F441309

General Info

Members Datasets Scaffolds Average Seq Length
426 217 852 180

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0106732|Ga0501067_0106732_813_1388
Length 191
Sequence VLGLFNTGGTMTLTIRRLCGIASAAILLMAPASXXXQESKSAGATIEFVKALDSMKLDSYAVKGSSPNEYVAALYFPGTQLLVVSAKFDSPFRADSLLQMKNYRDLYIELNSASQPQTKVFIADLSANGLRARKDGALYDTADVAGKSYSFDGDWKKAKISEDDYTKAYSTTDEQYSQLIQALLGGLKKSS

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 2.35
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 28.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0106732 3300049583 Bacteria 1556
2 SwRhRL3b_contig_1512519 2162886006 Bacteria 810
3 SwRhRL3b_contig_3917105 2162886006 Bacteria 974
4 JGI24749J21850_1029907 3300002076 Unclassified 781
5 Ga0065704_10008978 3300005289 Bacteria 2009
6 Ga0065712_10146815 3300005290 Bacteria 1360
7 Ga0065712_10260544 3300005290 Unclassified 938
8 Ga0065712_10303330 3300005290 Bacteria 856
9 Ga0065715_10090882 3300005293 Bacteria 6346
10 Ga0065715_10107302 3300005293 Unclassified 2779
11 Ga0065707_10015516 3300005295 Bacteria 1945
12 Ga0065707_10015927 3300005295 Bacteria 2148
13 Ga0065707_10428106 3300005295 Unclassified 823
14 Ga0065707_10429292 3300005295 Unclassified 822
15 Ga0070676_10178434 3300005328 Unclassified 1379
16 Ga0070676_10205425 3300005328 Unclassified 1293
17 Ga0070690_100020687 3300005330 Bacteria 4010
18 Ga0070670_100130876 3300005331 Unclassified 2167
19 Ga0070670_100570215 3300005331 Unclassified 1011
20 Ga0068869_100847170 3300005334 Unclassified 788
21 Ga0070680_100174564 3300005336 Bacteria 1809
22 Ga0070682_100108876 3300005337 Bacteria 1843
23 Ga0068868_100104479 3300005338 Bacteria 2296
24 Ga0068868_100209047 3300005338 Unclassified 1630
25 Ga0070689_100022087 3300005340 Bacteria 4748
26 Ga0070689_100058661 3300005340 Bacteria 2989
27 Ga0070689_100085082 3300005340 Unclassified 2486
28 Ga0070691_10063214 3300005341 Bacteria 1784
29 Ga0070687_100035869 3300005343 Bacteria 2467
30 Ga0070661_100057959 3300005344 Unclassified 2838
31 Ga0070661_100368891 3300005344 Bacteria 1130
32 Ga0070692_10007229 3300005345 Bacteria 4880
33 Ga0070692_10109199 3300005345 Bacteria 1528
34 Ga0070668_100137096 3300005347 Unclassified 1969
35 Ga0070669_100004798 3300005353 Bacteria 9756
36 Ga0070669_100435599 3300005353 Bacteria 1078
37 Ga0070675_100002398 3300005354 Bacteria 13975
38 Ga0070671_100006428 3300005355 Bacteria 9389
39 Ga0070674_100268116 3300005356 Unclassified 1348
40 Ga0070674_100294772 3300005356 Bacteria 1291
41 Ga0070674_100543612 3300005356 Bacteria 974
42 Ga0070674_100710257 3300005356 Unclassified 860
43 Ga0070673_100077793 3300005364 Bacteria 2681
44 Ga0070673_100571016 3300005364 Unclassified 1029
45 Ga0070673_100772591 3300005364 Unclassified 886
46 Ga0070688_100010527 3300005365 Bacteria 5104
47 Ga0070688_100055742 3300005365 Unclassified 2480
48 Ga0070659_100665098 3300005366 Bacteria 899
49 Ga0070667_100123120 3300005367 Bacteria 2258
50 Ga0070667_100468711 3300005367 Unclassified 1152
51 Ga0070701_10020241 3300005438 Unclassified 3157
52 Ga0070701_10119492 3300005438 Bacteria 1483
53 Ga0070705_100000125 3300005440 Bacteria 44753
54 Ga0070705_100025384 3300005440 Bacteria 3213
55 Ga0070705_100104548 3300005440 Bacteria 1796
56 Ga0070705_100661836 3300005440 Bacteria 816
57 Ga0070700_100137018 3300005441 Unclassified 1659
58 Ga0070700_100295229 3300005441 Bacteria 1181
59 Ga0070694_100004729 3300005444 Bacteria 8200
60 Ga0070694_100020380 3300005444 Bacteria 4226
61 Ga0070694_100034355 3300005444 Bacteria 3343
62 Ga0070708_100623153 3300005445 Bacteria 1017
63 Ga0070663_100840165 3300005455 Bacteria 790
64 Ga0070678_100339050 3300005456 Unclassified 1289
65 Ga0070662_100022610 3300005457 Bacteria 4307
66 Ga0070662_100416055 3300005457 Unclassified 1111
67 Ga0070681_10006214 3300005458 Bacteria 11607
68 Ga0070681_10314404 3300005458 Bacteria 1475
69 Ga0068867_100119722 3300005459 Unclassified 2033
70 Ga0070685_10258093 3300005466 Bacteria 1158
71 Ga0070707_100038558 3300005468 Bacteria 4564
72 Ga0070707_100072617 3300005468 Bacteria 3317
73 Ga0070707_100090210 3300005468 Bacteria 2967
74 Ga0070707_100126847 3300005468 Bacteria 2480
75 Ga0070698_100000242 3300005471 Bacteria 54440
76 Ga0070698_100020255 3300005471 Bacteria 6973
77 Ga0070698_100593335 3300005471 Viruses 1048
78 Ga0070698_100756523 3300005471 Bacteria 915
79 Ga0070699_100001060 3300005518 Bacteria 25585
80 Ga0070699_100007907 3300005518 Bacteria 9240
81 Ga0070699_100027222 3300005518 Bacteria 4932
82 Ga0070699_100051456 3300005518 Bacteria 3566
83 Ga0070699_100139615 3300005518 Unclassified 2139
84 Ga0070684_100022961 3300005535 Bacteria 5210
85 Ga0070697_100005456 3300005536 Bacteria 9802
86 Ga0070697_100109493 3300005536 Bacteria 2300
87 Ga0070697_100463048 3300005536 Bacteria 1105
88 Ga0070672_100697591 3300005543 Bacteria 889
89 Ga0070695_100000021 3300005545 Bacteria 60669
90 Ga0070695_100012571 3300005545 Bacteria 5081
91 Ga0070695_100351849 3300005545 Bacteria 1104
92 Ga0070696_100000016 3300005546 Bacteria 76371
93 Ga0070696_100010605 3300005546 Bacteria 6171
94 Ga0070696_100016822 3300005546 Bacteria 4933
95 Ga0070696_100057018 3300005546 Bacteria 2726
96 Ga0070696_100167796 3300005546 Bacteria 1621
97 Ga0070704_100001183 3300005549 Bacteria 13643
98 Ga0070704_100003851 3300005549 Bacteria 8637
99 Ga0070704_100017691 3300005549 Bacteria 4540
100 Ga0070704_100019096 3300005549 Bacteria 4399
101 Ga0070704_100022908 3300005549 Bacteria 4070
102 Ga0070704_100237891 3300005549 Unclassified 1489
103 Ga0070704_100678159 3300005549 Bacteria 912
104 Ga0070704_101252024 3300005549 Unclassified 678
105 Ga0070664_100069819 3300005564 Bacteria 3007
106 Ga0070664_100325473 3300005564 Bacteria 1393
107 Ga0070664_100558204 3300005564 Unclassified 1059
108 Ga0068857_100109781 3300005577 Unclassified 2479
109 Ga0068857_100860289 3300005577 Bacteria 868
110 Ga0068854_100120899 3300005578 Unclassified 1988
111 Ga0070702_100032803 3300005615 Bacteria 2852
112 Ga0070702_100240293 3300005615 Unclassified 1222
113 Ga0070702_100660111 3300005615 Bacteria 792
114 Ga0068852_100055201 3300005616 Unclassified 3427
115 Ga0068859_100000721 3300005617 Bacteria 33291
116 Ga0068859_100013781 3300005617 Bacteria 8106
117 Ga0068859_100020163 3300005617 Bacteria 6694
118 Ga0068859_101602983 3300005617 Unclassified 719
119 Ga0068864_100048492 3300005618 Bacteria 3652
120 Ga0068864_100053735 3300005618 Unclassified 3476
121 Ga0068864_100174423 3300005618 Bacteria 1962
122 Ga0068864_100675572 3300005618 Unclassified 1007
123 Ga0068866_10025881 3300005718 Bacteria 2764
124 Ga0068861_100007407 3300005719 Bacteria 7519
125 Ga0068861_100090134 3300005719 Bacteria 2418
126 Ga0068861_100812910 3300005719 Bacteria 878
127 Ga0068851_10040953 3300005834 Bacteria 2329
128 Ga0068870_10021723 3300005840 Unclassified 3144
129 Ga0068863_100043962 3300005841 Bacteria 4240
130 Ga0068858_100108767 3300005842 Unclassified 2588
131 Ga0068860_100029155 3300005843 Bacteria 5308
132 Ga0068862_100009763 3300005844 Bacteria 7936
133 Ga0068862_100054249 3300005844 Bacteria 3432
134 Ga0068862_100659944 3300005844 Bacteria 1009
135 Ga0081455_10381926 3300005937 Unclassified 984
136 Ga0081539_10302656 3300005985 Unclassified 687
137 Ga0075432_10149668 3300006058 Bacteria 896
138 Ga0097621_100027232 3300006237 Bacteria 4493
139 Ga0097621_100590987 3300006237 Unclassified 1014
140 Ga0068871_100003951 3300006358 Bacteria 10232
141 Ga0075428_100000010 3300006844 Bacteria 213631
142 Ga0075428_100009372 3300006844 Bacteria 10860
143 Ga0075428_100011336 3300006844 Bacteria 9919
144 Ga0075428_100180674 3300006844 Bacteria 2284
145 Ga0075430_100033577 3300006846 Bacteria 4355
146 Ga0075430_100167577 3300006846 Bacteria 1827
147 Ga0075431_100168049 3300006847 Bacteria 2254
148 Ga0075431_100255017 3300006847 Bacteria 1781
149 Ga0075433_10010990 3300006852 Bacteria 7280
150 Ga0075433_10133701 3300006852 Bacteria 2204
151 Ga0075433_10166508 3300006852 Bacteria 1962
152 Ga0075433_10467183 3300006852 Bacteria 1112
153 Ga0075433_11073812 3300006852 Bacteria 700
154 Ga0075433_11163813 3300006852 Unclassified 670
155 Ga0075434_100012504 3300006871 Bacteria 8051
156 Ga0075434_100025200 3300006871 Bacteria 5820
157 Ga0075434_100067166 3300006871 Bacteria 3572
158 Ga0075434_100107311 3300006871 Bacteria 2803
159 Ga0075429_100028263 3300006880 Bacteria 4870
160 Ga0075429_100155916 3300006880 Unclassified 2000
161 Ga0068865_100043346 3300006881 Bacteria 3074
162 Ga0068865_100081131 3300006881 Bacteria 2328
163 Ga0068865_100095516 3300006881 Bacteria 2166
164 Ga0068865_100242862 3300006881 Bacteria 1418
165 Ga0075436_100442203 3300006914 Bacteria 946
166 Ga0097620_100000721 3300006931 Bacteria 33291
167 Ga0097620_100013781 3300006931 Bacteria 8106
168 Ga0097620_100020163 3300006931 Bacteria 6694
169 Ga0097620_101602822 3300006931 Unclassified 719
170 Ga0075435_100025254 3300007076 Bacteria 4623
171 Ga0075435_100076999 3300007076 Bacteria 2734
172 Ga0075435_100132069 3300007076 Bacteria 2090
173 Ga0075435_100176547 3300007076 Bacteria 1804
174 Ga0075435_100312059 3300007076 Bacteria 1346
175 Ga0111539_10000001 3300009094 Bacteria 1035431
176 Ga0111539_10018586 3300009094 Bacteria 8610
177 Ga0111539_10735738 3300009094 Unclassified 1148
178 Ga0105245_10217954 3300009098 Bacteria 1840
179 Ga0114129_10006983 3300009147 Bacteria 16069
180 Ga0114129_10006985 3300009147 Bacteria 16068
181 Ga0114129_10011851 3300009147 Bacteria 12401
182 Ga0114129_10016817 3300009147 Bacteria 10411
183 Ga0114129_10020054 3300009147 Bacteria 9514
184 Ga0114129_10036409 3300009147 Bacteria 6949
185 Ga0114129_10391467 3300009147 Bacteria 1833
186 Ga0114129_10507021 3300009147 Bacteria 1575
187 Ga0114129_10507584 3300009147 Bacteria 1574
188 Ga0105243_10121553 3300009148 Unclassified 2202
189 Ga0105243_10789697 3300009148 Unclassified 935
190 Ga0105243_11315921 3300009148 Unclassified 740
191 Ga0105241_10223942 3300009174 Bacteria 1582
192 Ga0105242_10069873 3300009176 Bacteria 2910
193 Ga0105242_10211152 3300009176 Unclassified 1730
194 Ga0105248_10694879 3300009177 Unclassified 1148
195 Ga0105249_10027807 3300009553 Bacteria 5104
196 Ga0105249_10329249 3300009553 Bacteria 1541
197 Ga0105249_10612218 3300009553 Bacteria 1144
198 Ga0157374_10006989 3300013296 Bacteria 9608
199 Ga0157378_10091908 3300013297 Unclassified 2760
200 Ga0163162_10025339 3300013306 Bacteria 5860
201 Ga0163162_10139983 3300013306 Bacteria 2532
202 Ga0157375_10000777 3300013308 Bacteria 27988
203 Ga0157375_10091589 3300013308 Bacteria 3102
204 Ga0157375_10340151 3300013308 Bacteria 1666
205 Ga0157375_11155815 3300013308 Bacteria 907
206 Ga0163163_10155290 3300014325 Unclassified 2333
207 Ga0157380_10099903 3300014326 Bacteria 2414
208 Ga0157380_10101397 3300014326 Bacteria 2398
209 Ga0157377_10399613 3300014745 Bacteria 935
210 Ga0157376_10667124 3300014969 Unclassified 1042
211 Ga0163161_10034481 3300017792 Bacteria 3622
212 Ga0207642_10024218 3300025899 Bacteria 2438
213 Ga0207643_10027697 3300025908 Unclassified 3143
214 Ga0207643_10149562 3300025908 Unclassified 1399
215 Ga0207684_10300697 3300025910 Bacteria 1383
216 Ga0207654_10268601 3300025911 Bacteria 1150
217 Ga0207660_10082313 3300025917 Bacteria 2368
218 Ga0207660_10299183 3300025917 Bacteria 1281
219 Ga0207662_10009922 3300025918 Bacteria 5254
220 Ga0207649_10303791 3300025920 Bacteria 1167
221 Ga0207646_10079712 3300025922 Bacteria 2928
222 Ga0207646_10088977 3300025922 Bacteria 2764
223 Ga0207646_10169463 3300025922 Unclassified 1972
224 Ga0207646_10206366 3300025922 Bacteria 1775
225 Ga0207646_10424957 3300025922 Unclassified 1199
226 Ga0207681_10002488 3300025923 Bacteria 11698
227 Ga0207681_10395056 3300025923 Unclassified 1116
228 Ga0207681_10715861 3300025923 Bacteria 833
229 Ga0207650_10144038 3300025925 Bacteria 1876
230 Ga0207659_10001091 3300025926 Bacteria 16086
231 Ga0207659_10013832 3300025926 Bacteria 5186
232 Ga0207644_10280001 3300025931 Bacteria 1339
233 Ga0207706_10040164 3300025933 Bacteria 4147
234 Ga0207706_10143559 3300025933 Unclassified 2100
235 Ga0207686_10107797 3300025934 Bacteria 1873
236 Ga0207709_10028548 3300025935 Bacteria 3226
237 Ga0207709_10314434 3300025935 Unclassified 1170
238 Ga0207709_10534226 3300025935 Bacteria 920
239 Ga0207670_10003638 3300025936 Bacteria 8181
240 Ga0207670_10014356 3300025936 Bacteria 4700
241 Ga0207670_10081184 3300025936 Bacteria 2269
242 Ga0207669_10797614 3300025937 Bacteria 783
243 Ga0207704_10035458 3300025938 Unclassified 2859
244 Ga0207704_10044461 3300025938 Unclassified 2631
245 Ga0207704_10057058 3300025938 Unclassified 2396
246 Ga0207691_10023098 3300025940 Bacteria 5857
247 Ga0207691_10052047 3300025940 Bacteria 3741
248 Ga0207691_10504760 3300025940 Bacteria 1027
249 Ga0207711_10188952 3300025941 Unclassified 1876
250 Ga0207711_10205916 3300025941 Unclassified 1796
251 Ga0207689_10301114 3300025942 Unclassified 1329
252 Ga0207679_10033541 3300025945 Bacteria 3613
253 Ga0207679_10643500 3300025945 Bacteria 958
254 Ga0207667_10357271 3300025949 Unclassified 1490
255 Ga0207651_10141798 3300025960 Bacteria 1857
256 Ga0207651_10714168 3300025960 Bacteria 884
257 Ga0207651_10741880 3300025960 Unclassified 867
258 Ga0207712_10094536 3300025961 Archaea 2208
259 Ga0207712_10280543 3300025961 Bacteria 1360
260 Ga0207668_10352381 3300025972 Bacteria 1231
261 Ga0207640_10150932 3300025981 Bacteria 1707
262 Ga0207640_10295703 3300025981 Bacteria 1279
263 Ga0207658_10412909 3300025986 Unclassified 1189
264 Ga0207677_10157810 3300026023 Unclassified 1759
265 Ga0207677_10199025 3300026023 Bacteria 1591
266 Ga0207703_10124930 3300026035 Unclassified 2214
267 Ga0207678_10185329 3300026067 Bacteria 1777
268 Ga0207708_10226089 3300026075 Unclassified 1501
269 Ga0207708_10234314 3300026075 Unclassified 1475
270 Ga0207641_10412408 3300026088 Unclassified 1299
271 Ga0207648_10001011 3300026089 Bacteria 31668
272 Ga0207648_10195768 3300026089 Bacteria 1792
273 Ga0207648_10320837 3300026089 Unclassified 1392
274 Ga0207676_10046198 3300026095 Unclassified 3368
275 Ga0207676_10229267 3300026095 Bacteria 1659
276 Ga0207676_10390960 3300026095 Bacteria 1297
277 Ga0207676_10419832 3300026095 Bacteria 1254
278 Ga0207674_10054171 3300026116 Bacteria 4085
279 Ga0207674_10060946 3300026116 Bacteria 3813
280 Ga0207674_10566467 3300026116 Bacteria 1097
281 Ga0207675_100005301 3300026118 Bacteria 12398
282 Ga0207675_100675955 3300026118 Bacteria 1040
283 Ga0207683_10441146 3300026121 Unclassified 1200
284 Ga0207698_10184052 3300026142 Bacteria 1854
285 Ga0207428_10000002 3300027907 Bacteria 854851
286 Ga0207428_10002908 3300027907 Bacteria 16974
287 Ga0207428_10088946 3300027907 Bacteria 2401
288 Ga0268265_10000906 3300028380 Bacteria 27450
289 Ga0268265_10069003 3300028380 Bacteria 2744
290 Ga0268264_10012920 3300028381 Bacteria 6865
291 Ga0307408_100237486 3300031548 Unclassified 1496
292 Ga0307410_10511177 3300031852 Bacteria 990
293 Ga0307416_100009635 3300032002 Bacteria 6336
294 Ga0373934_0093783 3300035086 Bacteria 1211
295 Ga0373955_0295259 3300035172 Unclassified 977
296 Ga0373961_0133178 3300035241 Bacteria 834
297 Ga0373947_0596279 3300035725 Unclassified 753
298 Ga0373937_0040057 3300036401 Bacteria 4271
299 Ga0373925_0305183 3300037068 Bacteria 1286
300 Ga0395900_1175472 3300037418 Bacteria 683
301 Ga0395905_0599133 3300037471 Unclassified 1004
302 Ga0450908_058231 3300042184 Unclassified 677
303 Ga0439435_0001972 3300042436 Unclassified 3956
304 Ga0451577_0361901 3300042876 Unclassified 1316
305 Ga0453684_1648373 3300044712 Unclassified 657
306 Ga0451576_0047213 3300045051 Unclassified 4528
307 Ga0451576_0122732 3300045051 Bacteria 2705
308 Ga0451576_0215216 3300045051 Bacteria 2006
309 Ga0451576_0358285 3300045051 Bacteria 1527
310 Ga0495592_0386204 3300046454 Bacteria 890
311 Ga0495603_0034919 3300046455 Bacteria 3022
312 Ga0495629_0815867 3300046459 Unclassified 615
313 Ga0495584_0116215 3300046491 Bacteria 1354
314 Ga0495584_0267952 3300046491 Bacteria 868
315 Ga0495584_0387255 3300046491 Unclassified 710
316 Ga0495594_0127039 3300046499 Unclassified 1443
317 Ga0495608_0273242 3300046511 Unclassified 1050
318 Ga0495663_0024559 3300046525 Bacteria 1753
319 Ga0495663_0222401 3300046525 Unclassified 664
320 Ga0495642_0010208 3300046528 Bacteria 3597
321 Ga0495642_0143397 3300046528 Bacteria 1031
322 Ga0495598_0013456 3300046537 Unclassified 2028
323 Ga0495609_0047169 3300046538 Bacteria 1928
324 Ga0495609_0053546 3300046538 Bacteria 1794
325 Ga0495621_0006640 3300046539 Bacteria 3388
326 Ga0495621_0019773 3300046539 Unclassified 2202
327 Ga0495621_0126849 3300046539 Unclassified 990
328 Ga0495621_0188221 3300046539 Unclassified 826
329 Ga0495645_0175674 3300046543 Bacteria 1471
330 Ga0495659_0045448 3300046664 Bacteria 1582
331 Ga0495659_0050220 3300046664 Bacteria 1517
332 Ga0495659_0092586 3300046664 Unclassified 1162
333 Ga0495659_0093875 3300046664 Unclassified 1155
334 Ga0495659_0102464 3300046664 Bacteria 1110
335 Ga0495658_0042609 3300046683 Unclassified 2535
336 Ga0495669_0050016 3300046684 Bacteria 1873
337 Ga0495669_0076304 3300046684 Viruses 1534
338 Ga0495670_0250251 3300046691 Unclassified 945
339 Ga0495600_0351421 3300046809 Unclassified 923
340 Ga0495604_0232798 3300047317 Unclassified 1263
341 Ga0495636_0115321 3300047318 Bacteria 1185
342 Ga0495674_0092809 3300047319 Bacteria 2577
343 Ga0495676_0122926 3300047321 Unclassified 1885
344 Ga0495677_0013520 3300047445 Unclassified 2972
345 Ga0495685_023779 3300047447 Bacteria 2110
346 Ga0495593_0264284 3300047673 Unclassified 861
347 Ga0496101_0151171 3300048904 Bacteria 1776
348 Ga0496104_0775523 3300048907 Unclassified 865
349 Ga0496108_0216633 3300048911 Bacteria 1663
350 Ga0496109_0048195 3300048912 Unclassified 3877
351 Ga0496110_0088608 3300048913 Unclassified 2764
352 Ga0496110_1078621 3300048913 Unclassified 711
353 Ga0496112_0100494 3300048915 Bacteria 2862
354 Ga0496112_0285535 3300048915 Bacteria 1597
355 Ga0496114_0010157 3300048917 Bacteria 7490
356 Ga0496114_0026186 3300048917 Bacteria 4773
357 Ga0501031_0080573 3300049568 Bacteria 2122
358 Ga0501032_0172312 3300049569 Unclassified 1419
359 Ga0501036_0091952 3300049572 Unclassified 2563
360 Ga0501037_0551140 3300049573 Bacteria 778
361 Ga0501039_0130102 3300049575 Unclassified 1975
362 Ga0501040_0046203 3300049576 Bacteria 2972
363 Ga0501042_0136678 3300049578 Bacteria 1767
364 Ga0501043_0492393 3300049579 Bacteria 917
365 Ga0501047_0078434 3300049581 Bacteria 3176
366 Ga0501071_0279059 3300049587 Bacteria 1264
367 Ga0501071_0548244 3300049587 Unclassified 888
368 Ga0501072_0040195 3300049588 Bacteria 3672
369 Ga0501072_0155038 3300049588 Unclassified 1826
370 Ga0501072_0373340 3300049588 Bacteria 1132
371 Ga0501074_0178538 3300049590 Bacteria 1515
372 Ga0501075_0052316 3300049591 Bacteria 3071
373 Ga0501075_0120055 3300049591 Bacteria 2000
374 Ga0501076_0046455 3300049592 Bacteria 3431
375 Ga0501076_0116640 3300049592 Bacteria 2161
376 Ga0501081_0047212 3300049743 Bacteria 2963
377 Ga0501081_0243446 3300049743 Unclassified 1312
378 Ga0501083_0284577 3300049744 Bacteria 1075
379 Ga0501045_0069958 3300049824 Bacteria 2581
380 nmdc:mga05p37_1592_c1 3300050507 Bacteria 26358
381 nmdc:mga05p37_23007_c1 3300050507 Bacteria 7560
382 nmdc:mga05p37_27447_c1 3300050507 Bacteria 6931
383 nmdc:mga05p37_27710_c1 3300050507 Bacteria 6902
384 nmdc:mga05p37_316247_c1 3300050507 Unclassified 1849
385 nmdc:mga05p37_391941_c1 3300050507 Bacteria 1624
386 nmdc:mga05p37_39340_c1 3300050507 Bacteria 5806
387 nmdc:mga05p37_410897_c1 3300050507 Bacteria 1578
388 nmdc:mga05p37_601104_c1 3300050507 Bacteria 1242
389 nmdc:mga09592_1131071_c1 3300050508 Unclassified 650
390 nmdc:mga09592_221296_c1 3300050508 Unclassified 1640
391 nmdc:mga09592_99447_c1 3300050508 Unclassified 2490
392 nmdc:mga0qj67_38320_c1 3300050509 Bacteria 3760
393 nmdc:mga06r32_259864_c1 3300050510 Bacteria 1724
394 nmdc:mga08y16_1245508_c1 3300050511 Unclassified 713
395 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
396 nmdc:mga08y16_6975_c1 3300050511 Bacteria 11847
397 nmdc:mga0n895_1014607_c1 3300050512 Bacteria 810
398 nmdc:mga0n895_108591_c1 3300050512 Bacteria 2789
399 nmdc:mga0n895_1123345_c1 3300050512 Bacteria 762
400 nmdc:mga0n895_120270_c1 3300050512 Bacteria 2648
401 nmdc:mga0n895_17522_c1 3300050512 Bacteria 6603
402 nmdc:mga0n895_230516_c1 3300050512 Bacteria 1880
403 nmdc:mga0n895_386112_c1 3300050512 Bacteria 1417
404 nmdc:mga0n895_9525_c1 3300050512 Bacteria 8504
405 nmdc:mga0rr50_125588_c1 3300050513 Bacteria 2048
406 nmdc:mga0rr50_161678_c1 3300050513 Bacteria 1818
407 nmdc:mga0rr50_32667_c1 3300050513 Bacteria 3711
408 nmdc:mga0rr50_552567_c1 3300050513 Unclassified 980
409 nmdc:mga0rr50_87738_c1 3300050513 Unclassified 2415
410 nmdc:mga08x19_522201_c1 3300050514 Bacteria 839
411 nmdc:mga0a205_168759_c2 3300050515 Bacteria 1726
412 nmdc:mga0a205_18224_c1 3300050515 Bacteria 6596
413 nmdc:mga0a205_320441_c1 3300050515 Bacteria 1421
414 nmdc:mga0a205_33295_c1 3300050515 Bacteria 4941
415 nmdc:mga0a205_417095_c1 3300050515 Bacteria 1205
416 nmdc:mga0a205_885543_c1 3300050515 Bacteria 740
417 nmdc:mga0a205_905541_c1 3300050515 Bacteria 729
418 Ga0495601_0172254 3300053077 Bacteria 1415
419 Ga0495612_0041626 3300053078 Unclassified 1874
420 Ga0495595_0006400 3300053084 Bacteria 4802
421 Ga0500562_116506 3300053108 Bacteria 728
422 Ga0501084_0040387 3300054114 Bacteria 3903
423 Ga0501084_1151465 3300054114 Bacteria 651
424 Ga0501082_0041558 3300060353 Bacteria 3964
425 Ga0501082_0859025 3300060353 Unclassified 794
426 Ga0530510_0008981 3300061734 Bacteria 7004
427 Ga0501067_0106732
428 SwRhRL3b_contig_1512519
429 SwRhRL3b_contig_3917105
430 JGI24749J21850_1029907
431 Ga0065704_10008978
432 Ga0065712_10146815
433 Ga0065712_10260544
434 Ga0065712_10303330
435 Ga0065715_10090882
436 Ga0065715_10107302
437 Ga0065707_10015516
438 Ga0065707_10015927
439 Ga0065707_10428106
440 Ga0065707_10429292
441 Ga0070676_10178434
442 Ga0070676_10205425
443 Ga0070690_100020687
444 Ga0070670_100130876
445 Ga0070670_100570215
446 Ga0068869_100847170
447 Ga0070680_100174564
448 Ga0070682_100108876
449 Ga0068868_100104479
450 Ga0068868_100209047
451 Ga0070689_100022087
452 Ga0070689_100058661
453 Ga0070689_100085082
454 Ga0070691_10063214
455 Ga0070687_100035869
456 Ga0070661_100057959
457 Ga0070661_100368891
458 Ga0070692_10007229
459 Ga0070692_10109199
460 Ga0070668_100137096
461 Ga0070669_100004798
462 Ga0070669_100435599
463 Ga0070675_100002398
464 Ga0070671_100006428
465 Ga0070674_100268116
466 Ga0070674_100294772
467 Ga0070674_100543612
468 Ga0070674_100710257
469 Ga0070673_100077793
470 Ga0070673_100571016
471 Ga0070673_100772591
472 Ga0070688_100010527
473 Ga0070688_100055742
474 Ga0070659_100665098
475 Ga0070667_100123120
476 Ga0070667_100468711
477 Ga0070701_10020241
478 Ga0070701_10119492
479 Ga0070705_100000125
480 Ga0070705_100025384
481 Ga0070705_100104548
482 Ga0070705_100661836
483 Ga0070700_100137018
484 Ga0070700_100295229
485 Ga0070694_100004729
486 Ga0070694_100020380
487 Ga0070694_100034355
488 Ga0070708_100623153
489 Ga0070663_100840165
490 Ga0070678_100339050
491 Ga0070662_100022610
492 Ga0070662_100416055
493 Ga0070681_10006214
494 Ga0070681_10314404
495 Ga0068867_100119722
496 Ga0070685_10258093
497 Ga0070707_100038558
498 Ga0070707_100072617
499 Ga0070707_100090210
500 Ga0070707_100126847
501 Ga0070698_100000242
502 Ga0070698_100020255
503 Ga0070698_100593335
504 Ga0070698_100756523
505 Ga0070699_100001060
506 Ga0070699_100007907
507 Ga0070699_100027222
508 Ga0070699_100051456
509 Ga0070699_100139615
510 Ga0070684_100022961
511 Ga0070697_100005456
512 Ga0070697_100109493
513 Ga0070697_100463048
514 Ga0070672_100697591
515 Ga0070695_100000021
516 Ga0070695_100012571
517 Ga0070695_100351849
518 Ga0070696_100000016
519 Ga0070696_100010605
520 Ga0070696_100016822
521 Ga0070696_100057018
522 Ga0070696_100167796
523 Ga0070704_100001183
524 Ga0070704_100003851
525 Ga0070704_100017691
526 Ga0070704_100019096
527 Ga0070704_100022908
528 Ga0070704_100237891
529 Ga0070704_100678159
530 Ga0070704_101252024
531 Ga0070664_100069819
532 Ga0070664_100325473
533 Ga0070664_100558204
534 Ga0068857_100109781
535 Ga0068857_100860289
536 Ga0068854_100120899
537 Ga0070702_100032803
538 Ga0070702_100240293
539 Ga0070702_100660111
540 Ga0068852_100055201
541 Ga0068859_100000721
542 Ga0068859_100013781
543 Ga0068859_100020163
544 Ga0068859_101602983
545 Ga0068864_100048492
546 Ga0068864_100053735
547 Ga0068864_100174423
548 Ga0068864_100675572
549 Ga0068866_10025881
550 Ga0068861_100007407
551 Ga0068861_100090134
552 Ga0068861_100812910
553 Ga0068851_10040953
554 Ga0068870_10021723
555 Ga0068863_100043962
556 Ga0068858_100108767
557 Ga0068860_100029155
558 Ga0068862_100009763
559 Ga0068862_100054249
560 Ga0068862_100659944
561 Ga0081455_10381926
562 Ga0081539_10302656
563 Ga0075432_10149668
564 Ga0097621_100027232
565 Ga0097621_100590987
566 Ga0068871_100003951
567 Ga0075428_100000010
568 Ga0075428_100009372
569 Ga0075428_100011336
570 Ga0075428_100180674
571 Ga0075430_100033577
572 Ga0075430_100167577
573 Ga0075431_100168049
574 Ga0075431_100255017
575 Ga0075433_10010990
576 Ga0075433_10133701
577 Ga0075433_10166508
578 Ga0075433_10467183
579 Ga0075433_11073812
580 Ga0075433_11163813
581 Ga0075434_100012504
582 Ga0075434_100025200
583 Ga0075434_100067166
584 Ga0075434_100107311
585 Ga0075429_100028263
586 Ga0075429_100155916
587 Ga0068865_100043346
588 Ga0068865_100081131
589 Ga0068865_100095516
590 Ga0068865_100242862
591 Ga0075436_100442203
592 Ga0097620_100000721
593 Ga0097620_100013781
594 Ga0097620_100020163
595 Ga0097620_101602822
596 Ga0075435_100025254
597 Ga0075435_100076999
598 Ga0075435_100132069
599 Ga0075435_100176547
600 Ga0075435_100312059
601 Ga0111539_10000001
602 Ga0111539_10018586
603 Ga0111539_10735738
604 Ga0105245_10217954
605 Ga0114129_10006983
606 Ga0114129_10006985
607 Ga0114129_10011851
608 Ga0114129_10016817
609 Ga0114129_10020054
610 Ga0114129_10036409
611 Ga0114129_10391467
612 Ga0114129_10507021
613 Ga0114129_10507584
614 Ga0105243_10121553
615 Ga0105243_10789697
616 Ga0105243_11315921
617 Ga0105241_10223942
618 Ga0105242_10069873
619 Ga0105242_10211152
620 Ga0105248_10694879
621 Ga0105249_10027807
622 Ga0105249_10329249
623 Ga0105249_10612218
624 Ga0157374_10006989
625 Ga0157378_10091908
626 Ga0163162_10025339
627 Ga0163162_10139983
628 Ga0157375_10000777
629 Ga0157375_10091589
630 Ga0157375_10340151
631 Ga0157375_11155815
632 Ga0163163_10155290
633 Ga0157380_10099903
634 Ga0157380_10101397
635 Ga0157377_10399613
636 Ga0157376_10667124
637 Ga0163161_10034481
638 Ga0207642_10024218
639 Ga0207643_10027697
640 Ga0207643_10149562
641 Ga0207684_10300697
642 Ga0207654_10268601
643 Ga0207660_10082313
644 Ga0207660_10299183
645 Ga0207662_10009922
646 Ga0207649_10303791
647 Ga0207646_10079712
648 Ga0207646_10088977
649 Ga0207646_10169463
650 Ga0207646_10206366
651 Ga0207646_10424957
652 Ga0207681_10002488
653 Ga0207681_10395056
654 Ga0207681_10715861
655 Ga0207650_10144038
656 Ga0207659_10001091
657 Ga0207659_10013832
658 Ga0207644_10280001
659 Ga0207706_10040164
660 Ga0207706_10143559
661 Ga0207686_10107797
662 Ga0207709_10028548
663 Ga0207709_10314434
664 Ga0207709_10534226
665 Ga0207670_10003638
666 Ga0207670_10014356
667 Ga0207670_10081184
668 Ga0207669_10797614
669 Ga0207704_10035458
670 Ga0207704_10044461
671 Ga0207704_10057058
672 Ga0207691_10023098
673 Ga0207691_10052047
674 Ga0207691_10504760
675 Ga0207711_10188952
676 Ga0207711_10205916
677 Ga0207689_10301114
678 Ga0207679_10033541
679 Ga0207679_10643500
680 Ga0207667_10357271
681 Ga0207651_10141798
682 Ga0207651_10714168
683 Ga0207651_10741880
684 Ga0207712_10094536
685 Ga0207712_10280543
686 Ga0207668_10352381
687 Ga0207640_10150932
688 Ga0207640_10295703
689 Ga0207658_10412909
690 Ga0207677_10157810
691 Ga0207677_10199025
692 Ga0207703_10124930
693 Ga0207678_10185329
694 Ga0207708_10226089
695 Ga0207708_10234314
696 Ga0207641_10412408
697 Ga0207648_10001011
698 Ga0207648_10195768
699 Ga0207648_10320837
700 Ga0207676_10046198
701 Ga0207676_10229267
702 Ga0207676_10390960
703 Ga0207676_10419832
704 Ga0207674_10054171
705 Ga0207674_10060946
706 Ga0207674_10566467
707 Ga0207675_100005301
708 Ga0207675_100675955
709 Ga0207683_10441146
710 Ga0207698_10184052
711 Ga0207428_10000002
712 Ga0207428_10002908
713 Ga0207428_10088946
714 Ga0268265_10000906
715 Ga0268265_10069003
716 Ga0268264_10012920
717 Ga0307408_100237486
718 Ga0307410_10511177
719 Ga0307416_100009635
720 Ga0373934_0093783
721 Ga0373955_0295259
722 Ga0373961_0133178
723 Ga0373947_0596279
724 Ga0373937_0040057
725 Ga0373925_0305183
726 Ga0395900_1175472
727 Ga0395905_0599133
728 Ga0450908_058231
729 Ga0439435_0001972
730 Ga0451577_0361901
731 Ga0453684_1648373
732 Ga0451576_0047213
733 Ga0451576_0122732
734 Ga0451576_0215216
735 Ga0451576_0358285
736 Ga0495592_0386204
737 Ga0495603_0034919
738 Ga0495629_0815867
739 Ga0495584_0116215
740 Ga0495584_0267952
741 Ga0495584_0387255
742 Ga0495594_0127039
743 Ga0495608_0273242
744 Ga0495663_0024559
745 Ga0495663_0222401
746 Ga0495642_0010208
747 Ga0495642_0143397
748 Ga0495598_0013456
749 Ga0495609_0047169
750 Ga0495609_0053546
751 Ga0495621_0006640
752 Ga0495621_0019773
753 Ga0495621_0126849
754 Ga0495621_0188221
755 Ga0495645_0175674
756 Ga0495659_0045448
757 Ga0495659_0050220
758 Ga0495659_0092586
759 Ga0495659_0093875
760 Ga0495659_0102464
761 Ga0495658_0042609
762 Ga0495669_0050016
763 Ga0495669_0076304
764 Ga0495670_0250251
765 Ga0495600_0351421
766 Ga0495604_0232798
767 Ga0495636_0115321
768 Ga0495674_0092809
769 Ga0495676_0122926
770 Ga0495677_0013520
771 Ga0495685_023779
772 Ga0495593_0264284
773 Ga0496101_0151171
774 Ga0496104_0775523
775 Ga0496108_0216633
776 Ga0496109_0048195
777 Ga0496110_0088608
778 Ga0496110_1078621
779 Ga0496112_0100494
780 Ga0496112_0285535
781 Ga0496114_0010157
782 Ga0496114_0026186
783 Ga0501031_0080573
784 Ga0501032_0172312
785 Ga0501036_0091952
786 Ga0501037_0551140
787 Ga0501039_0130102
788 Ga0501040_0046203
789 Ga0501042_0136678
790 Ga0501043_0492393
791 Ga0501047_0078434
792 Ga0501071_0279059
793 Ga0501071_0548244
794 Ga0501072_0040195
795 Ga0501072_0155038
796 Ga0501072_0373340
797 Ga0501074_0178538
798 Ga0501075_0052316
799 Ga0501075_0120055
800 Ga0501076_0046455
801 Ga0501076_0116640
802 Ga0501081_0047212
803 Ga0501081_0243446
804 Ga0501083_0284577
805 Ga0501045_0069958
806 nmdc:mga05p37_1592_c1
807 nmdc:mga05p37_23007_c1
808 nmdc:mga05p37_27447_c1
809 nmdc:mga05p37_27710_c1
810 nmdc:mga05p37_316247_c1
811 nmdc:mga05p37_391941_c1
812 nmdc:mga05p37_39340_c1
813 nmdc:mga05p37_410897_c1
814 nmdc:mga05p37_601104_c1
815 nmdc:mga09592_1131071_c1
816 nmdc:mga09592_221296_c1
817 nmdc:mga09592_99447_c1
818 nmdc:mga0qj67_38320_c1
819 nmdc:mga06r32_259864_c1
820 nmdc:mga08y16_1245508_c1
821 nmdc:mga08y16_3_c1
822 nmdc:mga08y16_6975_c1
823 nmdc:mga0n895_1014607_c1
824 nmdc:mga0n895_108591_c1
825 nmdc:mga0n895_1123345_c1
826 nmdc:mga0n895_120270_c1
827 nmdc:mga0n895_17522_c1
828 nmdc:mga0n895_230516_c1
829 nmdc:mga0n895_386112_c1
830 nmdc:mga0n895_9525_c1
831 nmdc:mga0rr50_125588_c1
832 nmdc:mga0rr50_161678_c1
833 nmdc:mga0rr50_32667_c1
834 nmdc:mga0rr50_552567_c1
835 nmdc:mga0rr50_87738_c1
836 nmdc:mga08x19_522201_c1
837 nmdc:mga0a205_168759_c2
838 nmdc:mga0a205_18224_c1
839 nmdc:mga0a205_320441_c1
840 nmdc:mga0a205_33295_c1
841 nmdc:mga0a205_417095_c1
842 nmdc:mga0a205_885543_c1
843 nmdc:mga0a205_905541_c1
844 Ga0495601_0172254
845 Ga0495612_0041626
846 Ga0495595_0006400
847 Ga0500562_116506
848 Ga0501084_0040387
849 Ga0501084_1151465
850 Ga0501082_0041558
851 Ga0501082_0859025
852 Ga0530510_0008981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wmt-assembly1.cif.gz_C f. tularensis rnaps70-(mgla-sspa)-ppgpp-pigr-igla dna complex 0.8212 36 64
6wmr-assembly1.cif.gz_C f. tularensis rnaps70-(mgla-sspa)-igla dna complex 0.792 36 64
8syi-assembly1.cif.gz_C cyanobacterial rnap-ec 0.7671 36 64
8gzh-assembly1.cif.gz_C cryo-em structure of synechocystis sp. pcc 6803 ctp-bound rpitc 0.7661 36 64
1zle-assembly3.cif.gz_C crystal structure of a rgd-containing host-selective toxin: pyrenophora tritici-repentis ptr toxa 0.7299 36 67
ID Description Score Start End Superfamily
af_A1Z7F1_512_601_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8265 36 66 2.60.40.1180
af_Q5N9R6_457_606_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7783 36 65 2.130.10.10
af_P47107_732_1038_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7611 36 65 2.130.10.10
1zleC00 Mainly Beta;Sandwich;Immunoglobulin-like;Proteinaceous host-selective toxin ToxA 0.7299 36 67 2.60.40.1920
1nycB00 Mainly Beta;Beta Barrel;Staphostatins;beta-Barrel protease inhibitors 0.7299 36 67 2.40.310.10
ID Description Score Start End GO Terms
AF-A0A3D2AYC3-F1-model_v4 Uncharacterized protein 0.9689 36 166
AF-A0A3N5P7W8-F1-model_v4 Uncharacterized protein 0.9649 1 167
AF-A0A3N5P7W8-F1-model_v4 Uncharacterized protein 0.9591 1 167
AF-A0A1F2RA44-F1-model_v4 Uncharacterized protein 0.9529 4 166
AF-A0A7C7BYN5-F1-model_v4 Uncharacterized protein 0.9382 2 166

Map