0132483 3300045049 Bacteria 1766
226 Ga0466959_0249954 3300045049 Bacteria 1223
227 Ga0466959_0360229 3300045049 Bacteria 991
228 Ga0466959_0421408 3300045049 Bacteria 906
229 Ga0466959_0663338 3300045049 Bacteria 700
230 Ga0466959_0892367 3300045049 Bacteria 593
231 Ga0466958_0006541 3300045836 Bacteria 6350
232 Ga0466958_0008181 3300045836 Bacteria 5790
233 Ga0466958_0022522 3300045836 Bacteria 3692
234 Ga0466958_0343533 3300045836 Bacteria 960
235 Ga0466958_0477649 3300045836 Bacteria 808
236 Ga0466958_0685121 3300045836 Bacteria 667
237 Ga0466958_0815698 3300045836 Bacteria 608
238 Ga0466958_1054617 3300045836 Bacteria 530
239 Ga0466967_0000171 3300045976 Bacteria 26713
240 Ga0466967_0000375 3300045976 Bacteria 20754
241 Ga0466967_0004160 3300045976 Bacteria 9683
242 Ga0466967_0014944 3300045976 Bacteria 6071
243 Ga0466967_0035158 3300045976 Bacteria 4261
244 Ga0466967_0068703 3300045976 Bacteria 3164
245 Ga0466967_0128891 3300045976 Bacteria 2346
246 Ga0466967_0142548 3300045976 Bacteria 2233
247 Ga0466967_0356959 3300045976 Unclassified 1415
248 Ga0466967_0379403 3300045976 Unclassified 1372
249 Ga0466967_0394170 3300045976 Bacteria 1346
250 Ga0466967_0395216 3300045976 Bacteria 1344
251 Ga0466967_0426863 3300045976 Bacteria 1293
252 Ga0466967_0482590 3300045976 Bacteria 1215
253 Ga0466967_1144896 3300045976 Bacteria 775
254 Ga0495603_0003391 3300046455 Bacteria 9486
255 Ga0495629_0557354 3300046459 Bacteria 769
256 Ga0495641_0005424 3300046461 Bacteria 8627
257 Ga0495580_0228694 3300046472 Bacteria 1277
258 Ga0495582_0277069 3300046473 Bacteria 963
259 Ga0495639_0336606 3300046475 Bacteria 756
260 Ga0495639_0346700 3300046475 Bacteria 745
261 Ga0495594_0006399 3300046499 Bacteria 6059
262 Ga0495630_0179708 3300046517 Bacteria 1613
263 Ga0495644_0263840 3300046523 Bacteria 670
264 Ga0495609_0400544 3300046538 Bacteria 549
265 Ga0495645_0016609 3300046543 Bacteria 5259
266 Ga0495667_0998933 3300046559 Bacteria 510
267 Ga0495588_0000814 3300046674 Bacteria 13912
268 Ga0495657_0041592 3300046675 Bacteria 3144
269 Ga0495658_0157593 3300046683 Bacteria 1398
270 Ga0495669_0326894 3300046684 Bacteria 740
271 Ga0495613_0249258 3300046689 Bacteria 1240
272 Ga0495613_0512240 3300046689 Bacteria 807
273 Ga0495624_0093366 3300046690 Unclassified 1855
274 Ga0495581_0520907 3300047315 Bacteria 691
275 Ga0495676_0011685 3300047321 Bacteria 7917
276 Ga0495676_0132869 3300047321 Bacteria 1794
277 Ga0495676_0344717 3300047321 Bacteria 997
278 Ga0495680_0056916 3300047322 Bacteria 3026
279 Ga0495685_286888 3300047447 Bacteria 518
280 Ga0495614_0286054 3300048089 Bacteria 760
281 Ga0496100_0054464 3300048903 Bacteria 2609
282 Ga0496100_0099747 3300048903 Bacteria 1999
283 Ga0496100_0581912 3300048903 Bacteria 868
284 Ga0496100_0771179 3300048903 Bacteria 753
285 Ga0496100_1300191 3300048903 Bacteria 574
286 Ga0496101_0557474 3300048904 Bacteria 906
287 Ga0496102_0237994 3300048905 Bacteria 1717
288 Ga0496102_0445561 3300048905 Bacteria 1215
289 Ga0496103_0199018 3300048906 Bacteria 1288
290 Ga0496104_0274664 3300048907 Bacteria 1598
291 Ga0496105_0071579 3300048908 Bacteria 2865
292 Ga0496105_0281028 3300048908 Bacteria 1342
293 Ga0496105_0325173 3300048908 Bacteria 1232
294 Ga0496106_0269025 3300048909 Bacteria 1364
295 Ga0496107_0002867 3300048910 Bacteria 11400
296 Ga0496107_0705691 3300048910 Bacteria 742
297 Ga0496107_0762216 3300048910 Bacteria 710
298 Ga0496108_0009437 3300048911 Bacteria 7902
299 Ga0496108_0068335 3300048911 Bacteria 2998
300 Ga0496108_0207361 3300048911 Bacteria 1701
301 Ga0496108_0806116 3300048911 Bacteria 810
302 Ga0496109_0009340 3300048912 Bacteria 8356
303 Ga0496109_0260045 3300048912 Bacteria 1635
304 Ga0496109_0276185 3300048912 Bacteria 1583
305 Ga0496109_1361635 3300048912 Bacteria 645
306 Ga0496110_0009591 3300048913 Bacteria 7834
307 Ga0496110_0063921 3300048913 Bacteria 3252
308 Ga0496110_0511149 3300048913 Bacteria 1093
309 Ga0496110_0617318 3300048913 Bacteria 983
310 Ga0496111_0064006 3300048914 Bacteria 2667
311 Ga0496111_0135302 3300048914 Bacteria 1825
312 Ga0496111_0211495 3300048914 Bacteria 1440
313 Ga0496111_0439035 3300048914 Bacteria 963
314 Ga0496112_0144318 3300048915 Bacteria 2349
315 Ga0496112_0149433 3300048915 Bacteria 2304
316 Ga0496112_0176293 3300048915 Bacteria 2103
317 Ga0496113_0187354 3300048916 Bacteria 1642
318 Ga0496113_0890014 3300048916 Bacteria 705
319 Ga0496114_0294461 3300048917 Bacteria 1432
320 Ga0496114_0367109 3300048917 Bacteria 1274
321 Ga0496114_1227851 3300048917 Unclassified 636
322 Ga0496115_0074064 3300048918 Bacteria 2764
323 Ga0496115_0087590 3300048918 Bacteria 2541
324 Ga0501067_0001043 3300049583 Bacteria 14898
325 Ga0501069_0009597 3300049585 Bacteria 5109
326 nmdc:mga05p37_124293_c1 3300050507 Bacteria 3169
327 nmdc:mga0n895_12063_c1 3300050512 Bacteria 7736
328 nmdc:mga0n895_15207_c1 3300050512 Bacteria 7012
329 nmdc:mga0n895_231498_c1 3300050512 Bacteria 1875
330 nmdc:mga0n895_32988_c1 3300050512 Bacteria 4973
331 nmdc:mga0rr50_11427_c1 3300050513 Bacteria 5685
332 nmdc:mga0rr50_243999_c1 3300050513 Bacteria 1490
333 nmdc:mga0rr50_294013_c1 3300050513 Bacteria 1358
334 nmdc:mga0rr50_88667_c1 3300050513 Bacteria 2404
335 nmdc:mga08x19_660251_c1 3300050514 Bacteria 742
336 nmdc:mga0a205_38152_c2 3300050515 Bacteria 2896
337 nmdc:mga0a205_393960_c1 3300050515 Bacteria 1249
338 nmdc:mga0a205_415462_c1 3300050515 Bacteria 1208
339 nmdc:mga0a205_4711_c1 3300050515 Bacteria 12251
340 nmdc:mga0a205_83591_c1 3300050515 Bacteria 3083
341 Ga0587093_079506 3300059478 Bacteria 564
342 Ga0587066_018907 3300059490 Bacteria 1115
343 Ga0587070_036876 3300059491 Bacteria 917
344 Ga0587070_157382 3300059491 Bacteria 574
345 Ga0587073_0006662 3300059492 Bacteria 1790
346 Ga0587073_0053545 3300059492 Bacteria 923
347 Ga0587073_0115582 3300059492 Unclassified 717
348 Ga0587073_0211137 3300059492 Bacteria 588
349 Ga0587073_0320016 3300059492 Bacteria 511
350 Ga0587073_0328717 3300059492 Bacteria 506
351 Ga0587082_028739 3300059504 Bacteria 956
352 Ga0587082_059578 3300059504 Bacteria 750
353 Ga0587082_134910 3300059504 Bacteria 571
354 Ga0587083_0118064 3300059505 Bacteria 682
355 Ga0587083_0121128 3300059505 Bacteria 676
356 Ga0587083_0136431 3300059505 Bacteria 649
357 Ga0587083_0253355 3300059505 Bacteria 525
358 Ga0587083_0265852 3300059505 Bacteria 517
359 Ga0587088_004664 3300059508 Bacteria 1753
360 Ga0587088_044165 3300059508 Bacteria 850
361 Ga0587088_049902 3300059508 Unclassified 816
362 Ga0587089_055982 3300059509 Unclassified 643
363 Ga0587090_152834 3300059510 Bacteria 524
364 Ga0587091_050329 3300059511 Bacteria 853
365 Ga0587091_112789 3300059511 Bacteria 651
366 Ga0587091_146400 3300059511 Bacteria 596
367 Ga0587091_208497 3300059511 Bacteria 528
368 Ga0587094_116140 3300059513 Bacteria 531
369 Ga0587098_022920 3300059604 Bacteria 807
370 Ga0587098_031841 3300059604 Unclassified 729
371 Ga0587098_035477 3300059604 Bacteria 705
372 Ga0587106_006039 3300059605 Bacteria 1411
373 Ga0587106_030148 3300059605 Bacteria 866
374 Ga0587106_035617 3300059605 Bacteria 821
375 Ga0587099_003055 3300059622 Bacteria 1364
376 Ga0587101_138016 3300059623 Bacteria 518
377 Ga0587113_019437 3300059625 Bacteria 704
378 Ga0587115_028780 3300059626 Bacteria 815
379 Ga0587122_031625 3300059628 Bacteria 625
380 Ga0587128_001499 3300059630 Bacteria 2220
381 Ga0587128_009775 3300059630 Bacteria 1273
382 Ga0587128_041940 3300059630 Bacteria 804
383 Ga0587128_054480 3300059630 Bacteria 739
384 Ga0587128_092298 3300059630 Bacteria 623
385 Ga0587128_155506 3300059630 Bacteria 524
386 Ga0587128_173036 3300059630 Bacteria 505
387 Ga0587068_167296 3300059641 Bacteria 506
388 Ga0587075_003128 3300059644 Bacteria 1816
389 Ga0587075_078579 3300059644 Bacteria 626
390 Ga0587075_113457 3300059644 Unclassified 554
391 Ga0587079_008062 3300059647 Bacteria 1597
392 Ga0587107_007345 3300059652 Bacteria 1238
393 Ga0587107_033446 3300059652 Bacteria 795
394 Ga0587114_001505 3300059655 Bacteria 1971
395 Ga0587114_007751 3300059655 Bacteria 1240
396 Ga0587114_090492 3300059655 Bacteria 582
397 Ga0587120_018875 3300059659 Bacteria 644
398 Ga0587120_030396 3300059659 Bacteria 550
399 Ga0587111_0154370 3300060346 Bacteria 619
400 Ga0466962_0014414 3300061719 Bacteria 3809
401 Ga0466962_0196827 3300061719 Bacteria 984
402 Ga0466962_0234412 3300061719 Bacteria 900
403 Ga0530510_0014340 3300061734 Bacteria 5588

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_101582296 Ga0075434_1015822961 99
2 3300009094 Ga0111539_10920859 Ga0111539_109208592 99
3 3300005435 Ga0070714_100391112 Ga0070714_1003911122 100
4 3300005436 Ga0070713_100044639 Ga0070713_1000446396 100
5 3300005549 Ga0070704_101477459 Ga0070704_1014774592 100
6 3300006173 Ga0070716_100025827 Ga0070716_1000258275 100
7 3300006175 Ga0070712_100085807 Ga0070712_1000858074 100
8 3300020078 Ga0206352_10363894 Ga0206352_103638941 100
9 3300005937 Ga0081455_10000439 Ga0081455_1000043957 101
10 3300035171 Ga0373946_0514786 Ga0373946_0514786_87_464 101
11 3300044694 Ga0466963_0112021 Ga0466963_0112021_802_1164 101
12 3300045976 Ga0466967_0356959 Ga0466967_0356959_329_691 101
13 3300047321 Ga0495676_0132869 Ga0495676_0132869_744_1121 101
14 3300005458 Ga0070681_10054858 Ga0070681_100548582 102
15 3300020081 Ga0206354_11532108 Ga0206354_115321084 102
16 3300025905 Ga0207685_10055493 Ga0207685_100554932 102
17 3300025917 Ga0207660_10121921 Ga0207660_101219213 102
18 3300044719 Ga0466971_0012678 Ga0466971_0012678_2685_3044 103
19 3300044842 Ga0466957_0152975 Ga0466957_0152975_738_1097 103
20 3300006847 Ga0075431_100149394 Ga0075431_1001493943 104
21 3300005435 Ga0070714_100007122 Ga0070714_1000071226 105
22 3300005435 Ga0070714_100267841 Ga0070714_1002678412 105
23 3300005436 Ga0070713_100521897 Ga0070713_1005218971 105
24 3300005563 Ga0068855_100030742 Ga0068855_1000307423 105
25 3300005614 Ga0068856_101099122 Ga0068856_1010991222 105
26 3300009093 Ga0105240_11826324 Ga0105240_118263242 105
27 3300020081 Ga0206354_11049990 Ga0206354_110499903 105
28 3300025928 Ga0207700_11097208 Ga0207700_110972081 105
29 3300025929 Ga0207664_10246242 Ga0207664_102462422 105
30 3300025929 Ga0207664_11222310 Ga0207664_112223101 105
31 3300025929 Ga0207664_11601697 Ga0207664_116016972 105
32 3300025949 Ga0207667_10617335 Ga0207667_106173352 105
33 3300026078 Ga0207702_11032587 Ga0207702_110325872 105
34 3300026142 Ga0207698_10292313 Ga0207698_102923132 105
35 3300037466 Ga0395898_0069707 Ga0395898_0069707_1912_2283 105
36 3300044765 Ga0466970_0129654 Ga0466970_0129654_984_1343 105
37 3300045049 Ga0466959_0663338 Ga0466959_0663338_161_520 105
38 3300045836 Ga0466958_0022522 Ga0466958_0022522_213_572 105
39 3300050515 nmdc:mga0a205_393960_c1 nmdc:mga0a205_393960_c1_261_632 105
40 3300059505 Ga0587083_0265852 Ga0587083_0265852_34_399 105
41 3300059630 Ga0587128_155506 Ga0587128_155506_93_464 105
42 3300003308 Ga0006777J48905_1050010 Ga0006777J48905_10500103 106
43 3300003693 Ga0032354_1061107 Ga0032354_10611071 106
44 3300005329 Ga0070683_100013248 Ga0070683_1000132482 106
45 3300005336 Ga0070680_100037272 Ga0070680_1000372721 106
46 3300005338 Ga0068868_100082216 Ga0068868_1000822163 106
47 3300005340 Ga0070689_100269049 Ga0070689_1002690493 106
48 3300005354 Ga0070675_100357980 Ga0070675_1003579802 106
49 3300005364 Ga0070673_100236613 Ga0070673_1002366134 106
50 3300005365 Ga0070688_100106563 Ga0070688_1001065634 106
51 3300005440 Ga0070705_100434243 Ga0070705_1004342432 106
52 3300005444 Ga0070694_101113733 Ga0070694_1011137332 106
53 3300005458 Ga0070681_10078002 Ga0070681_100780022 106
54 3300005530 Ga0070679_100097748 Ga0070679_1000977484 106
55 3300005535 Ga0070684_100008348 Ga0070684_1000083484 106
56 3300005545 Ga0070695_100425850 Ga0070695_1004258501 106
57 3300005549 Ga0070704_100133928 Ga0070704_1001339282 106
58 3300005564 Ga0070664_100345649 Ga0070664_1003456491 106
59 3300005578 Ga0068854_100270080 Ga0068854_1002700802 106
60 3300005615 Ga0070702_100177119 Ga0070702_1001771192 106
61 3300005616 Ga0068852_102244390 Ga0068852_1022443902 106
62 3300005843 Ga0068860_102837488 Ga0068860_1028374881 106
63 3300005981 Ga0081538_10039202 Ga0081538_100392022 106
64 3300005985 Ga0081539_10000639 Ga0081539_1000063978 106
65 3300006173 Ga0070716_100262891 Ga0070716_1002628912 106
66 3300006175 Ga0070712_100024630 Ga0070712_1000246306 106
67 3300006847 Ga0075431_101821304 Ga0075431_1018213041 106
68 3300006852 Ga0075433_10059667 Ga0075433_100596674 106
69 3300006871 Ga0075434_100004184 Ga0075434_10000418412 106
70 3300006871 Ga0075434_100065387 Ga0075434_1000653876 106
71 3300007076 Ga0075435_100017592 Ga0075435_10001759211 106
72 3300007076 Ga0075435_100019323 Ga0075435_1000193237 106
73 3300009098 Ga0105245_10032247 Ga0105245_100322476 106
74 3300009147 Ga0114129_10155604 Ga0114129_101556041 106
75 3300009176 Ga0105242_11340622 Ga0105242_113406222 106
76 3300009177 Ga0105248_11918663 Ga0105248_119186632 106
77 3300009551 Ga0105238_11194328 Ga0105238_111943281 106
78 3300012481 Ga0157320_1012974 Ga0157320_10129742 106
79 3300013100 Ga0157373_11061243 Ga0157373_110612431 106
80 3300013100 Ga0157373_11251746 Ga0157373_112517462 106
81 3300013308 Ga0157375_10084048 Ga0157375_100840482 106
82 3300020069 Ga0197907_10446238 Ga0197907_104462383 106
83 3300020070 Ga0206356_11519433 Ga0206356_115194332 106
84 3300020070 Ga0206356_11900830 Ga0206356_119008302 106
85 3300020075 Ga0206349_1051630 Ga0206349_10516301 106
86 3300020077 Ga0206351_10307836 Ga0206351_103078363 106
87 3300020077 Ga0206351_10711578 Ga0206351_107115782 106
88 3300020077 Ga0206351_10778341 Ga0206351_107783412 106
89 3300020078 Ga0206352_10246285 Ga0206352_102462852 106
90 3300020078 Ga0206352_10314912 Ga0206352_103149122 106
91 3300020080 Ga0206350_10720888 Ga0206350_107208885 106
92 3300020081 Ga0206354_11532108 Ga0206354_115321082 106
93 3300020610 Ga0154015_1256524 Ga0154015_12565242 106
94 3300022467 Ga0224712_10011520 Ga0224712_100115203 106
95 3300022467 Ga0224712_10177697 Ga0224712_101776972 106
96 3300025912 Ga0207707_10224104 Ga0207707_102241042 106
97 3300025915 Ga0207693_10011917 Ga0207693_1001191714 106
98 3300025916 Ga0207663_10244598 Ga0207663_102445982 106
99 3300025917 Ga0207660_10129194 Ga0207660_101291943 106
100 3300025921 Ga0207652_10056417 Ga0207652_100564174 106
101 3300025926 Ga0207659_11206331 Ga0207659_112063312 106
102 3300025927 Ga0207687_10010410 Ga0207687_100104108 106
103 3300025932 Ga0207690_10585964 Ga0207690_105859642 106
104 3300025936 Ga0207670_10697092 Ga0207670_106970922 106
105 3300025942 Ga0207689_10928601 Ga0207689_109286012 106
106 3300025944 Ga0207661_10035579 Ga0207661_100355798 106
107 3300025945 Ga0207679_10604346 Ga0207679_106043462 106
108 3300025949 Ga0207667_11042745 Ga0207667_110427452 106
109 3300026023 Ga0207677_10708064 Ga0207677_107080642 106
110 3300026142 Ga0207698_11856035 Ga0207698_118560352 106
111 3300026142 Ga0207698_12174350 Ga0207698_121743502 106
112 3300028381 Ga0268264_10457227 Ga0268264_104572273 106
113 3300035170 Ga0373943_0002151 Ga0373943_0002151_3899_4261 106
114 3300035170 Ga0373943_0097697 Ga0373943_0097697_787_1152 106
115 3300035692 Ga0373935_0399154 Ga0373935_0399154_386_748 106
116 3300035695 Ga0373927_0475547 Ga0373927_0475547_222_587 106
117 3300035725 Ga0373947_0000346 Ga0373947_0000346_9325_9687 106
118 3300037068 Ga0373925_0058105 Ga0373925_0058105_1226_1588 106
119 3300044656 Ga0466969_0158713 Ga0466969_0158713_505_873 106
120 3300044658 Ga0466972_0255031 Ga0466972_0255031_252_620 106
121 3300044683 Ga0466965_0177189 Ga0466965_0177189_596_964 106
122 3300044684 Ga0466966_0032318 Ga0466966_0032318_2452_2823 106
123 3300044684 Ga0466966_0348425 Ga0466966_0348425_339_701 106
124 3300044693 Ga0466961_0093782 Ga0466961_0093782_1248_1619 106
125 3300044693 Ga0466961_0122946 Ga0466961_0122946_1110_1478 106
126 3300044693 Ga0466961_0288422 Ga0466961_0288422_306_668 106
127 3300044694 Ga0466963_0006083 Ga0466963_0006083_5842_6195 106
128 3300044694 Ga0466963_0007325 Ga0466963_0007325_2675_3046 106
129 3300044694 Ga0466963_0043890 Ga0466963_0043890_401_769 106
130 3300044694 Ga0466963_0138326 Ga0466963_0138326_319_672 106
131 3300044694 Ga0466963_0524917 Ga0466963_0524917_156_521 106
132 3300044694 Ga0466963_0631590 Ga0466963_0631590_247_609 106
133 3300044706 Ga0466964_0006796 Ga0466964_0006796_2460_2828 106
134 3300044706 Ga0466964_0012945 Ga0466964_0012945_1192_1539 106
135 3300044706 Ga0466964_0025241 Ga0466964_0025241_1451_1819 106
136 3300044735 Ga0466968_0144116 Ga0466968_0144116_177_539 106
137 3300044735 Ga0466968_0265412 Ga0466968_0265412_123_491 106
138 3300044735 Ga0466968_0351942 Ga0466968_0351942_52_420 106
139 3300044735 Ga0466968_0503630 Ga0466968_0503630_29_400 106
140 3300044765 Ga0466970_0315253 Ga0466970_0315253_276_647 106
141 3300044842 Ga0466957_0087813 Ga0466957_0087813_407_775 106
142 3300044842 Ga0466957_0113141 Ga0466957_0113141_520_882 106
143 3300044842 Ga0466957_0329861 Ga0466957_0329861_269_622 106
144 3300044842 Ga0466957_1272098 Ga0466957_1272098_144_515 106
145 3300045049 Ga0466959_0084343 Ga0466959_0084343_1712_2083 106
146 3300045049 Ga0466959_0132483 Ga0466959_0132483_379_747 106
147 3300045049 Ga0466959_0249954 Ga0466959_0249954_19_387 106
148 3300045049 Ga0466959_0892367 Ga0466959_0892367_212_580 106
149 3300045836 Ga0466958_0008181 Ga0466958_0008181_3501_3872 106
150 3300045836 Ga0466958_0685121 Ga0466958_0685121_132_485 106
151 3300045836 Ga0466958_0815698 Ga0466958_0815698_198_560 106
152 3300045836 Ga0466958_1054617 Ga0466958_1054617_70_438 106
153 3300045976 Ga0466967_0000171 Ga0466967_0000171_24162_24524 106
154 3300045976 Ga0466967_0000375 Ga0466967_0000375_18400_18768 106
155 3300045976 Ga0466967_0004160 Ga0466967_0004160_6847_7194 106
156 3300045976 Ga0466967_0014944 Ga0466967_0014944_2440_2793 106
157 3300045976 Ga0466967_0128891 Ga0466967_0128891_53_424 106
158 3300045976 Ga0466967_0142548 Ga0466967_0142548_1046_1417 106
159 3300045976 Ga0466967_0379403 Ga0466967_0379403_676_1038 106
160 3300045976 Ga0466967_0394170 Ga0466967_0394170_704_1147 106
161 3300045976 Ga0466967_0395216 Ga0466967_0395216_594_962 106
162 3300045976 Ga0466967_0482590 Ga0466967_0482590_725_1087 106
163 3300046459 Ga0495629_0557354 Ga0495629_0557354_233_595 106
164 3300046517 Ga0495630_0179708 Ga0495630_0179708_122_487 106
165 3300046523 Ga0495644_0263840 Ga0495644_0263840_305_655 106
166 3300046538 Ga0495609_0400544 Ga0495609_0400544_188_538 106
167 3300046684 Ga0495669_0326894 Ga0495669_0326894_73_423 106
168 3300047321 Ga0495676_0344717 Ga0495676_0344717_553_918 106
169 3300047447 Ga0495685_286888 Ga0495685_286888_149_499 106
170 3300048089 Ga0495614_0286054 Ga0495614_0286054_265_627 106
171 3300048903 Ga0496100_0054464 Ga0496100_0054464_1362_1733 106
172 3300048903 Ga0496100_0099747 Ga0496100_0099747_988_1344 106
173 3300048903 Ga0496100_1300191 Ga0496100_1300191_141_500 106
174 3300048904 Ga0496101_0557474 Ga0496101_0557474_14_373 106
175 3300048905 Ga0496102_0237994 Ga0496102_0237994_913_1269 106
176 3300048905 Ga0496102_0445561 Ga0496102_0445561_481_837 106
177 3300048906 Ga0496103_0199018 Ga0496103_0199018_446_802 106
178 3300048909 Ga0496106_0269025 Ga0496106_0269025_918_1289 106
179 3300048910 Ga0496107_0002867 Ga0496107_0002867_10249_10620 106
180 3300048910 Ga0496107_0705691 Ga0496107_0705691_226_582 106
181 3300048910 Ga0496107_0762216 Ga0496107_0762216_229_585 106
182 3300048911 Ga0496108_0009437 Ga0496108_0009437_4951_5307 106
183 3300048911 Ga0496108_0068335 Ga0496108_0068335_1912_2271 106
184 3300048912 Ga0496109_0009340 Ga0496109_0009340_1782_2138 106
185 3300048912 Ga0496109_0276185 Ga0496109_0276185_1144_1503 106
186 3300048912 Ga0496109_1361635 Ga0496109_1361635_80_439 106
187 3300048913 Ga0496110_0009591 Ga0496110_0009591_1465_1821 106
188 3300048913 Ga0496110_0063921 Ga0496110_0063921_1934_2293 106
189 3300048914 Ga0496111_0064006 Ga0496111_0064006_1438_1794 106
190 3300048914 Ga0496111_0135302 Ga0496111_0135302_642_1016 106
191 3300048914 Ga0496111_0211495 Ga0496111_0211495_121_480 106
192 3300048915 Ga0496112_0144318 Ga0496112_0144318_1419_1778 106
193 3300048915 Ga0496112_0149433 Ga0496112_0149433_461_817 106
194 3300048915 Ga0496112_0176293 Ga0496112_0176293_933_1292 106
195 3300048917 Ga0496114_0367109 Ga0496114_0367109_593_949 106
196 3300048917 Ga0496114_1227851 Ga0496114_1227851_98_457 106
197 3300050507 nmdc:mga05p37_124293_c1 nmdc:mga05p37_124293_c1_82_450 106
198 3300050512 nmdc:mga0n895_15207_c1 nmdc:mga0n895_15207_c1_4195_4566 106
199 3300050512 nmdc:mga0n895_32988_c1 nmdc:mga0n895_32988_c1_2077_2445 106
200 3300050513 nmdc:mga0rr50_11427_c1 nmdc:mga0rr50_11427_c1_5045_5413 106
201 3300050513 nmdc:mga0rr50_243999_c1 nmdc:mga0rr50_243999_c1_117_488 106
202 3300050514 nmdc:mga08x19_660251_c1 nmdc:mga08x19_660251_c1_68_436 106
203 3300050515 nmdc:mga0a205_38152_c2 nmdc:mga0a205_38152_c2_1410_1781 106
204 3300050515 nmdc:mga0a205_83591_c1 nmdc:mga0a205_83591_c1_940_1308 106
205 3300059478 Ga0587093_079506 Ga0587093_079506_74_445 106
206 3300059491 Ga0587070_157382 Ga0587070_157382_196_558 106
207 3300059492 Ga0587073_0115582 Ga0587073_0115582_233_595 106
208 3300059492 Ga0587073_0211137 Ga0587073_0211137_111_476 106
209 3300059492 Ga0587073_0320016 Ga0587073_0320016_18_380 106
210 3300059492 Ga0587073_0328717 Ga0587073_0328717_104_478 106
211 3300059504 Ga0587082_028739 Ga0587082_028739_587_937 106
212 3300059504 Ga0587082_134910 Ga0587082_134910_176_535 106
213 3300059505 Ga0587083_0121128 Ga0587083_0121128_152_517 106
214 3300059508 Ga0587088_044165 Ga0587088_044165_18_368 106
215 3300059508 Ga0587088_049902 Ga0587088_049902_324_686 106
216 3300059509 Ga0587089_055982 Ga0587089_055982_166_528 106
217 3300059511 Ga0587091_050329 Ga0587091_050329_168_530 106
218 3300059511 Ga0587091_146400 Ga0587091_146400_104_472 106
219 3300059511 Ga0587091_208497 Ga0587091_208497_37_408 106
220 3300059604 Ga0587098_031841 Ga0587098_031841_168_530 106
221 3300059605 Ga0587106_030148 Ga0587106_030148_181_543 106
222 3300059623 Ga0587101_138016 Ga0587101_138016_18_380 106
223 3300059630 Ga0587128_041940 Ga0587128_041940_321_683 106
224 3300059630 Ga0587128_054480 Ga0587128_054480_304_663 106
225 3300059630 Ga0587128_173036 Ga0587128_173036_89_448 106
226 3300059644 Ga0587075_078579 Ga0587075_078579_124_489 106
227 3300059644 Ga0587075_113457 Ga0587075_113457_116_478 106
228 3300059652 Ga0587107_033446 Ga0587107_033446_309_671 106
229 3300059655 Ga0587114_090492 Ga0587114_090492_152_511 106
230 3300061719 Ga0466962_0234412 Ga0466962_0234412_128_496 106
231 3300005535 Ga0070684_100586668 Ga0070684_1005866682 107
232 3300005549 Ga0070704_100438565 Ga0070704_1004385653 107
233 3300048916 Ga0496113_0187354 Ga0496113_0187354_382_831 107
234 3300044694 Ga0466963_0408105 Ga0466963_0408105_64_492 109
235 3300013296 Ga0157374_12932708 Ga0157374_129327081 110
236 3300013307 Ga0157372_12624811 Ga0157372_126248111 111
237 3300013308 Ga0157375_11631780 Ga0157375_116317802 112
238 3300048913 Ga0496110_0511149 Ga0496110_0511149_135_596 112
239 3300044694 Ga0466963_0014533 Ga0466963_0014533_1391_1834 113
240 3300045049 Ga0466959_0360229 Ga0466959_0360229_328_771 113
241 3300061719 Ga0466962_0014414 Ga0466962_0014414_1429_1872 113
242 3300005614 Ga0068856_100761943 Ga0068856_1007619432 114
243 3300041486 Ga0451807_0309764 Ga0451807_0309764_122_592 114
244 3300046689 Ga0495613_0512240 Ga0495613_0512240_103_567 114
245 3300048903 Ga0496100_0581912 Ga0496100_0581912_256_714 114
246 3300048908 Ga0496105_0325173 Ga0496105_0325173_323_781 114
247 3300048911 Ga0496108_0806116 Ga0496108_0806116_209_667 114
248 3300048914 Ga0496111_0439035 Ga0496111_0439035_476_934 114
249 3300044719 Ga0466971_0429940 Ga0466971_0429940_85_528 115
250 3300045976 Ga0466967_0004160 Ga0466967_0004160_7439_7876 115
251 3300045976 Ga0466967_0426863 Ga0466967_0426863_403_840 115
252 3300059659 Ga0587120_018875 Ga0587120_018875_117_554 115
253 3300020082 Ga0206353_10262973 Ga0206353_102629732 116
254 3300041459 Ga0451800_0434479 Ga0451800_0434479_1009_1449 116
255 3300041512 Ga0451853_0269936 Ga0451853_0269936_2852_3292 116
256 3300044656 Ga0466969_0228102 Ga0466969_0228102_265_702 116
257 3300044683 Ga0466965_0194585 Ga0466965_0194585_236_676 116
258 3300044693 Ga0466961_0093782 Ga0466961_0093782_361_801 116
259 3300044706 Ga0466964_0006796 Ga0466964_0006796_1611_2054 116
260 3300044765 Ga0466970_0261168 Ga0466970_0261168_190_630 116
261 3300044842 Ga0466957_0087813 Ga0466957_0087813_1188_1622 116
262 3300044842 Ga0466957_0252412 Ga0466957_0252412_432_872 116
263 3300045049 Ga0466959_0087125 Ga0466959_0087125_1547_1987 116
264 3300045049 Ga0466959_0125700 Ga0466959_0125700_486_926 116
265 3300045049 Ga0466959_0132483 Ga0466959_0132483_1170_1607 116
266 3300045049 Ga0466959_0421408 Ga0466959_0421408_398_832 116
267 3300045836 Ga0466958_0008181 Ga0466958_0008181_4319_4759 116
268 3300045836 Ga0466958_0343533 Ga0466958_0343533_75_512 116
269 3300045836 Ga0466958_0477649 Ga0466958_0477649_310_744 116
270 3300045976 Ga0466967_0000375 Ga0466967_0000375_17551_17994 116
271 3300045976 Ga0466967_0035158 Ga0466967_0035158_1245_1688 116
272 3300059505 Ga0587083_0136431 Ga0587083_0136431_42_482 116
273 3300059510 Ga0587090_152834 Ga0587090_152834_40_480 116
274 3300059511 Ga0587091_112789 Ga0587091_112789_30_467 116
275 3300059513 Ga0587094_116140 Ga0587094_116140_43_483 116
276 3300059630 Ga0587128_092298 Ga0587128_092298_154_591 116
277 3300061719 Ga0466962_0196827 Ga0466962_0196827_93_533 116
278 3300005328 Ga0070676_11267891 Ga0070676_112678911 117
279 3300005339 Ga0070660_100431515 Ga0070660_1004315152 117
280 3300005366 Ga0070659_100695259 Ga0070659_1006952591 117
281 3300005457 Ga0070662_100109088 Ga0070662_1001090882 117
282 3300005458 Ga0070681_10873112 Ga0070681_108731122 117
283 3300005530 Ga0070679_100775457 Ga0070679_1007754572 117
284 3300006871 Ga0075434_100478012 Ga0075434_1004780121 117
285 3300009094 Ga0111539_10083013 Ga0111539_100830134 117
286 3300013307 Ga0157372_11032215 Ga0157372_110322152 117
287 3300020075 Ga0206349_1465640 Ga0206349_14656401 117
288 3300020078 Ga0206352_10741160 Ga0206352_107411602 117
289 3300022467 Ga0224712_10041961 Ga0224712_100419613 117
290 3300027907 Ga0207428_10125898 Ga0207428_101258983 117
291 3300038443 Ga0395901_0559754 Ga0395901_0559754_108_560 117
292 3300044694 Ga0466963_0007325 Ga0466963_0007325_1821_2270 117
293 3300045976 Ga0466967_1144896 Ga0466967_1144896_221_676 117
294 3300050512 nmdc:mga0n895_231498_c1 nmdc:mga0n895_231498_c1_768_1226 117
295 3300003735 Ga0006780_1037103 Ga0006780_10371031 118
296 3300005336 Ga0070680_100098894 Ga0070680_1000988945 118
297 3300005339 Ga0070660_100423126 Ga0070660_1004231262 118
298 3300005435 Ga0070714_100322902 Ga0070714_1003229022 118
299 3300005436 Ga0070713_100146633 Ga0070713_1001466333 118
300 3300005441 Ga0070700_100453022 Ga0070700_1004530222 118
301 3300005444 Ga0070694_101118509 Ga0070694_1011185091 118
302 3300005458 Ga0070681_10078002 Ga0070681_100780024 118
303 3300005530 Ga0070679_100097748 Ga0070679_1000977482 118
304 3300005535 Ga0070684_100933041 Ga0070684_1009330412 118
305 3300005547 Ga0070693_101084432 Ga0070693_1010844321 118
306 3300006028 Ga0070717_10013228 Ga0070717_100132282 118
307 3300006058 Ga0075432_10114527 Ga0075432_101145273 118
308 3300006163 Ga0070715_10079742 Ga0070715_100797421 118
309 3300006175 Ga0070712_100024630 Ga0070712_1000246307 118
310 3300006847 Ga0075431_101726708 Ga0075431_1017267081 118
311 3300006852 Ga0075433_10412348 Ga0075433_104123482 118
312 3300006871 Ga0075434_100107907 Ga0075434_1001079076 118
313 3300006914 Ga0075436_100159753 Ga0075436_1001597533 118
314 3300007076 Ga0075435_100124026 Ga0075435_1001240263 118
315 3300009174 Ga0105241_11317856 Ga0105241_113178562 118
316 3300009176 Ga0105242_12431520 Ga0105242_124315201 118
317 3300013306 Ga0163162_11200548 Ga0163162_112005482 118
318 3300020070 Ga0206356_11900830 Ga0206356_119008304 118
319 3300020077 Ga0206351_10711578 Ga0206351_107115784 118
320 3300020077 Ga0206351_10852558 Ga0206351_108525582 118
321 3300020080 Ga0206350_10851596 Ga0206350_108515963 118
322 3300020082 Ga0206353_10833568 Ga0206353_108335682 118
323 3300025906 Ga0207699_10128097 Ga0207699_101280972 118
324 3300025912 Ga0207707_10474123 Ga0207707_104741232 118
325 3300025912 Ga0207707_10739925 Ga0207707_107399251 118
326 3300025915 Ga0207693_10011917 Ga0207693_1001191713 118
327 3300025919 Ga0207657_10138575 Ga0207657_101385752 118
328 3300025919 Ga0207657_10371354 Ga0207657_103713543 118
329 3300025921 Ga0207652_10056417 Ga0207652_100564176 118
330 3300025928 Ga0207700_10000004 Ga0207700_10000004439 118
331 3300025931 Ga0207644_11528269 Ga0207644_115282691 118
332 3300025933 Ga0207706_10032689 Ga0207706_100326898 118
333 3300025949 Ga0207667_10739655 Ga0207667_107396551 118
334 3300026023 Ga0207677_10918886 Ga0207677_109188862 118
335 3300026075 Ga0207708_10507867 Ga0207708_105078672 118
336 3300026121 Ga0207683_10212593 Ga0207683_102125933 118
337 3300027907 Ga0207428_10128386 Ga0207428_101283862 118
338 3300031995 Ga0307409_100443182 Ga0307409_1004431822 118
339 3300032126 Ga0307415_101592094 Ga0307415_1015920941 118
340 3300035170 Ga0373943_0416258 Ga0373943_0416258_266_718 118
341 3300035692 Ga0373935_0052060 Ga0373935_0052060_172_624 118
342 3300035725 Ga0373947_0000346 Ga0373947_0000346_8418_8867 118
343 3300035725 Ga0373947_0007374 Ga0373947_0007374_4025_4477 118
344 3300035725 Ga0373947_0951058 Ga0373947_0951058_59_511 118
345 3300037068 Ga0373925_0011633 Ga0373925_0011633_4553_5005 118
346 3300037068 Ga0373925_0058105 Ga0373925_0058105_2046_2495 118
347 3300037418 Ga0395900_1005380 Ga0395900_1005380_96_542 118
348 3300044684 Ga0466966_0009409 Ga0466966_0009409_4175_4630 118
349 3300044693 Ga0466961_0019049 Ga0466961_0019049_3491_3946 118
350 3300044694 Ga0466963_0006311 Ga0466963_0006311_5239_5694 118
351 3300044706 Ga0466964_0189522 Ga0466964_0189522_461_913 118
352 3300044842 Ga0466957_0719819 Ga0466957_0719819_107_562 118
353 3300045049 Ga0466959_0009724 Ga0466959_0009724_1258_1713 118
354 3300045836 Ga0466958_0006541 Ga0466958_0006541_649_1104 118
355 3300045976 Ga0466967_0068703 Ga0466967_0068703_1423_1878 118
356 3300046455 Ga0495603_0003391 Ga0495603_0003391_4585_5037 118
357 3300046461 Ga0495641_0005424 Ga0495641_0005424_4261_4713 118
358 3300046472 Ga0495580_0228694 Ga0495580_0228694_694_1146 118
359 3300046473 Ga0495582_0277069 Ga0495582_0277069_405_854 118
360 3300046475 Ga0495639_0336606 Ga0495639_0336606_18_470 118
361 3300046475 Ga0495639_0346700 Ga0495639_0346700_267_722 118
362 3300046499 Ga0495594_0006399 Ga0495594_0006399_3960_4412 118
363 3300046517 Ga0495630_0179708 Ga0495630_0179708_882_1340 118
364 3300046543 Ga0495645_0016609 Ga0495645_0016609_4138_4584 118
365 3300046559 Ga0495667_0998933 Ga0495667_0998933_37_483 118
366 3300046674 Ga0495588_0000814 Ga0495588_0000814_8786_9238 118
367 3300046675 Ga0495657_0041592 Ga0495657_0041592_2588_3034 118
368 3300046683 Ga0495658_0157593 Ga0495658_0157593_313_762 118
369 3300046689 Ga0495613_0249258 Ga0495613_0249258_406_855 118
370 3300046690 Ga0495624_0093366 Ga0495624_0093366_548_997 118
371 3300047315 Ga0495581_0520907 Ga0495581_0520907_13_465 118
372 3300047321 Ga0495676_0011685 Ga0495676_0011685_3671_4123 118
373 3300047322 Ga0495680_0056916 Ga0495680_0056916_2153_2599 118
374 3300048903 Ga0496100_0099747 Ga0496100_0099747_533_982 118
375 3300048903 Ga0496100_0771179 Ga0496100_0771179_92_544 118
376 3300048907 Ga0496104_0274664 Ga0496104_0274664_1069_1518 118
377 3300048908 Ga0496105_0071579 Ga0496105_0071579_1197_1646 118
378 3300048908 Ga0496105_0281028 Ga0496105_0281028_298_753 118
379 3300048909 Ga0496106_0269025 Ga0496106_0269025_23_469 118
380 3300048911 Ga0496108_0207361 Ga0496108_0207361_1196_1645 118
381 3300048912 Ga0496109_0260045 Ga0496109_0260045_652_1104 118
382 3300048913 Ga0496110_0617318 Ga0496110_0617318_112_564 118
383 3300048916 Ga0496113_0890014 Ga0496113_0890014_109_561 118
384 3300048917 Ga0496114_0294461 Ga0496114_0294461_506_961 118
385 3300048918 Ga0496115_0074064 Ga0496115_0074064_870_1325 118
386 3300048918 Ga0496115_0087590 Ga0496115_0087590_1001_1450 118
387 3300049583 Ga0501067_0001043 Ga0501067_0001043_5726_6178 118
388 3300049585 Ga0501069_0009597 Ga0501069_0009597_3381_3833 118
389 3300050512 nmdc:mga0n895_12063_c1 nmdc:mga0n895_12063_c1_905_1360 118
390 3300050513 nmdc:mga0rr50_294013_c1 nmdc:mga0rr50_294013_c1_113_568 118
391 3300050513 nmdc:mga0rr50_88667_c1 nmdc:mga0rr50_88667_c1_1391_1843 118
392 3300050515 nmdc:mga0a205_415462_c1 nmdc:mga0a205_415462_c1_509_958 118
393 3300050515 nmdc:mga0a205_4711_c1 nmdc:mga0a205_4711_c1_6398_6853 118
394 3300059490 Ga0587066_018907 Ga0587066_018907_347_802 118
395 3300059491 Ga0587070_036876 Ga0587070_036876_229_684 118
396 3300059492 Ga0587073_0006662 Ga0587073_0006662_1232_1687 118
397 3300059492 Ga0587073_0053545 Ga0587073_0053545_447_902 118
398 3300059504 Ga0587082_059578 Ga0587082_059578_143_598 118
399 3300059505 Ga0587083_0118064 Ga0587083_0118064_194_649 118
400 3300059505 Ga0587083_0253355 Ga0587083_0253355_27_464 118
401 3300059508 Ga0587088_004664 Ga0587088_004664_1225_1680 118
402 3300059604 Ga0587098_022920 Ga0587098_022920_26_463 118
403 3300059604 Ga0587098_035477 Ga0587098_035477_76_531 118
404 3300059605 Ga0587106_006039 Ga0587106_006039_876_1331 118
405 3300059605 Ga0587106_035617 Ga0587106_035617_195_632 118
406 3300059622 Ga0587099_003055 Ga0587099_003055_754_1209 118
407 3300059625 Ga0587113_019437 Ga0587113_019437_174_629 118
408 3300059626 Ga0587115_028780 Ga0587115_028780_123_578 118
409 3300059628 Ga0587122_031625 Ga0587122_031625_67_522 118
410 3300059630 Ga0587128_001499 Ga0587128_001499_1439_1894 118
411 3300059630 Ga0587128_009775 Ga0587128_009775_497_934 118
412 3300059641 Ga0587068_167296 Ga0587068_167296_25_480 118
413 3300059644 Ga0587075_003128 Ga0587075_003128_1265_1720 118
414 3300059647 Ga0587079_008062 Ga0587079_008062_946_1401 118
415 3300059652 Ga0587107_007345 Ga0587107_007345_671_1126 118
416 3300059655 Ga0587114_001505 Ga0587114_001505_1438_1893 118
417 3300059655 Ga0587114_007751 Ga0587114_007751_564_1025 118
418 3300059659 Ga0587120_030396 Ga0587120_030396_76_534 118
419 3300061734 Ga0530510_0014340 Ga0530510_0014340_2207_2659 118
420 3300005436 Ga0070713_100044639 Ga0070713_1000446394 119
421 3300006173 Ga0070716_100025827 Ga0070716_1000258277 119
422 3300003203 JGI25406J46586_10081936 JGI25406J46586_100819361 120
423 3300005434 Ga0070709_10322255 Ga0070709_103222552 120
424 3300005985 Ga0081539_10000639 Ga0081539_1000063980 120
425 3300025906 Ga0207699_10025262 Ga0207699_100252627 120
426 3300025915 Ga0207693_10042937 Ga0207693_100429372 120
427 3300060346 Ga0587111_0154370 Ga0587111_0154370_156_518 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00741

Gas_vesicle

Gas vesicle protein

17

55

0.99

Feature Viewer

pLDDT pTM Quality
60.47 0.29 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map