F441279

General Info

Members Datasets Scaffolds Average Seq Length
426 257 415 497

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0006322|Ga0495625_0006322_7170_8951
Length 593
Sequence MHADVAGQDLAPDVIPGSIFEFRHLCPKWPLCVKTSARGTLPALGKSKLRRPGGWAEATRSPDSVSYGPSPHSRLPTRGNRMMNQQPPAAGRMPRQIPYIIANEGCERFSFYGMRNILTVFLMTSLLLSIPEQMRKDEAKEIFHTFVIGVYFFPLLGGWIADRWFGKYPTILWLSLVYCAGHACLALFDTNLHGFYLGLFLIALGSGGIKPLVSSFVGDQFDKSNRSLAQKVFEAFYWIINLGSFFASLFMPLILKQFGGAVAFGIPGVFMFIATAIFWSARHRYVHVKPAAHEDPNSFLKVVRTALSQGAAGRAVAFVGLALAGVALAFWNDLGVVAALCTALVLVIGFGGAGAWMALDRATPKHGAEAVAAVRSVLRLLVLFGLVTPFWSLFDQKASTWVLQADQMTKPAWFQSSMMQALNPALVLILIPFNKVVLYPLLERLGVRLTALRRMGAGIAFAGAAWIVVGLMQLWLDGGQRVDIVWQVLPYALLTLGEVLVSTTGLEFAYSQAPMAMKGVIMSFWSLSVTVGNLWVLLSNVSVRSGAVTSRIAGTGLSVTAFQMFFFAGFALLAALAFALYARRYQVRDYYRG

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2643221656 Pelomonas sp. Root405 Isolate Unclassified
6 2738541337 Pelomonas sp. BT06 Isolate Unclassified
7 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
8 2831864461 Roseateles noduli HZ7 Isolate Nodule
9 2919404418 Luteibacter sp. 3190 Isolate Unclassified
10 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
11 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
12 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
212 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
213 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
214 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
215 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
216 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
217 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 0.47
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 0.7
Rhizoplane 2.58
Rhizosphere 82.16
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000032 3300000545 Bacteria 29092
2 JGI24741J21665_1001160 3300001915 Bacteria 7779
3 JGI24740J21852_10000202 3300001979 Bacteria 24620
4 JGI24740J21852_10000830 3300001979 Bacteria 13620
5 JGI24749J21850_1002939 3300002076 Bacteria 2386
6 JGI25156J39149_1000151 3300002705 Bacteria 51549
7 JGI25154J39366_1000572 3300002738 Bacteria 18034
8 JGI25157J39369_1000193 3300002741 Bacteria 51549
9 rootH2_10039996 3300003320 Bacteria 9250
10 rootL2_10005556 3300003322 Bacteria 16405
11 rootH1_10047019 3300003323 Bacteria 4382
12 JGI25404J52841_10003484 3300003659 Bacteria 3114
13 Ga0055539_1000198 3300003752 Bacteria 48821
14 Ga0055539_1000446 3300003752 Bacteria 14269
15 Ga0055533_1000008 3300003756 Bacteria 575861
16 Ga0055525_1000004 3300003759 Bacteria 888039
17 Ga0055525_1000951 3300003759 Bacteria 7945
18 Ga0055526_1000020 3300003771 Bacteria 188230
19 Ga0055524_1000015 3300003775 Bacteria 246493
20 Ga0055524_1002112 3300003775 Bacteria 10500
21 Ga0055531_10000007 3300003794 Bacteria 225289
22 Ga0055531_10007415 3300003794 Bacteria 5996
23 Ga0055531_10011074 3300003794 Bacteria 4401
24 Ga0055543_1004356 3300004625 Bacteria 3885
25 Ga0065165_1000016 3300005262 Bacteria 286248
26 Ga0065165_1000942 3300005262 Bacteria 37104
27 Ga0070658_10000164 3300005327 Bacteria 57701
28 Ga0070658_10053486 3300005327 Bacteria 3277
29 Ga0070658_10119801 3300005327 Bacteria 2186
30 Ga0070658_10155577 3300005327 Bacteria 1916
31 Ga0070676_10000013 3300005328 Bacteria 56019
32 Ga0070683_100007772 3300005329 Bacteria 9081
33 Ga0070683_100028377 3300005329 Bacteria 5057
34 Ga0070683_100132941 3300005329 Bacteria 2355
35 Ga0070690_100000013 3300005330 Bacteria 89224
36 Ga0070670_100001325 3300005331 Bacteria 19780
37 Ga0070677_10000093 3300005333 Bacteria 29009
38 Ga0068869_100000673 3300005334 Bacteria 19304
39 Ga0070666_10004168 3300005335 Bacteria 8774
40 Ga0070680_100002497 3300005336 Bacteria 13632
41 Ga0070680_100015673 3300005336 Bacteria 5949
42 Ga0070682_100034657 3300005337 Bacteria 3076
43 Ga0068868_100000344 3300005338 Bacteria 31528
44 Ga0070660_100000034 3300005339 Bacteria 78347
45 Ga0070660_100039185 3300005339 Bacteria 3601
46 Ga0070689_100000082 3300005340 Bacteria 56097
47 Ga0070691_10039300 3300005341 Bacteria 2235
48 Ga0070687_100000004 3300005343 Bacteria 73882
49 Ga0070661_100000577 3300005344 Bacteria 27870
50 Ga0070661_100005748 3300005344 Bacteria 8538
51 Ga0070661_100008845 3300005344 Bacteria 6969
52 Ga0070692_10001207 3300005345 Bacteria 9167
53 Ga0070692_10002113 3300005345 Bacteria 7592
54 Ga0070692_10005153 3300005345 Bacteria 5533
55 Ga0070692_10006235 3300005345 Bacteria 5163
56 Ga0070668_100000023 3300005347 Bacteria 95415
57 Ga0070668_100020828 3300005347 Bacteria 4952
58 Ga0070669_100000182 3300005353 Bacteria 54933
59 Ga0070675_100000471 3300005354 Bacteria 27556
60 Ga0070671_100003704 3300005355 Bacteria 11993
61 Ga0070671_100045615 3300005355 Bacteria 3644
62 Ga0070674_100000097 3300005356 Bacteria 40603
63 Ga0070673_100000031 3300005364 Bacteria 62096
64 Ga0070688_100000034 3300005365 Bacteria 63078
65 Ga0070659_100000171 3300005366 Bacteria 50036
66 Ga0070667_100001475 3300005367 Bacteria 21100
67 Ga0070701_10013476 3300005438 Bacteria 3721
68 Ga0070705_100000129 3300005440 Bacteria 44167
69 Ga0070700_100001520 3300005441 Bacteria 11549
70 Ga0070663_100013590 3300005455 Bacteria 5196
71 Ga0070663_100052295 3300005455 Bacteria 2913
72 Ga0070663_100147981 3300005455 Bacteria 1798
73 Ga0070678_100000045 3300005456 Bacteria 42395
74 Ga0070662_100000237 3300005457 Bacteria 32505
75 Ga0070662_100073822 3300005457 Bacteria 2521
76 Ga0070681_10002073 3300005458 Bacteria 18195
77 Ga0070681_10034453 3300005458 Bacteria 5084
78 Ga0068867_100001063 3300005459 Bacteria 18739
79 Ga0070685_10000089 3300005466 Bacteria 55794
80 Ga0070679_100000657 3300005530 Bacteria 29456
81 Ga0070679_100002232 3300005530 Bacteria 17485
82 Ga0070679_100056707 3300005530 Bacteria 3903
83 Ga0070684_100008942 3300005535 Bacteria 7864
84 Ga0070684_100034303 3300005535 Bacteria 4338
85 Ga0068853_100000234 3300005539 Bacteria 39290
86 Ga0070686_100001677 3300005544 Bacteria 12375
87 Ga0070696_100010087 3300005546 Bacteria 6321
88 Ga0070696_100017777 3300005546 Bacteria 4801
89 Ga0070693_100005451 3300005547 Bacteria 6116
90 Ga0070665_100005546 3300005548 Bacteria 12975
91 Ga0068855_100000442 3300005563 Bacteria 51292
92 Ga0068855_100002771 3300005563 Bacteria 21564
93 Ga0068855_100039027 3300005563 Bacteria 5638
94 Ga0070664_100000384 3300005564 Bacteria 32914
95 Ga0070664_100000467 3300005564 Bacteria 30703
96 Ga0070664_100025397 3300005564 Bacteria 4910
97 Ga0068857_100000127 3300005577 Bacteria 45765
98 Ga0068857_100000544 3300005577 Bacteria 27429
99 Ga0068857_100027071 3300005577 Bacteria 5057
100 Ga0068857_100161871 3300005577 Bacteria 2031
101 Ga0068854_100017753 3300005578 Bacteria 4766
102 Ga0068854_100023843 3300005578 Bacteria 4182
103 Ga0068854_100043153 3300005578 Bacteria 3195
104 Ga0068856_100002855 3300005614 Bacteria 17672
105 Ga0068856_100003409 3300005614 Bacteria 16081
106 Ga0068856_100137681 3300005614 Bacteria 2447
107 Ga0070702_100006763 3300005615 Bacteria 5449
108 Ga0068852_100000276 3300005616 Bacteria 34230
109 Ga0068852_100005072 3300005616 Bacteria 9370
110 Ga0068864_100000202 3300005618 Bacteria 54004
111 Ga0068866_10000240 3300005718 Bacteria 25801
112 Ga0068861_100000034 3300005719 Bacteria 63827
113 Ga0068851_10000424 3300005834 Bacteria 18894
114 Ga0068870_10000019 3300005840 Bacteria 57495
115 Ga0068863_100001831 3300005841 Bacteria 21146
116 Ga0068862_100000136 3300005844 Bacteria 84924
117 Ga0081540_1000062 3300005983 Bacteria 119556
118 Ga0081540_1000369 3300005983 Bacteria 45088
119 Ga0081539_10010289 3300005985 Bacteria 7631
120 Ga0081539_10019435 3300005985 Bacteria 4649
121 Ga0097621_100000324 3300006237 Bacteria 32347
122 Ga0068871_100000123 3300006358 Bacteria 48789
123 Ga0068871_100047275 3300006358 Bacteria 3470
124 Ga0068871_100160269 3300006358 Bacteria 1924
125 Ga0075428_100038222 3300006844 Bacteria 5281
126 Ga0075431_100019044 3300006847 Bacteria 6994
127 Ga0075431_100020137 3300006847 Bacteria 6813
128 Ga0099823_1000021 3300006944 Bacteria 76133
129 Ga0105240_10000478 3300009093 Bacteria 73913
130 Ga0105240_10029042 3300009093 Bacteria 7212
131 Ga0105240_10074090 3300009093 Bacteria 4203
132 Ga0105245_10000080 3300009098 Bacteria 98140
133 Ga0105247_10000071 3300009101 Bacteria 114212
134 Ga0105243_10060654 3300009148 Bacteria 3022
135 Ga0105241_10010737 3300009174 Bacteria 6722
136 Ga0105241_10088961 3300009174 Bacteria 2432
137 Ga0105242_10145529 3300009176 Bacteria 2061
138 Ga0105248_10004159 3300009177 Bacteria 16004
139 Ga0105237_10130101 3300009545 Bacteria 2512
140 Ga0105238_10004755 3300009551 Bacteria 13434
141 Ga0105238_10123957 3300009551 Bacteria 2563
142 Ga0105249_10000140 3300009553 Bacteria 92898
143 Ga0105239_10000763 3300010375 Bacteria 45441
144 Ga0105239_10010174 3300010375 Bacteria 10538
145 Ga0105246_10025955 3300011119 Bacteria 3821
146 Ga0157319_1000008 3300012497 Bacteria 315600
147 Ga0157373_10004710 3300013100 Bacteria 10258
148 Ga0157373_10007942 3300013100 Bacteria 7889
149 Ga0157373_10034151 3300013100 Bacteria 3654
150 Ga0157371_10000182 3300013102 Bacteria 92464
151 Ga0157371_10011575 3300013102 Bacteria 6782
152 Ga0157371_10024513 3300013102 Bacteria 4404
153 Ga0157370_10027894 3300013104 Bacteria 5563
154 Ga0157370_10188325 3300013104 Bacteria 1916
155 Ga0157369_10000331 3300013105 Bacteria 63157
156 Ga0157369_10019146 3300013105 Bacteria 7662
157 Ga0157369_10029422 3300013105 Bacteria 6070
158 Ga0157374_10000198 3300013296 Bacteria 55701
159 Ga0157378_10000376 3300013297 Bacteria 44193
160 Ga0163162_10000319 3300013306 Bacteria 44269
161 Ga0157372_10001014 3300013307 Bacteria 30731
162 Ga0157372_10005140 3300013307 Bacteria 13909
163 Ga0157372_10015710 3300013307 Bacteria 8119
164 Ga0157372_10084219 3300013307 Bacteria 3603
165 Ga0157377_10000710 3300014745 Bacteria 13748
166 Ga0157379_10000081 3300014968 Bacteria 62822
167 Ga0157376_10013432 3300014969 Bacteria 6109
168 Ga0163161_10006923 3300017792 Bacteria 7840
169 Ga0206356_10077683 3300020070 Bacteria 9645
170 Ga0206354_11007317 3300020081 Bacteria 3969
171 Ga0213872_10000469 3300021361 Bacteria 32732
172 Ga0213872_10000528 3300021361 Bacteria 29926
173 Ga0213872_10001347 3300021361 Bacteria 16224
174 Ga0213872_10004976 3300021361 Bacteria 6913
175 Ga0209674_100015 3300025226 Bacteria 697299
176 Ga0209563_100013 3300025230 Bacteria 941463
177 Ga0209563_100017 3300025230 Bacteria 796449
178 Ga0207427_100501 3300025231 Bacteria 20836
179 Ga0209258_101216 3300025242 Bacteria 10035
180 Ga0209646_1000261 3300025246 Bacteria 51612
181 Ga0209026_1000317 3300025250 Bacteria 51612
182 Ga0209677_100037 3300025253 Bacteria 286702
183 Ga0209677_100101 3300025253 Bacteria 91739
184 Ga0209759_1000422 3300025256 Bacteria 51612
185 Ga0209759_1000463 3300025256 Bacteria 45951
186 Ga0209759_1002330 3300025256 Bacteria 8516
187 Ga0209673_1004686 3300025273 Bacteria 7214
188 Ga0209673_1011543 3300025273 Bacteria 3636
189 Ga0209025_1008102 3300025294 Bacteria 7638
190 Ga0209564_1000008 3300025295 Bacteria 953227
191 Ga0209050_1002388 3300025298 Bacteria 16298
192 Ga0209050_1006270 3300025298 Bacteria 7117
193 Ga0209256_1001935 3300025299 Bacteria 18873
194 Ga0209051_1001897 3300025303 Bacteria 16305
195 Ga0209051_1021887 3300025303 Bacteria 2706
196 Ga0209051_1024512 3300025303 Bacteria 2479
197 Ga0209051_1029734 3300025303 Bacteria 2132
198 Ga0209257_1000021 3300025304 Bacteria 771986
199 Ga0209257_1004508 3300025304 Bacteria 10723
200 Ga0209257_1005138 3300025304 Bacteria 9461
201 Ga0207697_10000462 3300025315 Bacteria 22886
202 Ga0207656_10000245 3300025321 Bacteria 18965
203 Ga0207656_10001353 3300025321 Bacteria 8083
204 Ga0207656_10049024 3300025321 Bacteria 1820
205 Ga0207682_10000014 3300025893 Bacteria 82425
206 Ga0207642_10001034 3300025899 Bacteria 8652
207 Ga0207710_10001627 3300025900 Bacteria 10970
208 Ga0207688_10000005 3300025901 Bacteria 63715
209 Ga0207680_10000066 3300025903 Bacteria 47477
210 Ga0207647_10001470 3300025904 Bacteria 18101
211 Ga0207647_10001488 3300025904 Bacteria 17999
212 Ga0207647_10006509 3300025904 Bacteria 8490
213 Ga0207645_10000008 3300025907 Bacteria 158682
214 Ga0207645_10004284 3300025907 Bacteria 10588
215 Ga0207643_10000008 3300025908 Bacteria 163521
216 Ga0207705_10000087 3300025909 Bacteria 114441
217 Ga0207705_10000153 3300025909 Bacteria 74093
218 Ga0207705_10001967 3300025909 Bacteria 16021
219 Ga0207705_10004515 3300025909 Bacteria 10518
220 Ga0207705_10005258 3300025909 Bacteria 9700
221 Ga0207705_10007480 3300025909 Bacteria 8031
222 Ga0207705_10016730 3300025909 Bacteria 5252
223 Ga0207705_10071793 3300025909 Bacteria 2510
224 Ga0207654_10013196 3300025911 Bacteria 4246
225 Ga0207707_10000389 3300025912 Bacteria 45856
226 Ga0207707_10001030 3300025912 Bacteria 26758
227 Ga0207707_10001039 3300025912 Bacteria 26597
228 Ga0207707_10004929 3300025912 Bacteria 11737
229 Ga0207707_10040763 3300025912 Bacteria 4055
230 Ga0207695_10000859 3300025913 Bacteria 55564
231 Ga0207695_10001326 3300025913 Bacteria 41988
232 Ga0207695_10007523 3300025913 Bacteria 13812
233 Ga0207695_10015088 3300025913 Bacteria 9114
234 Ga0207695_10239657 3300025913 Bacteria 1715
235 Ga0207671_10029401 3300025914 Bacteria 4102
236 Ga0207660_10000534 3300025917 Bacteria 25449
237 Ga0207660_10001751 3300025917 Bacteria 14544
238 Ga0207660_10004031 3300025917 Bacteria 9584
239 Ga0207662_10000023 3300025918 Bacteria 70935
240 Ga0207657_10000069 3300025919 Bacteria 95262
241 Ga0207657_10007728 3300025919 Bacteria 10979
242 Ga0207657_10008328 3300025919 Bacteria 10544
243 Ga0207657_10012319 3300025919 Bacteria 8450
244 Ga0207649_10000488 3300025920 Bacteria 28138
245 Ga0207649_10000703 3300025920 Bacteria 21942
246 Ga0207649_10004535 3300025920 Bacteria 7540
247 Ga0207649_10004897 3300025920 Bacteria 7241
248 Ga0207649_10041183 3300025920 Bacteria 2811
249 Ga0207652_10000017 3300025921 Bacteria 188391
250 Ga0207652_10000040 3300025921 Bacteria 131566
251 Ga0207652_10000072 3300025921 Bacteria 109080
252 Ga0207652_10000418 3300025921 Bacteria 44135
253 Ga0207652_10005285 3300025921 Bacteria 10480
254 Ga0207681_10000445 3300025923 Bacteria 28954
255 Ga0207694_10003183 3300025924 Bacteria 13094
256 Ga0207694_10005730 3300025924 Bacteria 9519
257 Ga0207694_10006004 3300025924 Bacteria 9295
258 Ga0207650_10000595 3300025925 Bacteria 28962
259 Ga0207659_10000053 3300025926 Bacteria 78612
260 Ga0207687_10000674 3300025927 Bacteria 22972
261 Ga0207644_10000349 3300025931 Bacteria 29986
262 Ga0207690_10000738 3300025932 Bacteria 21071
263 Ga0207690_10001149 3300025932 Bacteria 16803
264 Ga0207690_10003181 3300025932 Bacteria 9861
265 Ga0207706_10000087 3300025933 Bacteria 95262
266 Ga0207706_10012233 3300025933 Bacteria 7820
267 Ga0207709_10005509 3300025935 Bacteria 7184
268 Ga0207670_10000151 3300025936 Bacteria 45835
269 Ga0207669_10000094 3300025937 Bacteria 45389
270 Ga0207704_10000170 3300025938 Bacteria 34383
271 Ga0207691_10000048 3300025940 Bacteria 95495
272 Ga0207711_10000280 3300025941 Bacteria 55024
273 Ga0207689_10000035 3300025942 Bacteria 95241
274 Ga0207689_10057766 3300025942 Bacteria 3191
275 Ga0207661_10001043 3300025944 Bacteria 18426
276 Ga0207661_10007421 3300025944 Bacteria 7803
277 Ga0207661_10008052 3300025944 Bacteria 7513
278 Ga0207679_10000219 3300025945 Bacteria 45129
279 Ga0207679_10003034 3300025945 Bacteria 10399
280 Ga0207679_10003484 3300025945 Bacteria 9730
281 Ga0207667_10002701 3300025949 Bacteria 21961
282 Ga0207667_10005890 3300025949 Bacteria 14928
283 Ga0207667_10007356 3300025949 Bacteria 13250
284 Ga0207667_10012521 3300025949 Bacteria 9764
285 Ga0207667_10148911 3300025949 Bacteria 2409
286 Ga0207667_10167175 3300025949 Bacteria 2261
287 Ga0207651_10000039 3300025960 Bacteria 62741
288 Ga0207651_10001106 3300025960 Bacteria 11995
289 Ga0207712_10000385 3300025961 Bacteria 38366
290 Ga0207668_10003557 3300025972 Bacteria 9155
291 Ga0207668_10034744 3300025972 Bacteria 3350
292 Ga0207640_10000180 3300025981 Bacteria 45856
293 Ga0207640_10000318 3300025981 Bacteria 32231
294 Ga0207640_10000355 3300025981 Bacteria 30039
295 Ga0207640_10026232 3300025981 Bacteria 3535
296 Ga0207658_10000259 3300025986 Bacteria 55319
297 Ga0207677_10000068 3300026023 Bacteria 86534
298 Ga0207703_10000106 3300026035 Bacteria 99033
299 Ga0207639_10000268 3300026041 Bacteria 37276
300 Ga0207639_10000702 3300026041 Bacteria 22962
301 Ga0207678_10000237 3300026067 Bacteria 49441
302 Ga0207678_10002305 3300026067 Bacteria 17276
303 Ga0207678_10002600 3300026067 Bacteria 16445
304 Ga0207678_10006320 3300026067 Bacteria 10520
305 Ga0207678_10016390 3300026067 Bacteria 6506
306 Ga0207678_10182164 3300026067 Bacteria 1794
307 Ga0207708_10011795 3300026075 Bacteria 6510
308 Ga0207702_10000851 3300026078 Bacteria 31904
309 Ga0207702_10007325 3300026078 Bacteria 9424
310 Ga0207702_10009905 3300026078 Bacteria 7988
311 Ga0207702_10051560 3300026078 Bacteria 3478
312 Ga0207641_10000528 3300026088 Bacteria 42770
313 Ga0207648_10000070 3300026089 Bacteria 95262
314 Ga0207676_10000158 3300026095 Bacteria 59247
315 Ga0207674_10000377 3300026116 Bacteria 58008
316 Ga0207674_10000681 3300026116 Bacteria 44110
317 Ga0207674_10010434 3300026116 Bacteria 10521
318 Ga0207674_10015162 3300026116 Bacteria 8481
319 Ga0207675_100000008 3300026118 Bacteria 182355
320 Ga0207683_10000094 3300026121 Bacteria 72088
321 Ga0207698_10000056 3300026142 Bacteria 80605
322 Ga0207698_10001614 3300026142 Bacteria 13119
323 Ga0207698_10002238 3300026142 Bacteria 11438
324 Ga0209389_1002544 3300027296 Bacteria 14101
325 Ga0268266_10000223 3300028379 Bacteria 98692
326 Ga0268265_10000130 3300028380 Bacteria 95720
327 Ga0268264_10000460 3300028381 Bacteria 55265
328 Ga0307515_10144888 3300028794 Bacteria 2523
329 Ga0265327_10000012 3300031251 Bacteria 530403
330 Ga0307509_10000175 3300031507 Bacteria 100922
331 Ga0307408_100000416 3300031548 Bacteria 38287
332 Ga0307516_10132175 3300031730 Bacteria 2274
333 Ga0373934_0047235 3300035086 Bacteria 1702
334 Ga0373939_0000020 3300035114 Bacteria 58845
335 Ga0373960_0001102 3300035121 Bacteria 5827
336 Ga0373931_0035847 3300035691 Bacteria 2582
337 Ga0395900_0025171 3300037418 Bacteria 6093
338 Ga0395898_0043495 3300037466 Bacteria 4425
339 Ga0395905_0010172 3300037471 Bacteria 9167
340 Ga0395905_0216629 3300037471 Bacteria 1793
341 Ga0395901_0015320 3300038443 Bacteria 7803
342 Ga0395901_0084784 3300038443 Bacteria 3311
343 Ga0436361_0141504 3300039447 Bacteria 6486
344 Ga0436361_0162124 3300039447 Bacteria 22005
345 Ga0436361_0325950 3300039447 Bacteria 85005
346 Ga0436361_0410668 3300039447 Bacteria 27008
347 Ga0436361_0487065 3300039447 Bacteria 63556
348 Ga0436361_0925879 3300039447 Bacteria 1453
349 Ga0436361_0982530 3300039447 Bacteria 2048
350 Ga0436361_1150605 3300039447 Bacteria 6955
351 Ga0439437_000580 3300042000 Bacteria 3654
352 Ga0450917_000298 3300042120 Bacteria 3640
353 Ga0450890_000183 3300042127 Bacteria 9525
354 Ga0450891_000477 3300042129 Bacteria 4205
355 Ga0450889_000296 3300042144 Bacteria 5601
356 Ga0439459_0003283 3300042438 Bacteria 2552
357 Ga0450893_0001467 3300042532 Bacteria 3617
358 Ga0451577_0040491 3300042876 Bacteria 4183
359 Ga0451577_0043334 3300042876 Bacteria 4031
360 Ga0451577_0062539 3300042876 Bacteria 3320
361 Ga0466963_0061960 3300044694 Bacteria 2502
362 Ga0453684_0012813 3300044712 Bacteria 13749
363 Ga0453684_0018927 3300044712 Bacteria 10530
364 Ga0453684_0054834 3300044712 Bacteria 5188
365 Ga0451576_0000109 3300045051 Bacteria 210549
366 Ga0451576_0084937 3300045051 Bacteria 3292
367 Ga0451576_0111052 3300045051 Bacteria 2853
368 Ga0495590_0000007 3300046457 Bacteria 331108
369 Ga0495650_0000177 3300046471 Bacteria 139376
370 Ga0495650_0025525 3300046471 Bacteria 2767
371 Ga0495596_0000667 3300046500 Bacteria 21379
372 Ga0495583_0000166 3300046506 Bacteria 111939
373 Ga0495606_0001259 3300046507 Bacteria 35323
374 Ga0495648_0009966 3300046524 Bacteria 7292
375 Ga0495668_0014163 3300046616 Bacteria 4686
376 Ga0495625_0006322 3300046660 Bacteria 10588
377 Ga0495649_0000998 3300046694 Bacteria 22261
378 Ga0495589_0011604 3300046794 Bacteria 4574
379 Ga0496102_0000579 3300048905 Bacteria 38811
380 Ga0496103_0049032 3300048906 Bacteria 2611
381 Ga0496104_0037612 3300048907 Bacteria 4526
382 Ga0496104_0173374 3300048907 Bacteria 2067
383 Ga0496105_0087100 3300048908 Bacteria 2581
384 Ga0496108_0112093 3300048911 Bacteria 2333
385 Ga0496109_0006592 3300048912 Bacteria 9777
386 Ga0496109_0112155 3300048912 Bacteria 2536
387 Ga0496112_0000116 3300048915 Bacteria 49388
388 Ga0496113_0014589 3300048916 Bacteria 5366
389 Ga0496113_0143898 3300048916 Bacteria 1877
390 Ga0501047_0038495 3300049581 Bacteria 4627
391 Ga0501069_0000241 3300049585 Bacteria 24511
392 Ga0501069_0026896 3300049585 Bacteria 3151
393 Ga0501070_0031393 3300049586 Bacteria 4451
394 Ga0501070_0041404 3300049586 Bacteria 3838
395 Ga0501070_0078531 3300049586 Bacteria 2731
396 Ga0501071_0002091 3300049587 Bacteria 11987
397 Ga0501072_0029354 3300049588 Bacteria 4296
398 Ga0501074_0011576 3300049590 Bacteria 6414
399 Ga0501077_0083980 3300049593 Bacteria 2018
400 Ga0501233_014573 3300049668 Bacteria 1608
401 Ga0501080_0017557 3300049742 Bacteria 6617
402 Ga0501080_0023971 3300049742 Bacteria 5657
403 Ga0501267_000301 3300049764 Bacteria 3631
404 Ga0501035_0087419 3300049822 Bacteria 2747
405 Ga0501044_0012928 3300049823 Bacteria 9035
406 Ga0501044_0033171 3300049823 Bacteria 5427
407 nmdc:mga07m45_11859_c1 3300050496 Bacteria 4590
408 nmdc:mga07m45_31265_c1 3300050496 Bacteria 2950
409 nmdc:mga07m45_40358_c2 3300050496 Bacteria 1924
410 nmdc:mga06r32_15115_c1 3300050510 Bacteria 7009
411 nmdc:mga06r32_18396_c1 3300050510 Bacteria 6398
412 nmdc:mga08y16_103659_c1 3300050511 Bacteria 2962
413 Ga0500568_0012394 3300053139 Bacteria 3925
414 Ga0500622_0008241 3300053156 Bacteria 5848
415 Ga0500636_0016438 3300053177 Bacteria 4363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0049032 Ga0496103_0049032_1036_2478 428
2 3300035691 Ga0373931_0035847 Ga0373931_0035847_706_2118 429
3 3300006358 Ga0068871_100047275 Ga0068871_1000472752 430
4 3300002076 JGI24749J21850_1002939 JGI24749J21850_10029392 431
5 3300003659 JGI25404J52841_10003484 JGI25404J52841_100034841 431
6 3300005327 Ga0070658_10000164 Ga0070658_1000016429 431
7 3300005328 Ga0070676_10000013 Ga0070676_1000001326 431
8 3300005329 Ga0070683_100007772 Ga0070683_1000077724 431
9 3300005330 Ga0070690_100000013 Ga0070690_10000001359 431
10 3300005331 Ga0070670_100001325 Ga0070670_1000013252 431
11 3300005333 Ga0070677_10000093 Ga0070677_1000009326 431
12 3300005334 Ga0068869_100000673 Ga0068869_1000006737 431
13 3300005335 Ga0070666_10004168 Ga0070666_100041688 431
14 3300005338 Ga0068868_100000344 Ga0068868_1000003443 431
15 3300005339 Ga0070660_100000034 Ga0070660_10000003422 431
16 3300005340 Ga0070689_100000082 Ga0070689_10000008227 431
17 3300005343 Ga0070687_100000004 Ga0070687_10000000418 431
18 3300005344 Ga0070661_100000577 Ga0070661_10000057723 431
19 3300005344 Ga0070661_100005748 Ga0070661_1000057488 431
20 3300005345 Ga0070692_10005153 Ga0070692_100051537 431
21 3300005347 Ga0070668_100000023 Ga0070668_10000002359 431
22 3300005353 Ga0070669_100000182 Ga0070669_10000018226 431
23 3300005354 Ga0070675_100000471 Ga0070675_1000004714 431
24 3300005355 Ga0070671_100003704 Ga0070671_1000037046 431
25 3300005356 Ga0070674_100000097 Ga0070674_10000009726 431
26 3300005364 Ga0070673_100000031 Ga0070673_10000003154 431
27 3300005365 Ga0070688_100000034 Ga0070688_1000000347 431
28 3300005366 Ga0070659_100000171 Ga0070659_10000017125 431
29 3300005367 Ga0070667_100001475 Ga0070667_10000147515 431
30 3300005438 Ga0070701_10013476 Ga0070701_100134764 431
31 3300005440 Ga0070705_100000129 Ga0070705_10000012916 431
32 3300005441 Ga0070700_100001520 Ga0070700_1000015202 431
33 3300005456 Ga0070678_100000045 Ga0070678_10000004514 431
34 3300005457 Ga0070662_100000237 Ga0070662_1000002377 431
35 3300005459 Ga0068867_100001063 Ga0068867_1000010637 431
36 3300005466 Ga0070685_10000089 Ga0070685_1000008925 431
37 3300005535 Ga0070684_100008942 Ga0070684_1000089425 431
38 3300005539 Ga0068853_100000234 Ga0068853_1000002348 431
39 3300005544 Ga0070686_100001677 Ga0070686_1000016779 431
40 3300005546 Ga0070696_100017777 Ga0070696_1000177774 431
41 3300005547 Ga0070693_100005451 Ga0070693_1000054517 431
42 3300005548 Ga0070665_100005546 Ga0070665_1000055469 431
43 3300005563 Ga0068855_100000442 Ga0068855_10000044216 431
44 3300005564 Ga0070664_100000384 Ga0070664_1000003848 431
45 3300005564 Ga0070664_100000467 Ga0070664_10000046726 431
46 3300005577 Ga0068857_100000544 Ga0068857_1000005448 431
47 3300005577 Ga0068857_100161871 Ga0068857_1001618711 431
48 3300005614 Ga0068856_100003409 Ga0068856_1000034097 431
49 3300005615 Ga0070702_100006763 Ga0070702_1000067634 431
50 3300005616 Ga0068852_100000276 Ga0068852_10000027616 431
51 3300005618 Ga0068864_100000202 Ga0068864_10000020226 431
52 3300005718 Ga0068866_10000240 Ga0068866_1000024021 431
53 3300005719 Ga0068861_100000034 Ga0068861_10000003459 431
54 3300005834 Ga0068851_10000424 Ga0068851_100004247 431
55 3300005840 Ga0068870_10000019 Ga0068870_1000001924 431
56 3300005841 Ga0068863_100001831 Ga0068863_1000018318 431
57 3300005844 Ga0068862_100000136 Ga0068862_10000013626 431
58 3300005983 Ga0081540_1000062 Ga0081540_100006238 431
59 3300005983 Ga0081540_1000369 Ga0081540_10003697 431
60 3300006237 Ga0097621_100000324 Ga0097621_10000032414 431
61 3300006358 Ga0068871_100000123 Ga0068871_10000012326 431
62 3300009093 Ga0105240_10000478 Ga0105240_1000047818 431
63 3300009098 Ga0105245_10000080 Ga0105245_1000008035 431
64 3300009101 Ga0105247_10000071 Ga0105247_1000007158 431
65 3300009174 Ga0105241_10010737 Ga0105241_100107374 431
66 3300009553 Ga0105249_10000140 Ga0105249_1000014059 431
67 3300010375 Ga0105239_10000763 Ga0105239_1000076325 431
68 3300011119 Ga0105246_10025955 Ga0105246_100259554 431
69 3300013100 Ga0157373_10034151 Ga0157373_100341513 431
70 3300013102 Ga0157371_10000182 Ga0157371_1000018259 431
71 3300013105 Ga0157369_10000331 Ga0157369_1000033150 431
72 3300013296 Ga0157374_10000198 Ga0157374_1000019825 431
73 3300013297 Ga0157378_10000376 Ga0157378_1000037624 431
74 3300013306 Ga0163162_10000319 Ga0163162_1000031924 431
75 3300013307 Ga0157372_10001014 Ga0157372_100010145 431
76 3300014745 Ga0157377_10000710 Ga0157377_1000071011 431
77 3300014968 Ga0157379_10000081 Ga0157379_100000814 431
78 3300014969 Ga0157376_10013432 Ga0157376_100134324 431
79 3300017792 Ga0163161_10006923 Ga0163161_100069239 431
80 3300025315 Ga0207697_10000462 Ga0207697_1000046211 431
81 3300025321 Ga0207656_10000245 Ga0207656_1000024517 431
82 3300025893 Ga0207682_10000014 Ga0207682_1000001431 431
83 3300025899 Ga0207642_10001034 Ga0207642_100010348 431
84 3300025900 Ga0207710_10001627 Ga0207710_100016279 431
85 3300025901 Ga0207688_10000005 Ga0207688_1000000515 431
86 3300025903 Ga0207680_10000066 Ga0207680_1000006622 431
87 3300025904 Ga0207647_10006509 Ga0207647_100065097 431
88 3300025907 Ga0207645_10000008 Ga0207645_1000000893 431
89 3300025908 Ga0207643_10000008 Ga0207643_1000000858 431
90 3300025909 Ga0207705_10001967 Ga0207705_100019678 431
91 3300025911 Ga0207654_10013196 Ga0207654_100131964 431
92 3300025912 Ga0207707_10040763 Ga0207707_100407635 431
93 3300025918 Ga0207662_10000023 Ga0207662_1000002358 431
94 3300025919 Ga0207657_10000069 Ga0207657_1000006958 431
95 3300025920 Ga0207649_10000703 Ga0207649_1000070322 431
96 3300025920 Ga0207649_10004535 Ga0207649_100045353 431
97 3300025923 Ga0207681_10000445 Ga0207681_1000044525 431
98 3300025924 Ga0207694_10006004 Ga0207694_100060048 431
99 3300025925 Ga0207650_10000595 Ga0207650_100005956 431
100 3300025926 Ga0207659_10000053 Ga0207659_1000005358 431
101 3300025927 Ga0207687_10000674 Ga0207687_1000067416 431
102 3300025931 Ga0207644_10000349 Ga0207644_1000034926 431
103 3300025932 Ga0207690_10000738 Ga0207690_100007386 431
104 3300025933 Ga0207706_10000087 Ga0207706_1000008758 431
105 3300025935 Ga0207709_10005509 Ga0207709_100055094 431
106 3300025936 Ga0207670_10000151 Ga0207670_1000015124 431
107 3300025937 Ga0207669_10000094 Ga0207669_1000009424 431
108 3300025938 Ga0207704_10000170 Ga0207704_1000017022 431
109 3300025940 Ga0207691_10000048 Ga0207691_1000004858 431
110 3300025941 Ga0207711_10000280 Ga0207711_1000028020 431
111 3300025942 Ga0207689_10000035 Ga0207689_1000003558 431
112 3300025944 Ga0207661_10008052 Ga0207661_100080524 431
113 3300025945 Ga0207679_10000219 Ga0207679_1000021922 431
114 3300025945 Ga0207679_10003484 Ga0207679_100034843 431
115 3300025949 Ga0207667_10007356 Ga0207667_100073567 431
116 3300025960 Ga0207651_10000039 Ga0207651_1000003934 431
117 3300025961 Ga0207712_10000385 Ga0207712_1000038528 431
118 3300025972 Ga0207668_10003557 Ga0207668_100035575 431
119 3300025981 Ga0207640_10000180 Ga0207640_1000018022 431
120 3300025986 Ga0207658_10000259 Ga0207658_1000025926 431
121 3300026023 Ga0207677_10000068 Ga0207677_1000006858 431
122 3300026035 Ga0207703_10000106 Ga0207703_1000010658 431
123 3300026041 Ga0207639_10000268 Ga0207639_1000026815 431
124 3300026067 Ga0207678_10000237 Ga0207678_1000023747 431
125 3300026075 Ga0207708_10011795 Ga0207708_100117952 431
126 3300026088 Ga0207641_10000528 Ga0207641_1000052823 431
127 3300026089 Ga0207648_10000070 Ga0207648_1000007058 431
128 3300026095 Ga0207676_10000158 Ga0207676_1000015825 431
129 3300026116 Ga0207674_10000377 Ga0207674_1000037713 431
130 3300026118 Ga0207675_100000008 Ga0207675_100000008116 431
131 3300026121 Ga0207683_10000094 Ga0207683_1000009433 431
132 3300026142 Ga0207698_10002238 Ga0207698_100022385 431
133 3300028379 Ga0268266_10000223 Ga0268266_1000022358 431
134 3300028380 Ga0268265_10000130 Ga0268265_1000013033 431
135 3300028381 Ga0268264_10000460 Ga0268264_1000046027 431
136 3300042876 Ga0451577_0040491 Ga0451577_0040491_828_2309 431
137 3300044712 Ga0453684_0054834 Ga0453684_0054834_983_2464 431
138 3300045051 Ga0451576_0111052 Ga0451576_0111052_1429_2835 431
139 3300048905 Ga0496102_0000579 Ga0496102_0000579_14231_15682 431
140 3300048911 Ga0496108_0112093 Ga0496108_0112093_864_2297 431
141 3300048912 Ga0496109_0006592 Ga0496109_0006592_5513_6964 431
142 3300048915 Ga0496112_0000116 Ga0496112_0000116_20031_21482 431
143 3300048916 Ga0496113_0014589 Ga0496113_0014589_1329_2780 431
144 3300038443 Ga0395901_0084784 Ga0395901_0084784_793_2451 432
145 3300005336 Ga0070680_100002497 Ga0070680_10000249715 447
146 3300005458 Ga0070681_10002073 Ga0070681_1000207315 447
147 3300005530 Ga0070679_100000657 Ga0070679_1000006576 447
148 3300039447 Ga0436361_0925879 Ga0436361_0925879_59_1438 449
149 3300009545 Ga0105237_10130101 Ga0105237_101301014 450
150 3300025912 Ga0207707_10000389 Ga0207707_1000038929 451
151 3300025917 Ga0207660_10001751 Ga0207660_100017516 451
152 3300025921 Ga0207652_10000072 Ga0207652_1000007215 451
153 3300026078 Ga0207702_10051560 Ga0207702_100515602 453
154 3300013104 Ga0157370_10188325 Ga0157370_101883251 458
155 3300049585 Ga0501069_0026896 Ga0501069_0026896_1064_2626 461
156 3300046471 Ga0495650_0000177 Ga0495650_0000177_100121_101668 463
157 3300049590 Ga0501074_0011576 Ga0501074_0011576_4432_5994 463
158 3300049742 Ga0501080_0023971 Ga0501080_0023971_3248_4810 463
159 3300049823 Ga0501044_0033171 Ga0501044_0033171_3559_5121 463
160 3300049586 Ga0501070_0031393 Ga0501070_0031393_2828_4390 464
161 3300001979 JGI24740J21852_10000830 JGI24740J21852_100008302 465
162 3300005327 Ga0070658_10155577 Ga0070658_101555771 465
163 3300005329 Ga0070683_100028377 Ga0070683_1000283772 465
164 3300005336 Ga0070680_100015673 Ga0070680_1000156735 465
165 3300005339 Ga0070660_100039185 Ga0070660_1000391852 465
166 3300005341 Ga0070691_10039300 Ga0070691_100393001 465
167 3300005345 Ga0070692_10001207 Ga0070692_100012075 465
168 3300005455 Ga0070663_100147981 Ga0070663_1001479811 465
169 3300005530 Ga0070679_100056707 Ga0070679_1000567075 465
170 3300005546 Ga0070696_100010087 Ga0070696_1000100874 465
171 3300005577 Ga0068857_100027071 Ga0068857_1000270712 465
172 3300013100 Ga0157373_10004710 Ga0157373_100047105 465
173 3300013102 Ga0157371_10024513 Ga0157371_100245134 465
174 3300013105 Ga0157369_10019146 Ga0157369_100191464 465
175 3300020081 Ga0206354_11007317 Ga0206354_110073172 465
176 3300025321 Ga0207656_10049024 Ga0207656_100490242 465
177 3300025904 Ga0207647_10001488 Ga0207647_100014884 465
178 3300025909 Ga0207705_10004515 Ga0207705_100045155 465
179 3300025912 Ga0207707_10004929 Ga0207707_100049297 465
180 3300025913 Ga0207695_10015088 Ga0207695_100150884 465
181 3300025917 Ga0207660_10004031 Ga0207660_100040319 465
182 3300025919 Ga0207657_10008328 Ga0207657_100083284 465
183 3300025920 Ga0207649_10041183 Ga0207649_100411832 465
184 3300025921 Ga0207652_10005285 Ga0207652_100052856 465
185 3300025944 Ga0207661_10007421 Ga0207661_100074217 465
186 3300025949 Ga0207667_10012521 Ga0207667_100125214 465
187 3300025981 Ga0207640_10000355 Ga0207640_100003555 465
188 3300026067 Ga0207678_10006320 Ga0207678_100063204 465
189 3300026078 Ga0207702_10000851 Ga0207702_100008516 465
190 3300026116 Ga0207674_10010434 Ga0207674_100104346 465
191 3300026142 Ga0207698_10001614 Ga0207698_100016147 465
192 3300044712 Ga0453684_0018927 Ga0453684_0018927_2985_4547 465
193 3300049593 Ga0501077_0083980 Ga0501077_0083980_129_1688 465
194 3300044712 Ga0453684_0012813 Ga0453684_0012813_10071_11627 467
195 3300042876 Ga0451577_0043334 Ga0451577_0043334_1133_2692 469
196 3300005985 Ga0081539_10010289 Ga0081539_100102892 472
197 3300046616 Ga0495668_0014163 Ga0495668_0014163_1703_3277 472
198 3300005985 Ga0081539_10019435 Ga0081539_100194352 473
199 3300013102 Ga0157371_10011575 Ga0157371_100115754 475
200 3300013307 Ga0157372_10015710 Ga0157372_100157105 475
201 3300021361 Ga0213872_10000528 Ga0213872_1000052832 475
202 3300025913 Ga0207695_10001326 Ga0207695_1000132638 475
203 3300039447 Ga0436361_0162124 Ga0436361_0162124_19413_21017 475
204 3300020070 Ga0206356_10077683 Ga0206356_100776833 476
205 3300005345 Ga0070692_10006235 Ga0070692_100062353 477
206 3300005455 Ga0070663_100052295 Ga0070663_1000522951 477
207 3300005578 Ga0068854_100017753 Ga0068854_1000177535 477
208 3300005616 Ga0068852_100005072 Ga0068852_1000050726 477
209 3300009176 Ga0105242_10145529 Ga0105242_101455291 477
210 3300025909 Ga0207705_10000153 Ga0207705_1000015320 477
211 3300025919 Ga0207657_10012319 Ga0207657_100123197 477
212 3300025920 Ga0207649_10004897 Ga0207649_100048979 477
213 3300025932 Ga0207690_10001149 Ga0207690_100011498 477
214 3300025949 Ga0207667_10002701 Ga0207667_1000270119 477
215 3300026067 Ga0207678_10002305 Ga0207678_1000230512 477
216 3300049668 Ga0501233_014573 Ga0501233_014573_46_1575 477
217 3300049764 Ga0501267_000301 Ga0501267_000301_1867_3396 477
218 3300006847 Ga0075431_100019044 Ga0075431_1000190445 479
219 3300050510 nmdc:mga06r32_15115_c1 nmdc:mga06r32_15115_c1_5130_6686 479
220 3300025256 Ga0209759_1000463 Ga0209759_10004634 480
221 3300049588 Ga0501072_0029354 Ga0501072_0029354_969_2549 480
222 3300001915 JGI24741J21665_1001160 JGI24741J21665_10011603 481
223 3300001979 JGI24740J21852_10000202 JGI24740J21852_1000020215 481
224 3300003759 Ga0055525_1000004 Ga0055525_1000004467 481
225 3300005344 Ga0070661_100008845 Ga0070661_1000088459 481
226 3300005345 Ga0070692_10002113 Ga0070692_1000211310 481
227 3300005457 Ga0070662_100073822 Ga0070662_1000738222 481
228 3300005535 Ga0070684_100034303 Ga0070684_1000343033 481
229 3300005564 Ga0070664_100025397 Ga0070664_1000253976 481
230 3300005578 Ga0068854_100043153 Ga0068854_1000431533 481
231 3300005614 Ga0068856_100137681 Ga0068856_1001376812 481
232 3300009174 Ga0105241_10088961 Ga0105241_100889612 481
233 3300013307 Ga0157372_10084219 Ga0157372_100842193 481
234 3300025230 Ga0209563_100013 Ga0209563_100013468 481
235 3300025321 Ga0207656_10001353 Ga0207656_1000135310 481
236 3300025904 Ga0207647_10001470 Ga0207647_100014705 481
237 3300025909 Ga0207705_10000087 Ga0207705_1000008768 481
238 3300025909 Ga0207705_10005258 Ga0207705_100052582 481
239 3300025913 Ga0207695_10000859 Ga0207695_1000085921 481
240 3300025917 Ga0207660_10000534 Ga0207660_1000053428 481
241 3300025919 Ga0207657_10007728 Ga0207657_100077286 481
242 3300025920 Ga0207649_10000488 Ga0207649_1000048819 481
243 3300025921 Ga0207652_10000418 Ga0207652_100004183 481
244 3300025924 Ga0207694_10003183 Ga0207694_1000318310 481
245 3300025932 Ga0207690_10003181 Ga0207690_100031813 481
246 3300025933 Ga0207706_10012233 Ga0207706_100122332 481
247 3300025945 Ga0207679_10003034 Ga0207679_1000303413 481
248 3300025949 Ga0207667_10005890 Ga0207667_100058903 481
249 3300025981 Ga0207640_10000318 Ga0207640_1000031818 481
250 3300026041 Ga0207639_10000702 Ga0207639_1000070213 481
251 3300026067 Ga0207678_10002600 Ga0207678_1000260010 481
252 3300026078 Ga0207702_10007325 Ga0207702_1000732513 481
253 3300026116 Ga0207674_10015162 Ga0207674_1001516210 481
254 3300026142 Ga0207698_10000056 Ga0207698_1000005621 481
255 3300037418 Ga0395900_0025171 Ga0395900_0025171_4322_5884 481
256 3300048907 Ga0496104_0037612 Ga0496104_0037612_2353_3918 481
257 3300009551 Ga0105238_10004755 Ga0105238_1000475516 482
258 3300025912 Ga0207707_10001030 Ga0207707_100010302 482
259 3300025944 Ga0207661_10001043 Ga0207661_100010434 482
260 3300049581 Ga0501047_0038495 Ga0501047_0038495_538_2094 482
261 3300049587 Ga0501071_0002091 Ga0501071_0002091_1446_3002 482
262 3300049822 Ga0501035_0087419 Ga0501035_0087419_738_2294 482
263 3300049823 Ga0501044_0012928 Ga0501044_0012928_6316_7872 482
264 3300053139 Ga0500568_0012394 Ga0500568_0012394_644_2179 482
265 3300003322 rootL2_10005556 rootL2_1000555616 483
266 3300049585 Ga0501069_0000241 Ga0501069_0000241_3998_5566 483
267 3300006847 Ga0075431_100020137 Ga0075431_1000201374 484
268 3300009551 Ga0105238_10123957 Ga0105238_101239572 484
269 3300010375 Ga0105239_10010174 Ga0105239_100101744 484
270 3300013105 Ga0157369_10029422 Ga0157369_100294223 484
271 3300037471 Ga0395905_0216629 Ga0395905_0216629_236_1741 484
272 3300044694 Ga0466963_0061960 Ga0466963_0061960_931_2454 484
273 3300050510 nmdc:mga06r32_18396_c1 nmdc:mga06r32_18396_c1_4401_5969 484
274 3300050511 nmdc:mga08y16_103659_c1 nmdc:mga08y16_103659_c1_456_2024 484
275 3300006844 Ga0075428_100038222 Ga0075428_1000382223 485
276 3300031251 Ga0265327_10000012 Ga0265327_1000001246 486
277 3300006358 Ga0068871_100160269 Ga0068871_1001602691 487
278 3300021361 Ga0213872_10001347 Ga0213872_100013479 487
279 3300025942 Ga0207689_10057766 Ga0207689_100577662 487
280 3300039447 Ga0436361_0487065 Ga0436361_0487065_25715_27247 487
281 3300025242 Ga0209258_101216 Ga0209258_1012164 488
282 3300046524 Ga0495648_0009966 Ga0495648_0009966_1307_2896 488
283 3300049586 Ga0501070_0041404 Ga0501070_0041404_535_2106 488
284 3300003775 Ga0055524_1002112 Ga0055524_10021122 489
285 3300003794 Ga0055531_10007415 Ga0055531_100074152 489
286 3300005355 Ga0070671_100045615 Ga0070671_1000456152 489
287 3300009177 Ga0105248_10004159 Ga0105248_1000415913 489
288 3300012497 Ga0157319_1000008 Ga0157319_1000008263 489
289 3300025299 Ga0209256_1001935 Ga0209256_100193521 489
290 3300025304 Ga0209257_1005138 Ga0209257_10051389 489
291 3300042438 Ga0439459_0003283 Ga0439459_0003283_356_1945 489
292 3300042876 Ga0451577_0062539 Ga0451577_0062539_880_2454 489
293 3300048907 Ga0496104_0173374 Ga0496104_0173374_310_1890 489
294 3300048912 Ga0496109_0112155 Ga0496109_0112155_31_1611 489
295 3300048916 Ga0496113_0143898 Ga0496113_0143898_23_1603 489
296 3300050496 nmdc:mga07m45_31265_c1 nmdc:mga07m45_31265_c1_1217_2806 489
297 3300005337 Ga0070682_100034657 Ga0070682_1000346573 490
298 3300009148 Ga0105243_10060654 Ga0105243_100606542 490
299 3300031507 Ga0307509_10000175 Ga0307509_1000017537 490
300 3300031548 Ga0307408_100000416 Ga0307408_10000041626 490
301 3300037466 Ga0395898_0043495 Ga0395898_0043495_2448_3953 490
302 3300050496 nmdc:mga07m45_40358_c2 nmdc:mga07m45_40358_c2_377_1882 490
303 3300046471 Ga0495650_0025525 Ga0495650_0025525_845_2383 491
304 3300003794 Ga0055531_10011074 Ga0055531_100110743 492
305 3300006944 Ga0099823_1000021 Ga0099823_100002126 492
306 3300025273 Ga0209673_1004686 Ga0209673_10046862 492
307 3300025298 Ga0209050_1006270 Ga0209050_10062702 492
308 3300025303 Ga0209051_1001897 Ga0209051_10018973 492
309 3300025304 Ga0209257_1004508 Ga0209257_10045087 492
310 3300027296 Ga0209389_1002544 Ga0209389_100254412 492
311 3300002705 JGI25156J39149_1000151 JGI25156J39149_100015114 494
312 3300002738 JGI25154J39366_1000572 JGI25154J39366_100057210 494
313 3300002741 JGI25157J39369_1000193 JGI25157J39369_100019328 494
314 3300003752 Ga0055539_1000446 Ga0055539_10004466 494
315 3300005329 Ga0070683_100132941 Ga0070683_1001329412 494
316 3300005577 Ga0068857_100000127 Ga0068857_10000012739 494
317 3300005614 Ga0068856_100002855 Ga0068856_10000285512 494
318 3300025246 Ga0209646_1000261 Ga0209646_100026113 494
319 3300025250 Ga0209026_1000317 Ga0209026_100031713 494
320 3300025253 Ga0209677_100101 Ga0209677_10010160 494
321 3300025256 Ga0209759_1000422 Ga0209759_100042213 494
322 3300025914 Ga0207671_10029401 Ga0207671_100294012 494
323 3300025924 Ga0207694_10005730 Ga0207694_100057304 494
324 3300025949 Ga0207667_10167175 Ga0207667_101671752 494
325 3300026078 Ga0207702_10009905 Ga0207702_100099053 494
326 3300026116 Ga0207674_10000681 Ga0207674_1000068136 494
327 iso_pu_bacteria 2643221544 2643744972 494
328 3300025913 Ga0207695_10007523 Ga0207695_100075236 495
329 3300048908 Ga0496105_0087100 Ga0496105_0087100_654_2219 495
330 iso_pu_bacteria 2643221585 2643937324 495
331 iso_pu_bacteria 2643221656 2644318489 495
332 3300025960 Ga0207651_10001106 Ga0207651_100011066 496
333 3300026067 Ga0207678_10182164 Ga0207678_101821641 496
334 iso_pu_bacteria 2831864461 2831869282 496
335 3300021361 Ga0213872_10004976 Ga0213872_100049763 497
336 3300039447 Ga0436361_0141504 Ga0436361_0141504_1310_2902 497
337 3300031730 Ga0307516_10132175 Ga0307516_101321752 498
338 3300046457 Ga0495590_0000007 Ga0495590_0000007_322017_323615 498
339 iso_pu_bacteria 2643221639 2644222835 498
340 iso_pu_bacteria 2643221646 2644260707 498
341 iso_pu_bacteria 2738541337 2739058909 498
342 iso_pu_bacteria 2808606418 2809144503 498
343 3300046500 Ga0495596_0000667 Ga0495596_0000667_10284_11900 499
344 3300049586 Ga0501070_0078531 Ga0501070_0078531_15_1559 499
345 iso_pu_bacteria 2919404418 2919404460 499
346 iso_pu_bacteria 2932410948 2932412424 499
347 iso_pu_bacteria 2932416698 2932419939 499
348 3300003320 rootH2_10039996 rootH2_100399963 500
349 3300003323 rootH1_10047019 rootH1_100470191 500
350 3300003752 Ga0055539_1000198 Ga0055539_100019833 500
351 3300003756 Ga0055533_1000008 Ga0055533_100000843 500
352 3300003759 Ga0055525_1000951 Ga0055525_10009512 500
353 3300003771 Ga0055526_1000020 Ga0055526_100002048 500
354 3300003775 Ga0055524_1000015 Ga0055524_1000015108 500
355 3300005262 Ga0065165_1000016 Ga0065165_100001651 500
356 3300005563 Ga0068855_100002771 Ga0068855_1000027718 500
357 3300009093 Ga0105240_10029042 Ga0105240_100290421 500
358 3300021361 Ga0213872_10000469 Ga0213872_1000046930 500
359 3300025226 Ga0209674_100015 Ga0209674_100015619 500
360 3300025230 Ga0209563_100017 Ga0209563_100017716 500
361 3300025231 Ga0207427_100501 Ga0207427_10050117 500
362 3300025253 Ga0209677_100037 Ga0209677_100037216 500
363 3300025256 Ga0209759_1002330 Ga0209759_10023303 500
364 3300025273 Ga0209673_1011543 Ga0209673_10115433 500
365 3300025295 Ga0209564_1000008 Ga0209564_1000008502 500
366 3300025303 Ga0209051_1029734 Ga0209051_10297342 500
367 3300035086 Ga0373934_0047235 Ga0373934_0047235_127_1662 500
368 3300038443 Ga0395901_0015320 Ga0395901_0015320_1138_2673 500
369 3300039447 Ga0436361_0325950 Ga0436361_0325950_77452_79032 500
370 3300039447 Ga0436361_0410668 Ga0436361_0410668_13733_15274 500
371 3300042000 Ga0439437_000580 Ga0439437_000580_770_2320 500
372 3300042120 Ga0450917_000298 Ga0450917_000298_1125_2675 500
373 3300042127 Ga0450890_000183 Ga0450890_000183_445_1995 500
374 3300042129 Ga0450891_000477 Ga0450891_000477_573_2123 500
375 3300042144 Ga0450889_000296 Ga0450889_000296_2908_4458 500
376 3300042532 Ga0450893_0001467 Ga0450893_0001467_985_2535 500
377 3300046506 Ga0495583_0000166 Ga0495583_0000166_82814_84352 500
378 3300046507 Ga0495606_0001259 Ga0495606_0001259_3189_4727 500
379 3300046660 Ga0495625_0006322 Ga0495625_0006322_7170_8951 500
380 3300046694 Ga0495649_0000998 Ga0495649_0000998_19321_20859 500
381 3300046794 Ga0495589_0011604 Ga0495589_0011604_1629_3167 500
382 3300049742 Ga0501080_0017557 Ga0501080_0017557_3258_4805 500
383 3300050496 nmdc:mga07m45_11859_c1 nmdc:mga07m45_11859_c1_1275_2822 500
384 3300053177 Ga0500636_0016438 Ga0500636_0016438_1811_3346 500
385 3300003794 Ga0055531_10000007 Ga0055531_10000007135 501
386 3300005327 Ga0070658_10053486 Ga0070658_100534861 501
387 3300005327 Ga0070658_10119801 Ga0070658_101198012 501
388 3300005455 Ga0070663_100013590 Ga0070663_1000135903 501
389 3300005458 Ga0070681_10034453 Ga0070681_100344532 501
390 3300005530 Ga0070679_100002232 Ga0070679_10000223210 501
391 3300005563 Ga0068855_100039027 Ga0068855_1000390272 501
392 3300005578 Ga0068854_100023843 Ga0068854_1000238435 501
393 3300009093 Ga0105240_10074090 Ga0105240_100740902 501
394 3300013100 Ga0157373_10007942 Ga0157373_100079425 501
395 3300013104 Ga0157370_10027894 Ga0157370_100278946 501
396 3300013307 Ga0157372_10005140 Ga0157372_100051401 501
397 3300025298 Ga0209050_1002388 Ga0209050_100238810 501
398 3300025303 Ga0209051_1021887 Ga0209051_10218872 501
399 3300025303 Ga0209051_1024512 Ga0209051_10245122 501
400 3300025304 Ga0209257_1000021 Ga0209257_100002193 501
401 3300025909 Ga0207705_10007480 Ga0207705_100074803 501
402 3300025909 Ga0207705_10016730 Ga0207705_100167305 501
403 3300025909 Ga0207705_10071793 Ga0207705_100717932 501
404 3300025912 Ga0207707_10001039 Ga0207707_100010392 501
405 3300025913 Ga0207695_10239657 Ga0207695_102396571 501
406 3300025921 Ga0207652_10000017 Ga0207652_1000001764 501
407 3300025921 Ga0207652_10000040 Ga0207652_1000004051 501
408 3300025949 Ga0207667_10148911 Ga0207667_101489111 501
409 3300025981 Ga0207640_10026232 Ga0207640_100262324 501
410 3300026067 Ga0207678_10016390 Ga0207678_100163904 501
411 3300028794 Ga0307515_10144888 Ga0307515_101448882 501
412 3300035114 Ga0373939_0000020 Ga0373939_0000020_29353_30909 501
413 3300035121 Ga0373960_0001102 Ga0373960_0001102_52_1608 501
414 3300037471 Ga0395905_0010172 Ga0395905_0010172_6596_8152 501
415 3300039447 Ga0436361_0982530 Ga0436361_0982530_295_1839 501
416 3300039447 Ga0436361_1150605 Ga0436361_1150605_2080_3645 501
417 3300045051 Ga0451576_0000109 Ga0451576_0000109_152474_154018 501
418 3300053156 Ga0500622_0008241 Ga0500622_0008241_4213_5796 501
419 3300005347 Ga0070668_100020828 Ga0070668_1000208286 502
420 3300025294 Ga0209025_1008102 Ga0209025_10081022 502
421 3300025907 Ga0207645_10004284 Ga0207645_100042846 502
422 3300025972 Ga0207668_10034744 Ga0207668_100347442 502
423 3300045051 Ga0451576_0084937 Ga0451576_0084937_1497_3044 502
424 3300004625 Ga0055543_1004356 Ga0055543_10043562 503
425 3300005262 Ga0065165_1000942 Ga0065165_100094234 503
426 3300000545 CNXas_1000032 CNXas_100003211 504

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00854

PTR2

POT family

168

547

0.91

PF07690

MFS_1

Major Facilitator Superfamily

108

537

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uvm-assembly1.cif.gz_A in meso crystal structure of the pot family transporter peptso 0.9387 12 501
6ei3-assembly1.cif.gz_A crystal structure of auto inhibited pot family peptide transporter 0.932 15 504
4uvm-assembly1.cif.gz_A in meso crystal structure of the pot family transporter peptso 0.9117 12 501
2xut-assembly2.cif.gz_B crystal structure of a proton dependent oligopeptide (pot) family transporter. 0.9097 17 488
2xut-assembly2.cif.gz_B crystal structure of a proton dependent oligopeptide (pot) family transporter. 0.9059 17 488
ID Description Score Start End Superfamily
6ei3A00 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.932 15 504 1.20.1250.20
2xutB00 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9097 17 488 1.20.1250.20
2xutB00 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9059 17 488 1.20.1250.20
6ei3A00 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9057 15 504 1.20.1250.20
af_A0A0P0WBS7_11_296_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8847 28 214 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A848UUG8-F1-model_v4 MFS transporter 0.8944 18 216 GO:0016020
GO:0022857
AF-A0A101DKN3-F1-model_v4 deleted 0.8628 14 200
AF-A0A813BDY6-F1-model_v4 Uncharacterized protein 0.852 18 205 GO:0016020
AF-A0A2G4HE87-F1-model_v4 MFS transporter 0.8496 1 493 GO:0006857
GO:0016020
GO:0022857
AF-A0A101DKN3-F1-model_v4 deleted 0.8331 14 200

Feature Viewer

pLDDT pTM Quality
83.74 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map