F441433

General Info

Members Datasets Scaffolds Average Seq Length
427 200 403 122

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10920859|Ga0111539_109208592
Length 118
Sequence MTVAGQSTYLDRPSPSSLADVIDTILDKGLVIDIYVRVSLLGIELVTVDARIVVASVDTYLRFAEAVNRLDLTETQTGGIPELMEGLAESDQEGKGRGAIEAASEKVSEFLGDKRAKS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.39
Metatranscriptomes 20.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.01
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10081936 3300003203 Bacteria 988
2 Ga0006777J48905_1050010 3300003308 Bacteria 1175
3 Ga0032354_1061107 3300003693 Bacteria 919
4 Ga0006780_1037103 3300003735 Bacteria 805
5 Ga0070676_11267891 3300005328 Bacteria 562
6 Ga0070683_100013248 3300005329 Bacteria 7187
7 Ga0070680_100037272 3300005336 Bacteria 3928
8 Ga0070680_100098894 3300005336 Bacteria 2420
9 Ga0068868_100082216 3300005338 Bacteria 2583
10 Ga0070660_100423126 3300005339 Bacteria 1103
11 Ga0070660_100431515 3300005339 Bacteria 1092
12 Ga0070689_100269049 3300005340 Bacteria 1410
13 Ga0070675_100357980 3300005354 Bacteria 1295
14 Ga0070673_100236613 3300005364 Bacteria 1586
15 Ga0070688_100106563 3300005365 Bacteria 1857
16 Ga0070659_100695259 3300005366 Bacteria 879
17 Ga0070709_10322255 3300005434 Bacteria 1134
18 Ga0070714_100007122 3300005435 Bacteria 8676
19 Ga0070714_100267841 3300005435 Bacteria 1583
20 Ga0070714_100322902 3300005435 Bacteria 1444
21 Ga0070714_100391112 3300005435 Bacteria 1312
22 Ga0070713_100044639 3300005436 Bacteria 3629
23 Ga0070713_100146633 3300005436 Bacteria 2096
24 Ga0070713_100521897 3300005436 Bacteria 1122
25 Ga0070705_100434243 3300005440 Bacteria 981
26 Ga0070700_100453022 3300005441 Bacteria 977
27 Ga0070694_101113733 3300005444 Bacteria 659
28 Ga0070694_101118509 3300005444 Bacteria 658
29 Ga0070662_100109088 3300005457 Bacteria 2106
30 Ga0070681_10054858 3300005458 Bacteria 3971
31 Ga0070681_10078002 3300005458 Bacteria 3269
32 Ga0070681_10873112 3300005458 Bacteria 818
33 Ga0070679_100097748 3300005530 Bacteria 2923
34 Ga0070679_100775457 3300005530 Bacteria 902
35 Ga0070684_100008348 3300005535 Bacteria 8089
36 Ga0070684_100586668 3300005535 Bacteria 1036
37 Ga0070684_100933041 3300005535 Bacteria 814
38 Ga0070695_100425850 3300005545 Bacteria 1012
39 Ga0070693_101084432 3300005547 Bacteria 610
40 Ga0070704_100133928 3300005549 Bacteria 1925
41 Ga0070704_100438565 3300005549 Bacteria 1122
42 Ga0070704_101477459 3300005549 Bacteria 625
43 Ga0068855_100030742 3300005563 Bacteria 6420
44 Ga0070664_100345649 3300005564 Bacteria 1352
45 Ga0068854_100270080 3300005578 Unclassified 1365
46 Ga0068856_100761943 3300005614 Bacteria 988
47 Ga0068856_101099122 3300005614 Bacteria 812
48 Ga0070702_100177119 3300005615 Bacteria 1392
49 Ga0068852_102244390 3300005616 Bacteria 567
50 Ga0068860_102837488 3300005843 Bacteria 502
51 Ga0081455_10000439 3300005937 Bacteria 54636
52 Ga0081538_10039202 3300005981 Bacteria 3042
53 Ga0081539_10000639 3300005985 Bacteria 70847
54 Ga0070717_10013228 3300006028 Bacteria 6315
55 Ga0075432_10114527 3300006058 Bacteria 1008
56 Ga0070715_10079742 3300006163 Bacteria 1483
57 Ga0070716_100025827 3300006173 Bacteria 3139
58 Ga0070716_100262891 3300006173 Bacteria 1182
59 Ga0070712_100024630 3300006175 Bacteria 3990
60 Ga0070712_100085807 3300006175 Bacteria 2293
61 Ga0075431_100149394 3300006847 Bacteria 2406
62 Ga0075431_101726708 3300006847 Bacteria 583
63 Ga0075431_101821304 3300006847 Bacteria 565
64 Ga0075433_10059667 3300006852 Bacteria 3338
65 Ga0075433_10412348 3300006852 Bacteria 1191
66 Ga0075434_100004184 3300006871 Bacteria 12929
67 Ga0075434_100065387 3300006871 Bacteria 3622
68 Ga0075434_100107907 3300006871 Bacteria 2795
69 Ga0075434_100478012 3300006871 Bacteria 1267
70 Ga0075434_101582296 3300006871 Unclassified 664
71 Ga0075436_100159753 3300006914 Bacteria 1588
72 Ga0075435_100017592 3300007076 Bacteria 5415
73 Ga0075435_100019323 3300007076 Bacteria 5201
74 Ga0075435_100124026 3300007076 Bacteria 2157
75 Ga0105240_11826324 3300009093 Bacteria 633
76 Ga0111539_10083013 3300009094 Bacteria 3768
77 Ga0111539_10920859 3300009094 Bacteria 1016
78 Ga0105245_10032247 3300009098 Bacteria 4639
79 Ga0114129_10155604 3300009147 Bacteria 3126
80 Ga0105241_11317856 3300009174 Bacteria 688
81 Ga0105242_11340622 3300009176 Bacteria 741
82 Ga0105242_12431520 3300009176 Bacteria 571
83 Ga0105248_11918663 3300009177 Bacteria 672
84 Ga0105238_11194328 3300009551 Bacteria 785
85 Ga0157320_1012974 3300012481 Bacteria 676
86 Ga0157373_11061243 3300013100 Bacteria 606
87 Ga0157373_11251746 3300013100 Bacteria 560
88 Ga0157374_12932708 3300013296 Bacteria 504
89 Ga0163162_11200548 3300013306 Bacteria 861
90 Ga0157372_11032215 3300013307 Bacteria 952
91 Ga0157372_12624811 3300013307 Bacteria 578
92 Ga0157375_10084048 3300013308 Bacteria 3230
93 Ga0157375_11631780 3300013308 Bacteria 763
94 Ga0197907_10446238 3300020069 Bacteria 1240
95 Ga0206356_11519433 3300020070 Bacteria 751
96 Ga0206356_11900830 3300020070 Bacteria 1831
97 Ga0206349_1051630 3300020075 Bacteria 613
98 Ga0206349_1465640 3300020075 Bacteria 598
99 Ga0206351_10307836 3300020077 Bacteria 2768
100 Ga0206351_10711578 3300020077 Bacteria 2459
101 Ga0206351_10778341 3300020077 Bacteria 831
102 Ga0206351_10852558 3300020077 Bacteria 1063
103 Ga0206352_10246285 3300020078 Bacteria 833
104 Ga0206352_10314912 3300020078 Unclassified 960
105 Ga0206352_10363894 3300020078 Bacteria 538
106 Ga0206352_10741160 3300020078 Bacteria 1531
107 Ga0206350_10720888 3300020080 Bacteria 2959
108 Ga0206350_10851596 3300020080 Bacteria 1973
109 Ga0206354_11049990 3300020081 Bacteria 1172
110 Ga0206354_11532108 3300020081 Bacteria 1446
111 Ga0206353_10262973 3300020082 Bacteria 1126
112 Ga0206353_10833568 3300020082 Bacteria 795
113 Ga0154015_1256524 3300020610 Bacteria 725
114 Ga0224712_10011520 3300022467 Bacteria 2749
115 Ga0224712_10041961 3300022467 Bacteria 1731
116 Ga0224712_10177697 3300022467 Unclassified 957
117 Ga0207685_10055493 3300025905 Bacteria 1547
118 Ga0207699_10025262 3300025906 Bacteria 3259
119 Ga0207699_10128097 3300025906 Bacteria 1652
120 Ga0207707_10224104 3300025912 Unclassified 1636
121 Ga0207707_10474123 3300025912 Bacteria 1069
122 Ga0207707_10739925 3300025912 Bacteria 823
123 Ga0207693_10011917 3300025915 Bacteria 7027
124 Ga0207693_10042937 3300025915 Bacteria 3559
125 Ga0207663_10244598 3300025916 Bacteria 1317
126 Ga0207660_10121921 3300025917 Bacteria 1975
127 Ga0207660_10129194 3300025917 Bacteria 1921
128 Ga0207657_10138575 3300025919 Bacteria 1989
129 Ga0207657_10371354 3300025919 Bacteria 1127
130 Ga0207652_10056417 3300025921 Bacteria 3381
131 Ga0207659_11206331 3300025926 Bacteria 650
132 Ga0207687_10010410 3300025927 Bacteria 6077
133 Ga0207700_10000004 3300025928 Bacteria 443409
134 Ga0207700_11097208 3300025928 Bacteria 711
135 Ga0207664_10246242 3300025929 Bacteria 1558
136 Ga0207664_11222310 3300025929 Bacteria 670
137 Ga0207664_11601697 3300025929 Bacteria 573
138 Ga0207644_11528269 3300025931 Bacteria 560
139 Ga0207690_10585964 3300025932 Bacteria 909
140 Ga0207706_10032689 3300025933 Bacteria 4631
141 Ga0207670_10697092 3300025936 Bacteria 840
142 Ga0207689_10928601 3300025942 Bacteria 734
143 Ga0207661_10035579 3300025944 Bacteria 3882
144 Ga0207679_10604346 3300025945 Bacteria 989
145 Ga0207667_10617335 3300025949 Bacteria 1092
146 Ga0207667_10739655 3300025949 Bacteria 984
147 Ga0207667_11042745 3300025949 Bacteria 803
148 Ga0207677_10708064 3300026023 Unclassified 894
149 Ga0207677_10918886 3300026023 Bacteria 790
150 Ga0207708_10507867 3300026075 Bacteria 1011
151 Ga0207702_11032587 3300026078 Bacteria 816
152 Ga0207683_10212593 3300026121 Bacteria 1761
153 Ga0207698_10292313 3300026142 Bacteria 1513
154 Ga0207698_11856035 3300026142 Bacteria 618
155 Ga0207698_12174350 3300026142 Bacteria 568
156 Ga0207428_10125898 3300027907 Bacteria 1962
157 Ga0207428_10128386 3300027907 Bacteria 1941
158 Ga0268264_10457227 3300028381 Bacteria 1238
159 Ga0307409_100443182 3300031995 Bacteria 1252
160 Ga0307415_101592094 3300032126 Bacteria 627
161 Ga0373943_0002151 3300035170 Bacteria 8959
162 Ga0373943_0097697 3300035170 Bacteria 1531
163 Ga0373943_0416258 3300035170 Bacteria 777
164 Ga0373946_0514786 3300035171 Bacteria 615
165 Ga0373935_0052060 3300035692 Bacteria 2602
166 Ga0373935_0399154 3300035692 Bacteria 987
167 Ga0373927_0475547 3300035695 Bacteria 826
168 Ga0373947_0000346 3300035725 Bacteria 26182
169 Ga0373947_0007374 3300035725 Bacteria 6367
170 Ga0373947_0951058 3300035725 Bacteria 586
171 Ga0373925_0011633 3300037068 Bacteria 6364
172 Ga0373925_0058105 3300037068 Bacteria 2900
173 Ga0395900_1005380 3300037418 Bacteria 754
174 Ga0395898_0069707 3300037466 Bacteria 3401
175 Ga0395901_0559754 3300038443 Bacteria 1158
176 Ga0451800_0434479 3300041459 Bacteria 2140
177 Ga0451807_0309764 3300041486 Bacteria 683
178 Ga0451853_0269936 3300041512 Bacteria 4417
179 Ga0466969_0158713 3300044656 Bacteria 1040
180 Ga0466969_0228102 3300044656 Bacteria 846
181 Ga0466972_0255031 3300044658 Bacteria 820
182 Ga0466965_0177189 3300044683 Bacteria 1124
183 Ga0466965_0194585 3300044683 Bacteria 1074
184 Ga0466966_0009409 3300044684 Bacteria 6470
185 Ga0466966_0032318 3300044684 Bacteria 3392
186 Ga0466966_0348425 3300044684 Bacteria 890
187 Ga0466961_0019049 3300044693 Bacteria 4415
188 Ga0466961_0093782 3300044693 Bacteria 1894
189 Ga0466961_0122946 3300044693 Bacteria 1629
190 Ga0466961_0288422 3300044693 Bacteria 1004
191 Ga0466963_0006083 3300044694 Bacteria 7117
192 Ga0466963_0006311 3300044694 Bacteria 7011
193 Ga0466963_0007325 3300044694 Bacteria 6576
194 Ga0466963_0014533 3300044694 Bacteria 4856
195 Ga0466963_0043890 3300044694 Bacteria 2941
196 Ga0466963_0112021 3300044694 Bacteria 1874
197 Ga0466963_0138326 3300044694 Bacteria 1686
198 Ga0466963_0408105 3300044694 Bacteria 958
199 Ga0466963_0524917 3300044694 Bacteria 836
200 Ga0466963_0631590 3300044694 Bacteria 756
201 Ga0466964_0006796 3300044706 Bacteria 4266
202 Ga0466964_0012945 3300044706 Bacteria 3160
203 Ga0466964_0025241 3300044706 Bacteria 2320
204 Ga0466964_0189522 3300044706 Bacteria 980
205 Ga0466971_0012678 3300044719 Bacteria 3697
206 Ga0466971_0429940 3300044719 Bacteria 646
207 Ga0466968_0144116 3300044735 Bacteria 1091
208 Ga0466968_0265412 3300044735 Bacteria 818
209 Ga0466968_0351942 3300044735 Bacteria 716
210 Ga0466968_0503630 3300044735 Bacteria 604
211 Ga0466970_0129654 3300044765 Bacteria 1385
212 Ga0466970_0261168 3300044765 Bacteria 971
213 Ga0466970_0315253 3300044765 Bacteria 883
214 Ga0466957_0087813 3300044842 Bacteria 1945
215 Ga0466957_0113141 3300044842 Bacteria 1723
216 Ga0466957_0152975 3300044842 Bacteria 1493
217 Ga0466957_0252412 3300044842 Bacteria 1173
218 Ga0466957_0329861 3300044842 Bacteria 1031
219 Ga0466957_0719819 3300044842 Bacteria 705
220 Ga0466957_1272098 3300044842 Bacteria 533
221 Ga0466959_0009724 3300045049 Bacteria 6848
222 Ga0466959_0084343 3300045049 Bacteria 2287
223 Ga0466959_0087125 3300045049 Bacteria 2246
224 Ga0466959_0125700 3300045049 Bacteria 1820
225 Ga0466959_0132483 3300045049 Bacteria 1766
226 Ga0466959_0249954 3300045049 Bacteria 1223
227 Ga0466959_0360229 3300045049 Bacteria 991
228 Ga0466959_0421408 3300045049 Bacteria 906
229 Ga0466959_0663338 3300045049 Bacteria 700
230 Ga0466959_0892367 3300045049 Bacteria 593
231 Ga0466958_0006541 3300045836 Bacteria 6350
232 Ga0466958_0008181 3300045836 Bacteria 5790
233 Ga0466958_0022522 3300045836 Bacteria 3692
234 Ga0466958_0343533 3300045836 Bacteria 960
235 Ga0466958_0477649 3300045836 Bacteria 808
236 Ga0466958_0685121 3300045836 Bacteria 667
237 Ga0466958_0815698 3300045836 Bacteria 608
238 Ga0466958_1054617 3300045836 Bacteria 530
239 Ga0466967_0000171 3300045976 Bacteria 26713
240 Ga0466967_0000375 3300045976 Bacteria 20754
241 Ga0466967_0004160 3300045976 Bacteria 9683
242 Ga0466967_0014944 3300045976 Bacteria 6071
243 Ga0466967_0035158 3300045976 Bacteria 4261
244 Ga0466967_0068703 3300045976 Bacteria 3164
245 Ga0466967_0128891 3300045976 Bacteria 2346
246 Ga0466967_0142548 3300045976 Bacteria 2233
247 Ga0466967_0356959 3300045976 Unclassified 1415
248 Ga0466967_0379403 3300045976 Unclassified 1372
249 Ga0466967_0394170 3300045976 Bacteria 1346
250 Ga0466967_0395216 3300045976 Bacteria 1344
251 Ga0466967_0426863 3300045976 Bacteria 1293
252 Ga0466967_0482590 3300045976 Bacteria 1215
253 Ga0466967_1144896 3300045976 Bacteria 775
254 Ga0495603_0003391 3300046455 Bacteria 9486
255 Ga0495629_0557354 3300046459 Bacteria 769
256 Ga0495641_0005424 3300046461 Bacteria 8627
257 Ga0495580_0228694 3300046472 Bacteria 1277
258 Ga0495582_0277069 3300046473 Bacteria 963
259 Ga0495639_0336606 3300046475 Bacteria 756
260 Ga0495639_0346700 3300046475 Bacteria 745
261 Ga0495594_0006399 3300046499 Bacteria 6059
262 Ga0495630_0179708 3300046517 Bacteria 1613
263 Ga0495644_0263840 3300046523 Bacteria 670
264 Ga0495609_0400544 3300046538 Bacteria 549
265 Ga0495645_0016609 3300046543 Bacteria 5259
266 Ga0495667_0998933 3300046559 Bacteria 510
267 Ga0495588_0000814 3300046674 Bacteria 13912
268 Ga0495657_0041592 3300046675 Bacteria 3144
269 Ga0495658_0157593 3300046683 Bacteria 1398
270 Ga0495669_0326894 3300046684 Bacteria 740
271 Ga0495613_0249258 3300046689 Bacteria 1240
272 Ga0495613_0512240 3300046689 Bacteria 807
273 Ga0495624_0093366 3300046690 Unclassified 1855
274 Ga0495581_0520907 3300047315 Bacteria 691
275 Ga0495676_0011685 3300047321 Bacteria 7917
276 Ga0495676_0132869 3300047321 Bacteria 1794
277 Ga0495676_0344717 3300047321 Bacteria 997
278 Ga0495680_0056916 3300047322 Bacteria 3026
279 Ga0495685_286888 3300047447 Bacteria 518
280 Ga0495614_0286054 3300048089 Bacteria 760
281 Ga0496100_0054464 3300048903 Bacteria 2609
282 Ga0496100_0099747 3300048903 Bacteria 1999
283 Ga0496100_0581912 3300048903 Bacteria 868
284 Ga0496100_0771179 3300048903 Bacteria 753
285 Ga0496100_1300191 3300048903 Bacteria 574
286 Ga0496101_0557474 3300048904 Bacteria 906
287 Ga0496102_0237994 3300048905 Bacteria 1717
288 Ga0496102_0445561 3300048905 Bacteria 1215
289 Ga0496103_0199018 3300048906 Bacteria 1288
290 Ga0496104_0274664 3300048907 Bacteria 1598
291 Ga0496105_0071579 3300048908 Bacteria 2865
292 Ga0496105_0281028 3300048908 Bacteria 1342
293 Ga0496105_0325173 3300048908 Bacteria 1232
294 Ga0496106_0269025 3300048909 Bacteria 1364
295 Ga0496107_0002867 3300048910 Bacteria 11400
296 Ga0496107_0705691 3300048910 Bacteria 742
297 Ga0496107_0762216 3300048910 Bacteria 710
298 Ga0496108_0009437 3300048911 Bacteria 7902
299 Ga0496108_0068335 3300048911 Bacteria 2998
300 Ga0496108_0207361 3300048911 Bacteria 1701
301 Ga0496108_0806116 3300048911 Bacteria 810
302 Ga0496109_0009340 3300048912 Bacteria 8356
303 Ga0496109_0260045 3300048912 Bacteria 1635
304 Ga0496109_0276185 3300048912 Bacteria 1583
305 Ga0496109_1361635 3300048912 Bacteria 645
306 Ga0496110_0009591 3300048913 Bacteria 7834
307 Ga0496110_0063921 3300048913 Bacteria 3252
308 Ga0496110_0511149 3300048913 Bacteria 1093
309 Ga0496110_0617318 3300048913 Bacteria 983
310 Ga0496111_0064006 3300048914 Bacteria 2667
311 Ga0496111_0135302 3300048914 Bacteria 1825
312 Ga0496111_0211495 3300048914 Bacteria 1440
313 Ga0496111_0439035 3300048914 Bacteria 963
314 Ga0496112_0144318 3300048915 Bacteria 2349
315 Ga0496112_0149433 3300048915 Bacteria 2304
316 Ga0496112_0176293 3300048915 Bacteria 2103
317 Ga0496113_0187354 3300048916 Bacteria 1642
318 Ga0496113_0890014 3300048916 Bacteria 705
319 Ga0496114_0294461 3300048917 Bacteria 1432
320 Ga0496114_0367109 3300048917 Bacteria 1274
321 Ga0496114_1227851 3300048917 Unclassified 636
322 Ga0496115_0074064 3300048918 Bacteria 2764
323 Ga0496115_0087590 3300048918 Bacteria 2541
324 Ga0501067_0001043 3300049583 Bacteria 14898
325 Ga0501069_0009597 3300049585 Bacteria 5109
326 nmdc:mga05p37_124293_c1 3300050507 Bacteria 3169
327 nmdc:mga0n895_12063_c1 3300050512 Bacteria 7736
328 nmdc:mga0n895_15207_c1 3300050512 Bacteria 7012
329 nmdc:mga0n895_231498_c1 3300050512 Bacteria 1875
330 nmdc:mga0n895_32988_c1 3300050512 Bacteria 4973
331 nmdc:mga0rr50_11427_c1 3300050513 Bacteria 5685
332 nmdc:mga0rr50_243999_c1 3300050513 Bacteria 1490
333 nmdc:mga0rr50_294013_c1 3300050513 Bacteria 1358
334 nmdc:mga0rr50_88667_c1 3300050513 Bacteria 2404
335 nmdc:mga08x19_660251_c1 3300050514 Bacteria 742
336 nmdc:mga0a205_38152_c2 3300050515 Bacteria 2896
337 nmdc:mga0a205_393960_c1 3300050515 Bacteria 1249
338 nmdc:mga0a205_415462_c1 3300050515 Bacteria 1208
339 nmdc:mga0a205_4711_c1 3300050515 Bacteria 12251
340 nmdc:mga0a205_83591_c1 3300050515 Bacteria 3083
341 Ga0587093_079506 3300059478 Bacteria 564
342 Ga0587066_018907 3300059490 Bacteria 1115
343 Ga0587070_036876 3300059491 Bacteria 917
344 Ga0587070_157382 3300059491 Bacteria 574
345 Ga0587073_0006662 3300059492 Bacteria 1790
346 Ga0587073_0053545 3300059492 Bacteria 923
347 Ga0587073_0115582 3300059492 Unclassified 717
348 Ga0587073_0211137 3300059492 Bacteria 588
349 Ga0587073_0320016 3300059492 Bacteria 511
350 Ga0587073_0328717 3300059492 Bacteria 506
351 Ga0587082_028739 3300059504 Bacteria 956
352 Ga0587082_059578 3300059504 Bacteria 750
353 Ga0587082_134910 3300059504 Bacteria 571
354 Ga0587083_0118064 3300059505 Bacteria 682
355 Ga0587083_0121128 3300059505 Bacteria 676
356 Ga0587083_0136431 3300059505 Bacteria 649
357 Ga0587083_0253355 3300059505 Bacteria 525
358 Ga0587083_0265852 3300059505 Bacteria 517
359 Ga0587088_004664 3300059508 Bacteria 1753
360 Ga0587088_044165 3300059508 Bacteria 850
361 Ga0587088_049902 3300059508 Unclassified 816
362 Ga0587089_055982 3300059509 Unclassified 643
363 Ga0587090_152834 3300059510 Bacteria 524
364 Ga0587091_050329 3300059511 Bacteria 853
365 Ga0587091_112789 3300059511 Bacteria 651
366 Ga0587091_146400 3300059511 Bacteria 596
367 Ga0587091_208497 3300059511 Bacteria 528
368 Ga0587094_116140 3300059513 Bacteria 531
369 Ga0587098_022920 3300059604 Bacteria 807
370 Ga0587098_031841 3300059604 Unclassified 729
371 Ga0587098_035477 3300059604 Bacteria 705
372 Ga0587106_006039 3300059605 Bacteria 1411
373 Ga0587106_030148 3300059605 Bacteria 866
374 Ga0587106_035617 3300059605 Bacteria 821
375 Ga0587099_003055 3300059622 Bacteria 1364
376 Ga0587101_138016 3300059623 Bacteria 518
377 Ga0587113_019437 3300059625 Bacteria 704
378 Ga0587115_028780 3300059626 Bacteria 815
379 Ga0587122_031625 3300059628 Bacteria 625
380 Ga0587128_001499 3300059630 Bacteria 2220
381 Ga0587128_009775 3300059630 Bacteria 1273
382 Ga0587128_041940 3300059630 Bacteria 804
383 Ga0587128_054480 3300059630 Bacteria 739
384 Ga0587128_092298 3300059630 Bacteria 623
385 Ga0587128_155506 3300059630 Bacteria 524
386 Ga0587128_173036 3300059630 Bacteria 505
387 Ga0587068_167296 3300059641 Bacteria 506
388 Ga0587075_003128 3300059644 Bacteria 1816
389 Ga0587075_078579 3300059644 Bacteria 626
390 Ga0587075_113457 3300059644 Unclassified 554
391 Ga0587079_008062 3300059647 Bacteria 1597
392 Ga0587107_007345 3300059652 Bacteria 1238
393 Ga0587107_033446 3300059652 Bacteria 795
394 Ga0587114_001505 3300059655 Bacteria 1971
395 Ga0587114_007751 3300059655 Bacteria 1240
396 Ga0587114_090492 3300059655 Bacteria 582
397 Ga0587120_018875 3300059659 Bacteria 644
398 Ga0587120_030396 3300059659 Bacteria 550
399 Ga0587111_0154370 3300060346 Bacteria 619
400 Ga0466962_0014414 3300061719 Bacteria 3809
401 Ga0466962_0196827 3300061719 Bacteria 984
402 Ga0466962_0234412 3300061719 Bacteria 900
403 Ga0530510_0014340 3300061734 Bacteria 5588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_101582296 Ga0075434_1015822961 99
2 3300009094 Ga0111539_10920859 Ga0111539_109208592 99
3 3300005435 Ga0070714_100391112 Ga0070714_1003911122 100
4 3300005436 Ga0070713_100044639 Ga0070713_1000446396 100
5 3300005549 Ga0070704_101477459 Ga0070704_1014774592 100
6 3300006173 Ga0070716_100025827 Ga0070716_1000258275 100
7 3300006175 Ga0070712_100085807 Ga0070712_1000858074 100
8 3300020078 Ga0206352_10363894 Ga0206352_103638941 100
9 3300005937 Ga0081455_10000439 Ga0081455_1000043957 101
10 3300035171 Ga0373946_0514786 Ga0373946_0514786_87_464 101
11 3300044694 Ga0466963_0112021 Ga0466963_0112021_802_1164 101
12 3300045976 Ga0466967_0356959 Ga0466967_0356959_329_691 101
13 3300047321 Ga0495676_0132869 Ga0495676_0132869_744_1121 101
14 3300005458 Ga0070681_10054858 Ga0070681_100548582 102
15 3300020081 Ga0206354_11532108 Ga0206354_115321084 102
16 3300025905 Ga0207685_10055493 Ga0207685_100554932 102
17 3300025917 Ga0207660_10121921 Ga0207660_101219213 102
18 3300044719 Ga0466971_0012678 Ga0466971_0012678_2685_3044 103
19 3300044842 Ga0466957_0152975 Ga0466957_0152975_738_1097 103
20 3300006847 Ga0075431_100149394 Ga0075431_1001493943 104
21 3300005435 Ga0070714_100007122 Ga0070714_1000071226 105
22 3300005435 Ga0070714_100267841 Ga0070714_1002678412 105
23 3300005436 Ga0070713_100521897 Ga0070713_1005218971 105
24 3300005563 Ga0068855_100030742 Ga0068855_1000307423 105
25 3300005614 Ga0068856_101099122 Ga0068856_1010991222 105
26 3300009093 Ga0105240_11826324 Ga0105240_118263242 105
27 3300020081 Ga0206354_11049990 Ga0206354_110499903 105
28 3300025928 Ga0207700_11097208 Ga0207700_110972081 105
29 3300025929 Ga0207664_10246242 Ga0207664_102462422 105
30 3300025929 Ga0207664_11222310 Ga0207664_112223101 105
31 3300025929 Ga0207664_11601697 Ga0207664_116016972 105
32 3300025949 Ga0207667_10617335 Ga0207667_106173352 105
33 3300026078 Ga0207702_11032587 Ga0207702_110325872 105
34 3300026142 Ga0207698_10292313 Ga0207698_102923132 105
35 3300037466 Ga0395898_0069707 Ga0395898_0069707_1912_2283 105
36 3300044765 Ga0466970_0129654 Ga0466970_0129654_984_1343 105
37 3300045049 Ga0466959_0663338 Ga0466959_0663338_161_520 105
38 3300045836 Ga0466958_0022522 Ga0466958_0022522_213_572 105
39 3300050515 nmdc:mga0a205_393960_c1 nmdc:mga0a205_393960_c1_261_632 105
40 3300059505 Ga0587083_0265852 Ga0587083_0265852_34_399 105
41 3300059630 Ga0587128_155506 Ga0587128_155506_93_464 105
42 3300003308 Ga0006777J48905_1050010 Ga0006777J48905_10500103 106
43 3300003693 Ga0032354_1061107 Ga0032354_10611071 106
44 3300005329 Ga0070683_100013248 Ga0070683_1000132482 106
45 3300005336 Ga0070680_100037272 Ga0070680_1000372721 106
46 3300005338 Ga0068868_100082216 Ga0068868_1000822163 106
47 3300005340 Ga0070689_100269049 Ga0070689_1002690493 106
48 3300005354 Ga0070675_100357980 Ga0070675_1003579802 106
49 3300005364 Ga0070673_100236613 Ga0070673_1002366134 106
50 3300005365 Ga0070688_100106563 Ga0070688_1001065634 106
51 3300005440 Ga0070705_100434243 Ga0070705_1004342432 106
52 3300005444 Ga0070694_101113733 Ga0070694_1011137332 106
53 3300005458 Ga0070681_10078002 Ga0070681_100780022 106
54 3300005530 Ga0070679_100097748 Ga0070679_1000977484 106
55 3300005535 Ga0070684_100008348 Ga0070684_1000083484 106
56 3300005545 Ga0070695_100425850 Ga0070695_1004258501 106
57 3300005549 Ga0070704_100133928 Ga0070704_1001339282 106
58 3300005564 Ga0070664_100345649 Ga0070664_1003456491 106
59 3300005578 Ga0068854_100270080 Ga0068854_1002700802 106
60 3300005615 Ga0070702_100177119 Ga0070702_1001771192 106
61 3300005616 Ga0068852_102244390 Ga0068852_1022443902 106
62 3300005843 Ga0068860_102837488 Ga0068860_1028374881 106
63 3300005981 Ga0081538_10039202 Ga0081538_100392022 106
64 3300005985 Ga0081539_10000639 Ga0081539_1000063978 106
65 3300006173 Ga0070716_100262891 Ga0070716_1002628912 106
66 3300006175 Ga0070712_100024630 Ga0070712_1000246306 106
67 3300006847 Ga0075431_101821304 Ga0075431_1018213041 106
68 3300006852 Ga0075433_10059667 Ga0075433_100596674 106
69 3300006871 Ga0075434_100004184 Ga0075434_10000418412 106
70 3300006871 Ga0075434_100065387 Ga0075434_1000653876 106
71 3300007076 Ga0075435_100017592 Ga0075435_10001759211 106
72 3300007076 Ga0075435_100019323 Ga0075435_1000193237 106
73 3300009098 Ga0105245_10032247 Ga0105245_100322476 106
74 3300009147 Ga0114129_10155604 Ga0114129_101556041 106
75 3300009176 Ga0105242_11340622 Ga0105242_113406222 106
76 3300009177 Ga0105248_11918663 Ga0105248_119186632 106
77 3300009551 Ga0105238_11194328 Ga0105238_111943281 106
78 3300012481 Ga0157320_1012974 Ga0157320_10129742 106
79 3300013100 Ga0157373_11061243 Ga0157373_110612431 106
80 3300013100 Ga0157373_11251746 Ga0157373_112517462 106
81 3300013308 Ga0157375_10084048 Ga0157375_100840482 106
82 3300020069 Ga0197907_10446238 Ga0197907_104462383 106
83 3300020070 Ga0206356_11519433 Ga0206356_115194332 106
84 3300020070 Ga0206356_11900830 Ga0206356_119008302 106
85 3300020075 Ga0206349_1051630 Ga0206349_10516301 106
86 3300020077 Ga0206351_10307836 Ga0206351_103078363 106
87 3300020077 Ga0206351_10711578 Ga0206351_107115782 106
88 3300020077 Ga0206351_10778341 Ga0206351_107783412 106
89 3300020078 Ga0206352_10246285 Ga0206352_102462852 106
90 3300020078 Ga0206352_10314912 Ga0206352_103149122 106
91 3300020080 Ga0206350_10720888 Ga0206350_107208885 106
92 3300020081 Ga0206354_11532108 Ga0206354_115321082 106
93 3300020610 Ga0154015_1256524 Ga0154015_12565242 106
94 3300022467 Ga0224712_10011520 Ga0224712_100115203 106
95 3300022467 Ga0224712_10177697 Ga0224712_101776972 106
96 3300025912 Ga0207707_10224104 Ga0207707_102241042 106
97 3300025915 Ga0207693_10011917 Ga0207693_1001191714 106
98 3300025916 Ga0207663_10244598 Ga0207663_102445982 106
99 3300025917 Ga0207660_10129194 Ga0207660_101291943 106
100 3300025921 Ga0207652_10056417 Ga0207652_100564174 106
101 3300025926 Ga0207659_11206331 Ga0207659_112063312 106
102 3300025927 Ga0207687_10010410 Ga0207687_100104108 106
103 3300025932 Ga0207690_10585964 Ga0207690_105859642 106
104 3300025936 Ga0207670_10697092 Ga0207670_106970922 106
105 3300025942 Ga0207689_10928601 Ga0207689_109286012 106
106 3300025944 Ga0207661_10035579 Ga0207661_100355798 106
107 3300025945 Ga0207679_10604346 Ga0207679_106043462 106
108 3300025949 Ga0207667_11042745 Ga0207667_110427452 106
109 3300026023 Ga0207677_10708064 Ga0207677_107080642 106
110 3300026142 Ga0207698_11856035 Ga0207698_118560352 106
111 3300026142 Ga0207698_12174350 Ga0207698_121743502 106
112 3300028381 Ga0268264_10457227 Ga0268264_104572273 106
113 3300035170 Ga0373943_0002151 Ga0373943_0002151_3899_4261 106
114 3300035170 Ga0373943_0097697 Ga0373943_0097697_787_1152 106
115 3300035692 Ga0373935_0399154 Ga0373935_0399154_386_748 106
116 3300035695 Ga0373927_0475547 Ga0373927_0475547_222_587 106
117 3300035725 Ga0373947_0000346 Ga0373947_0000346_9325_9687 106
118 3300037068 Ga0373925_0058105 Ga0373925_0058105_1226_1588 106
119 3300044656 Ga0466969_0158713 Ga0466969_0158713_505_873 106
120 3300044658 Ga0466972_0255031 Ga0466972_0255031_252_620 106
121 3300044683 Ga0466965_0177189 Ga0466965_0177189_596_964 106
122 3300044684 Ga0466966_0032318 Ga0466966_0032318_2452_2823 106
123 3300044684 Ga0466966_0348425 Ga0466966_0348425_339_701 106
124 3300044693 Ga0466961_0093782 Ga0466961_0093782_1248_1619 106
125 3300044693 Ga0466961_0122946 Ga0466961_0122946_1110_1478 106
126 3300044693 Ga0466961_0288422 Ga0466961_0288422_306_668 106
127 3300044694 Ga0466963_0006083 Ga0466963_0006083_5842_6195 106
128 3300044694 Ga0466963_0007325 Ga0466963_0007325_2675_3046 106
129 3300044694 Ga0466963_0043890 Ga0466963_0043890_401_769 106
130 3300044694 Ga0466963_0138326 Ga0466963_0138326_319_672 106
131 3300044694 Ga0466963_0524917 Ga0466963_0524917_156_521 106
132 3300044694 Ga0466963_0631590 Ga0466963_0631590_247_609 106
133 3300044706 Ga0466964_0006796 Ga0466964_0006796_2460_2828 106
134 3300044706 Ga0466964_0012945 Ga0466964_0012945_1192_1539 106
135 3300044706 Ga0466964_0025241 Ga0466964_0025241_1451_1819 106
136 3300044735 Ga0466968_0144116 Ga0466968_0144116_177_539 106
137 3300044735 Ga0466968_0265412 Ga0466968_0265412_123_491 106
138 3300044735 Ga0466968_0351942 Ga0466968_0351942_52_420 106
139 3300044735 Ga0466968_0503630 Ga0466968_0503630_29_400 106
140 3300044765 Ga0466970_0315253 Ga0466970_0315253_276_647 106
141 3300044842 Ga0466957_0087813 Ga0466957_0087813_407_775 106
142 3300044842 Ga0466957_0113141 Ga0466957_0113141_520_882 106
143 3300044842 Ga0466957_0329861 Ga0466957_0329861_269_622 106
144 3300044842 Ga0466957_1272098 Ga0466957_1272098_144_515 106
145 3300045049 Ga0466959_0084343 Ga0466959_0084343_1712_2083 106
146 3300045049 Ga0466959_0132483 Ga0466959_0132483_379_747 106
147 3300045049 Ga0466959_0249954 Ga0466959_0249954_19_387 106
148 3300045049 Ga0466959_0892367 Ga0466959_0892367_212_580 106
149 3300045836 Ga0466958_0008181 Ga0466958_0008181_3501_3872 106
150 3300045836 Ga0466958_0685121 Ga0466958_0685121_132_485 106
151 3300045836 Ga0466958_0815698 Ga0466958_0815698_198_560 106
152 3300045836 Ga0466958_1054617 Ga0466958_1054617_70_438 106
153 3300045976 Ga0466967_0000171 Ga0466967_0000171_24162_24524 106
154 3300045976 Ga0466967_0000375 Ga0466967_0000375_18400_18768 106
155 3300045976 Ga0466967_0004160 Ga0466967_0004160_6847_7194 106
156 3300045976 Ga0466967_0014944 Ga0466967_0014944_2440_2793 106
157 3300045976 Ga0466967_0128891 Ga0466967_0128891_53_424 106
158 3300045976 Ga0466967_0142548 Ga0466967_0142548_1046_1417 106
159 3300045976 Ga0466967_0379403 Ga0466967_0379403_676_1038 106
160 3300045976 Ga0466967_0394170 Ga0466967_0394170_704_1147 106
161 3300045976 Ga0466967_0395216 Ga0466967_0395216_594_962 106
162 3300045976 Ga0466967_0482590 Ga0466967_0482590_725_1087 106
163 3300046459 Ga0495629_0557354 Ga0495629_0557354_233_595 106
164 3300046517 Ga0495630_0179708 Ga0495630_0179708_122_487 106
165 3300046523 Ga0495644_0263840 Ga0495644_0263840_305_655 106
166 3300046538 Ga0495609_0400544 Ga0495609_0400544_188_538 106
167 3300046684 Ga0495669_0326894 Ga0495669_0326894_73_423 106
168 3300047321 Ga0495676_0344717 Ga0495676_0344717_553_918 106
169 3300047447 Ga0495685_286888 Ga0495685_286888_149_499 106
170 3300048089 Ga0495614_0286054 Ga0495614_0286054_265_627 106
171 3300048903 Ga0496100_0054464 Ga0496100_0054464_1362_1733 106
172 3300048903 Ga0496100_0099747 Ga0496100_0099747_988_1344 106
173 3300048903 Ga0496100_1300191 Ga0496100_1300191_141_500 106
174 3300048904 Ga0496101_0557474 Ga0496101_0557474_14_373 106
175 3300048905 Ga0496102_0237994 Ga0496102_0237994_913_1269 106
176 3300048905 Ga0496102_0445561 Ga0496102_0445561_481_837 106
177 3300048906 Ga0496103_0199018 Ga0496103_0199018_446_802 106
178 3300048909 Ga0496106_0269025 Ga0496106_0269025_918_1289 106
179 3300048910 Ga0496107_0002867 Ga0496107_0002867_10249_10620 106
180 3300048910 Ga0496107_0705691 Ga0496107_0705691_226_582 106
181 3300048910 Ga0496107_0762216 Ga0496107_0762216_229_585 106
182 3300048911 Ga0496108_0009437 Ga0496108_0009437_4951_5307 106
183 3300048911 Ga0496108_0068335 Ga0496108_0068335_1912_2271 106
184 3300048912 Ga0496109_0009340 Ga0496109_0009340_1782_2138 106
185 3300048912 Ga0496109_0276185 Ga0496109_0276185_1144_1503 106
186 3300048912 Ga0496109_1361635 Ga0496109_1361635_80_439 106
187 3300048913 Ga0496110_0009591 Ga0496110_0009591_1465_1821 106
188 3300048913 Ga0496110_0063921 Ga0496110_0063921_1934_2293 106
189 3300048914 Ga0496111_0064006 Ga0496111_0064006_1438_1794 106
190 3300048914 Ga0496111_0135302 Ga0496111_0135302_642_1016 106
191 3300048914 Ga0496111_0211495 Ga0496111_0211495_121_480 106
192 3300048915 Ga0496112_0144318 Ga0496112_0144318_1419_1778 106
193 3300048915 Ga0496112_0149433 Ga0496112_0149433_461_817 106
194 3300048915 Ga0496112_0176293 Ga0496112_0176293_933_1292 106
195 3300048917 Ga0496114_0367109 Ga0496114_0367109_593_949 106
196 3300048917 Ga0496114_1227851 Ga0496114_1227851_98_457 106
197 3300050507 nmdc:mga05p37_124293_c1 nmdc:mga05p37_124293_c1_82_450 106
198 3300050512 nmdc:mga0n895_15207_c1 nmdc:mga0n895_15207_c1_4195_4566 106
199 3300050512 nmdc:mga0n895_32988_c1 nmdc:mga0n895_32988_c1_2077_2445 106
200 3300050513 nmdc:mga0rr50_11427_c1 nmdc:mga0rr50_11427_c1_5045_5413 106
201 3300050513 nmdc:mga0rr50_243999_c1 nmdc:mga0rr50_243999_c1_117_488 106
202 3300050514 nmdc:mga08x19_660251_c1 nmdc:mga08x19_660251_c1_68_436 106
203 3300050515 nmdc:mga0a205_38152_c2 nmdc:mga0a205_38152_c2_1410_1781 106
204 3300050515 nmdc:mga0a205_83591_c1 nmdc:mga0a205_83591_c1_940_1308 106
205 3300059478 Ga0587093_079506 Ga0587093_079506_74_445 106
206 3300059491 Ga0587070_157382 Ga0587070_157382_196_558 106
207 3300059492 Ga0587073_0115582 Ga0587073_0115582_233_595 106
208 3300059492 Ga0587073_0211137 Ga0587073_0211137_111_476 106
209 3300059492 Ga0587073_0320016 Ga0587073_0320016_18_380 106
210 3300059492 Ga0587073_0328717 Ga0587073_0328717_104_478 106
211 3300059504 Ga0587082_028739 Ga0587082_028739_587_937 106
212 3300059504 Ga0587082_134910 Ga0587082_134910_176_535 106
213 3300059505 Ga0587083_0121128 Ga0587083_0121128_152_517 106
214 3300059508 Ga0587088_044165 Ga0587088_044165_18_368 106
215 3300059508 Ga0587088_049902 Ga0587088_049902_324_686 106
216 3300059509 Ga0587089_055982 Ga0587089_055982_166_528 106
217 3300059511 Ga0587091_050329 Ga0587091_050329_168_530 106
218 3300059511 Ga0587091_146400 Ga0587091_146400_104_472 106
219 3300059511 Ga0587091_208497 Ga0587091_208497_37_408 106
220 3300059604 Ga0587098_031841 Ga0587098_031841_168_530 106
221 3300059605 Ga0587106_030148 Ga0587106_030148_181_543 106
222 3300059623 Ga0587101_138016 Ga0587101_138016_18_380 106
223 3300059630 Ga0587128_041940 Ga0587128_041940_321_683 106
224 3300059630 Ga0587128_054480 Ga0587128_054480_304_663 106
225 3300059630 Ga0587128_173036 Ga0587128_173036_89_448 106
226 3300059644 Ga0587075_078579 Ga0587075_078579_124_489 106
227 3300059644 Ga0587075_113457 Ga0587075_113457_116_478 106
228 3300059652 Ga0587107_033446 Ga0587107_033446_309_671 106
229 3300059655 Ga0587114_090492 Ga0587114_090492_152_511 106
230 3300061719 Ga0466962_0234412 Ga0466962_0234412_128_496 106
231 3300005535 Ga0070684_100586668 Ga0070684_1005866682 107
232 3300005549 Ga0070704_100438565 Ga0070704_1004385653 107
233 3300048916 Ga0496113_0187354 Ga0496113_0187354_382_831 107
234 3300044694 Ga0466963_0408105 Ga0466963_0408105_64_492 109
235 3300013296 Ga0157374_12932708 Ga0157374_129327081 110
236 3300013307 Ga0157372_12624811 Ga0157372_126248111 111
237 3300013308 Ga0157375_11631780 Ga0157375_116317802 112
238 3300048913 Ga0496110_0511149 Ga0496110_0511149_135_596 112
239 3300044694 Ga0466963_0014533 Ga0466963_0014533_1391_1834 113
240 3300045049 Ga0466959_0360229 Ga0466959_0360229_328_771 113
241 3300061719 Ga0466962_0014414 Ga0466962_0014414_1429_1872 113
242 3300005614 Ga0068856_100761943 Ga0068856_1007619432 114
243 3300041486 Ga0451807_0309764 Ga0451807_0309764_122_592 114
244 3300046689 Ga0495613_0512240 Ga0495613_0512240_103_567 114
245 3300048903 Ga0496100_0581912 Ga0496100_0581912_256_714 114
246 3300048908 Ga0496105_0325173 Ga0496105_0325173_323_781 114
247 3300048911 Ga0496108_0806116 Ga0496108_0806116_209_667 114
248 3300048914 Ga0496111_0439035 Ga0496111_0439035_476_934 114
249 3300044719 Ga0466971_0429940 Ga0466971_0429940_85_528 115
250 3300045976 Ga0466967_0004160 Ga0466967_0004160_7439_7876 115
251 3300045976 Ga0466967_0426863 Ga0466967_0426863_403_840 115
252 3300059659 Ga0587120_018875 Ga0587120_018875_117_554 115
253 3300020082 Ga0206353_10262973 Ga0206353_102629732 116
254 3300041459 Ga0451800_0434479 Ga0451800_0434479_1009_1449 116
255 3300041512 Ga0451853_0269936 Ga0451853_0269936_2852_3292 116
256 3300044656 Ga0466969_0228102 Ga0466969_0228102_265_702 116
257 3300044683 Ga0466965_0194585 Ga0466965_0194585_236_676 116
258 3300044693 Ga0466961_0093782 Ga0466961_0093782_361_801 116
259 3300044706 Ga0466964_0006796 Ga0466964_0006796_1611_2054 116
260 3300044765 Ga0466970_0261168 Ga0466970_0261168_190_630 116
261 3300044842 Ga0466957_0087813 Ga0466957_0087813_1188_1622 116
262 3300044842 Ga0466957_0252412 Ga0466957_0252412_432_872 116
263 3300045049 Ga0466959_0087125 Ga0466959_0087125_1547_1987 116
264 3300045049 Ga0466959_0125700 Ga0466959_0125700_486_926 116
265 3300045049 Ga0466959_0132483 Ga0466959_0132483_1170_1607 116
266 3300045049 Ga0466959_0421408 Ga0466959_0421408_398_832 116
267 3300045836 Ga0466958_0008181 Ga0466958_0008181_4319_4759 116
268 3300045836 Ga0466958_0343533 Ga0466958_0343533_75_512 116
269 3300045836 Ga0466958_0477649 Ga0466958_0477649_310_744 116
270 3300045976 Ga0466967_0000375 Ga0466967_0000375_17551_17994 116
271 3300045976 Ga0466967_0035158 Ga0466967_0035158_1245_1688 116
272 3300059505 Ga0587083_0136431 Ga0587083_0136431_42_482 116
273 3300059510 Ga0587090_152834 Ga0587090_152834_40_480 116
274 3300059511 Ga0587091_112789 Ga0587091_112789_30_467 116
275 3300059513 Ga0587094_116140 Ga0587094_116140_43_483 116
276 3300059630 Ga0587128_092298 Ga0587128_092298_154_591 116
277 3300061719 Ga0466962_0196827 Ga0466962_0196827_93_533 116
278 3300005328 Ga0070676_11267891 Ga0070676_112678911 117
279 3300005339 Ga0070660_100431515 Ga0070660_1004315152 117
280 3300005366 Ga0070659_100695259 Ga0070659_1006952591 117
281 3300005457 Ga0070662_100109088 Ga0070662_1001090882 117
282 3300005458 Ga0070681_10873112 Ga0070681_108731122 117
283 3300005530 Ga0070679_100775457 Ga0070679_1007754572 117
284 3300006871 Ga0075434_100478012 Ga0075434_1004780121 117
285 3300009094 Ga0111539_10083013 Ga0111539_100830134 117
286 3300013307 Ga0157372_11032215 Ga0157372_110322152 117
287 3300020075 Ga0206349_1465640 Ga0206349_14656401 117
288 3300020078 Ga0206352_10741160 Ga0206352_107411602 117
289 3300022467 Ga0224712_10041961 Ga0224712_100419613 117
290 3300027907 Ga0207428_10125898 Ga0207428_101258983 117
291 3300038443 Ga0395901_0559754 Ga0395901_0559754_108_560 117
292 3300044694 Ga0466963_0007325 Ga0466963_0007325_1821_2270 117
293 3300045976 Ga0466967_1144896 Ga0466967_1144896_221_676 117
294 3300050512 nmdc:mga0n895_231498_c1 nmdc:mga0n895_231498_c1_768_1226 117
295 3300003735 Ga0006780_1037103 Ga0006780_10371031 118
296 3300005336 Ga0070680_100098894 Ga0070680_1000988945 118
297 3300005339 Ga0070660_100423126 Ga0070660_1004231262 118
298 3300005435 Ga0070714_100322902 Ga0070714_1003229022 118
299 3300005436 Ga0070713_100146633 Ga0070713_1001466333 118
300 3300005441 Ga0070700_100453022 Ga0070700_1004530222 118
301 3300005444 Ga0070694_101118509 Ga0070694_1011185091 118
302 3300005458 Ga0070681_10078002 Ga0070681_100780024 118
303 3300005530 Ga0070679_100097748 Ga0070679_1000977482 118
304 3300005535 Ga0070684_100933041 Ga0070684_1009330412 118
305 3300005547 Ga0070693_101084432 Ga0070693_1010844321 118
306 3300006028 Ga0070717_10013228 Ga0070717_100132282 118
307 3300006058 Ga0075432_10114527 Ga0075432_101145273 118
308 3300006163 Ga0070715_10079742 Ga0070715_100797421 118
309 3300006175 Ga0070712_100024630 Ga0070712_1000246307 118
310 3300006847 Ga0075431_101726708 Ga0075431_1017267081 118
311 3300006852 Ga0075433_10412348 Ga0075433_104123482 118
312 3300006871 Ga0075434_100107907 Ga0075434_1001079076 118
313 3300006914 Ga0075436_100159753 Ga0075436_1001597533 118
314 3300007076 Ga0075435_100124026 Ga0075435_1001240263 118
315 3300009174 Ga0105241_11317856 Ga0105241_113178562 118
316 3300009176 Ga0105242_12431520 Ga0105242_124315201 118
317 3300013306 Ga0163162_11200548 Ga0163162_112005482 118
318 3300020070 Ga0206356_11900830 Ga0206356_119008304 118
319 3300020077 Ga0206351_10711578 Ga0206351_107115784 118
320 3300020077 Ga0206351_10852558 Ga0206351_108525582 118
321 3300020080 Ga0206350_10851596 Ga0206350_108515963 118
322 3300020082 Ga0206353_10833568 Ga0206353_108335682 118
323 3300025906 Ga0207699_10128097 Ga0207699_101280972 118
324 3300025912 Ga0207707_10474123 Ga0207707_104741232 118
325 3300025912 Ga0207707_10739925 Ga0207707_107399251 118
326 3300025915 Ga0207693_10011917 Ga0207693_1001191713 118
327 3300025919 Ga0207657_10138575 Ga0207657_101385752 118
328 3300025919 Ga0207657_10371354 Ga0207657_103713543 118
329 3300025921 Ga0207652_10056417 Ga0207652_100564176 118
330 3300025928 Ga0207700_10000004 Ga0207700_10000004439 118
331 3300025931 Ga0207644_11528269 Ga0207644_115282691 118
332 3300025933 Ga0207706_10032689 Ga0207706_100326898 118
333 3300025949 Ga0207667_10739655 Ga0207667_107396551 118
334 3300026023 Ga0207677_10918886 Ga0207677_109188862 118
335 3300026075 Ga0207708_10507867 Ga0207708_105078672 118
336 3300026121 Ga0207683_10212593 Ga0207683_102125933 118
337 3300027907 Ga0207428_10128386 Ga0207428_101283862 118
338 3300031995 Ga0307409_100443182 Ga0307409_1004431822 118
339 3300032126 Ga0307415_101592094 Ga0307415_1015920941 118
340 3300035170 Ga0373943_0416258 Ga0373943_0416258_266_718 118
341 3300035692 Ga0373935_0052060 Ga0373935_0052060_172_624 118
342 3300035725 Ga0373947_0000346 Ga0373947_0000346_8418_8867 118
343 3300035725 Ga0373947_0007374 Ga0373947_0007374_4025_4477 118
344 3300035725 Ga0373947_0951058 Ga0373947_0951058_59_511 118
345 3300037068 Ga0373925_0011633 Ga0373925_0011633_4553_5005 118
346 3300037068 Ga0373925_0058105 Ga0373925_0058105_2046_2495 118
347 3300037418 Ga0395900_1005380 Ga0395900_1005380_96_542 118
348 3300044684 Ga0466966_0009409 Ga0466966_0009409_4175_4630 118
349 3300044693 Ga0466961_0019049 Ga0466961_0019049_3491_3946 118
350 3300044694 Ga0466963_0006311 Ga0466963_0006311_5239_5694 118
351 3300044706 Ga0466964_0189522 Ga0466964_0189522_461_913 118
352 3300044842 Ga0466957_0719819 Ga0466957_0719819_107_562 118
353 3300045049 Ga0466959_0009724 Ga0466959_0009724_1258_1713 118
354 3300045836 Ga0466958_0006541 Ga0466958_0006541_649_1104 118
355 3300045976 Ga0466967_0068703 Ga0466967_0068703_1423_1878 118
356 3300046455 Ga0495603_0003391 Ga0495603_0003391_4585_5037 118
357 3300046461 Ga0495641_0005424 Ga0495641_0005424_4261_4713 118
358 3300046472 Ga0495580_0228694 Ga0495580_0228694_694_1146 118
359 3300046473 Ga0495582_0277069 Ga0495582_0277069_405_854 118
360 3300046475 Ga0495639_0336606 Ga0495639_0336606_18_470 118
361 3300046475 Ga0495639_0346700 Ga0495639_0346700_267_722 118
362 3300046499 Ga0495594_0006399 Ga0495594_0006399_3960_4412 118
363 3300046517 Ga0495630_0179708 Ga0495630_0179708_882_1340 118
364 3300046543 Ga0495645_0016609 Ga0495645_0016609_4138_4584 118
365 3300046559 Ga0495667_0998933 Ga0495667_0998933_37_483 118
366 3300046674 Ga0495588_0000814 Ga0495588_0000814_8786_9238 118
367 3300046675 Ga0495657_0041592 Ga0495657_0041592_2588_3034 118
368 3300046683 Ga0495658_0157593 Ga0495658_0157593_313_762 118
369 3300046689 Ga0495613_0249258 Ga0495613_0249258_406_855 118
370 3300046690 Ga0495624_0093366 Ga0495624_0093366_548_997 118
371 3300047315 Ga0495581_0520907 Ga0495581_0520907_13_465 118
372 3300047321 Ga0495676_0011685 Ga0495676_0011685_3671_4123 118
373 3300047322 Ga0495680_0056916 Ga0495680_0056916_2153_2599 118
374 3300048903 Ga0496100_0099747 Ga0496100_0099747_533_982 118
375 3300048903 Ga0496100_0771179 Ga0496100_0771179_92_544 118
376 3300048907 Ga0496104_0274664 Ga0496104_0274664_1069_1518 118
377 3300048908 Ga0496105_0071579 Ga0496105_0071579_1197_1646 118
378 3300048908 Ga0496105_0281028 Ga0496105_0281028_298_753 118
379 3300048909 Ga0496106_0269025 Ga0496106_0269025_23_469 118
380 3300048911 Ga0496108_0207361 Ga0496108_0207361_1196_1645 118
381 3300048912 Ga0496109_0260045 Ga0496109_0260045_652_1104 118
382 3300048913 Ga0496110_0617318 Ga0496110_0617318_112_564 118
383 3300048916 Ga0496113_0890014 Ga0496113_0890014_109_561 118
384 3300048917 Ga0496114_0294461 Ga0496114_0294461_506_961 118
385 3300048918 Ga0496115_0074064 Ga0496115_0074064_870_1325 118
386 3300048918 Ga0496115_0087590 Ga0496115_0087590_1001_1450 118
387 3300049583 Ga0501067_0001043 Ga0501067_0001043_5726_6178 118
388 3300049585 Ga0501069_0009597 Ga0501069_0009597_3381_3833 118
389 3300050512 nmdc:mga0n895_12063_c1 nmdc:mga0n895_12063_c1_905_1360 118
390 3300050513 nmdc:mga0rr50_294013_c1 nmdc:mga0rr50_294013_c1_113_568 118
391 3300050513 nmdc:mga0rr50_88667_c1 nmdc:mga0rr50_88667_c1_1391_1843 118
392 3300050515 nmdc:mga0a205_415462_c1 nmdc:mga0a205_415462_c1_509_958 118
393 3300050515 nmdc:mga0a205_4711_c1 nmdc:mga0a205_4711_c1_6398_6853 118
394 3300059490 Ga0587066_018907 Ga0587066_018907_347_802 118
395 3300059491 Ga0587070_036876 Ga0587070_036876_229_684 118
396 3300059492 Ga0587073_0006662 Ga0587073_0006662_1232_1687 118
397 3300059492 Ga0587073_0053545 Ga0587073_0053545_447_902 118
398 3300059504 Ga0587082_059578 Ga0587082_059578_143_598 118
399 3300059505 Ga0587083_0118064 Ga0587083_0118064_194_649 118
400 3300059505 Ga0587083_0253355 Ga0587083_0253355_27_464 118
401 3300059508 Ga0587088_004664 Ga0587088_004664_1225_1680 118
402 3300059604 Ga0587098_022920 Ga0587098_022920_26_463 118
403 3300059604 Ga0587098_035477 Ga0587098_035477_76_531 118
404 3300059605 Ga0587106_006039 Ga0587106_006039_876_1331 118
405 3300059605 Ga0587106_035617 Ga0587106_035617_195_632 118
406 3300059622 Ga0587099_003055 Ga0587099_003055_754_1209 118
407 3300059625 Ga0587113_019437 Ga0587113_019437_174_629 118
408 3300059626 Ga0587115_028780 Ga0587115_028780_123_578 118
409 3300059628 Ga0587122_031625 Ga0587122_031625_67_522 118
410 3300059630 Ga0587128_001499 Ga0587128_001499_1439_1894 118
411 3300059630 Ga0587128_009775 Ga0587128_009775_497_934 118
412 3300059641 Ga0587068_167296 Ga0587068_167296_25_480 118
413 3300059644 Ga0587075_003128 Ga0587075_003128_1265_1720 118
414 3300059647 Ga0587079_008062 Ga0587079_008062_946_1401 118
415 3300059652 Ga0587107_007345 Ga0587107_007345_671_1126 118
416 3300059655 Ga0587114_001505 Ga0587114_001505_1438_1893 118
417 3300059655 Ga0587114_007751 Ga0587114_007751_564_1025 118
418 3300059659 Ga0587120_030396 Ga0587120_030396_76_534 118
419 3300061734 Ga0530510_0014340 Ga0530510_0014340_2207_2659 118
420 3300005436 Ga0070713_100044639 Ga0070713_1000446394 119
421 3300006173 Ga0070716_100025827 Ga0070716_1000258277 119
422 3300003203 JGI25406J46586_10081936 JGI25406J46586_100819361 120
423 3300005434 Ga0070709_10322255 Ga0070709_103222552 120
424 3300005985 Ga0081539_10000639 Ga0081539_1000063980 120
425 3300025906 Ga0207699_10025262 Ga0207699_100252627 120
426 3300025915 Ga0207693_10042937 Ga0207693_100429372 120
427 3300060346 Ga0587111_0154370 Ga0587111_0154370_156_518 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00741

Gas_vesicle

Gas vesicle protein

17

55

0.99

Feature Viewer

pLDDT pTM Quality
60.47 0.29 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map