F441208

General Info

Members Datasets Scaffolds Average Seq Length
426 162 426 180

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10455567|Ga0157375_104555672
Length 195
Sequence LRHRQALRNEWSPRQQHRNPNNTRPAILIILAISAAASLFLFWLIYKHPAADVSSTQLPFLPALNAVLNGLSATAILIGYTFIRARKIAAHRASMITAFIFSTLFLVSYILHHYLHGDVRFPHDAALRSVYLPLLASHIILAVIALPLVLVTFFFSLTGRFPQHRKIARWTFPLWLYVSVTGVITYVMLRLAQGS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
162 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 1.64
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10056152 3300003320 Bacteria 10098
2 rootH2_10250967 3300003320 Bacteria 1269
3 rootH1_10234201 3300003323 Unclassified 1008
4 Ga0070658_10036945 3300005327 Unclassified 3936
5 Ga0070658_10126228 3300005327 Bacteria 2130
6 Ga0070658_10296367 3300005327 Bacteria 1379
7 Ga0070658_10711333 3300005327 Unclassified 872
8 Ga0070683_100002284 3300005329 Bacteria 15191
9 Ga0070683_100005781 3300005329 Bacteria 10341
10 Ga0070683_100113199 3300005329 Bacteria 2561
11 Ga0070683_100223918 3300005329 Bacteria 1788
12 Ga0070683_100564969 3300005329 Unclassified 1088
13 Ga0070670_100010703 3300005331 Bacteria 7838
14 Ga0068869_100413603 3300005334 Bacteria 1111
15 Ga0070666_10302227 3300005335 Bacteria 1140
16 Ga0070680_100545485 3300005336 Bacteria 994
17 Ga0068868_100000110 3300005338 Bacteria 51175
18 Ga0068868_100012867 3300005338 Bacteria 6120
19 Ga0068868_100020327 3300005338 Bacteria 4986
20 Ga0070660_100048679 3300005339 Unclassified 3256
21 Ga0070661_100008297 3300005344 Bacteria 7173
22 Ga0070661_100014768 3300005344 Bacteria 5507
23 Ga0070661_100211968 3300005344 Bacteria 1483
24 Ga0070661_100396048 3300005344 Unclassified 1091
25 Ga0070668_100388098 3300005347 Bacteria 1190
26 Ga0070675_100155917 3300005354 Bacteria 1961
27 Ga0070671_100008461 3300005355 Bacteria 8245
28 Ga0070673_100239164 3300005364 Bacteria 1578
29 Ga0070667_100000289 3300005367 Bacteria 56919
30 Ga0070667_100196466 3300005367 Bacteria 1788
31 Ga0070714_100011594 3300005435 Bacteria 6998
32 Ga0070713_100074438 3300005436 Unclassified 2877
33 Ga0070713_100307157 3300005436 Bacteria 1462
34 Ga0070710_10136535 3300005437 Bacteria 1500
35 Ga0070663_100077936 3300005455 Bacteria 2428
36 Ga0070678_100186119 3300005456 Bacteria 1704
37 Ga0070681_10109967 3300005458 Unclassified 2696
38 Ga0070681_10345050 3300005458 Bacteria 1399
39 Ga0070681_10415709 3300005458 Unclassified 1257
40 Ga0070679_100044808 3300005530 Unclassified 4407
41 Ga0070684_100024584 3300005535 Bacteria 5055
42 Ga0070684_100053692 3300005535 Bacteria 3509
43 Ga0070684_100192708 3300005535 Unclassified 1855
44 Ga0068853_100001002 3300005539 Bacteria 19900
45 Ga0068853_100112609 3300005539 Bacteria 2418
46 Ga0070672_100028815 3300005543 Bacteria 4157
47 Ga0070665_100013491 3300005548 Bacteria 8222
48 Ga0070665_100129179 3300005548 Bacteria 2529
49 Ga0068855_100001519 3300005563 Bacteria 29079
50 Ga0068855_100001966 3300005563 Bacteria 25530
51 Ga0068855_100030086 3300005563 Bacteria 6494
52 Ga0068855_100032121 3300005563 Bacteria 6267
53 Ga0068855_100235411 3300005563 Bacteria 2048
54 Ga0068855_101116622 3300005563 Bacteria 823
55 Ga0070664_100074629 3300005564 Bacteria 2911
56 Ga0070664_100516406 3300005564 Bacteria 1102
57 Ga0068857_100032897 3300005577 Bacteria 4584
58 Ga0068857_100055464 3300005577 Bacteria 3517
59 Ga0068857_100237699 3300005577 Bacteria 1667
60 Ga0068857_100334006 3300005577 Bacteria 1401
61 Ga0068854_100274762 3300005578 Bacteria 1354
62 Ga0068854_100437154 3300005578 Bacteria 1090
63 Ga0068856_100000992 3300005614 Bacteria 30320
64 Ga0068856_100028065 3300005614 Bacteria 5493
65 Ga0068856_100038886 3300005614 Unclassified 4671
66 Ga0068856_100051475 3300005614 Bacteria 4060
67 Ga0068856_100160005 3300005614 Bacteria 2262
68 Ga0068856_100196276 3300005614 Bacteria 2032
69 Ga0068856_100315964 3300005614 Unclassified 1579
70 Ga0068856_100479441 3300005614 Bacteria 1265
71 Ga0068856_101018482 3300005614 Unclassified 846
72 Ga0068856_101027003 3300005614 Bacteria 842
73 Ga0068852_100000040 3300005616 Bacteria 93349
74 Ga0068852_100007323 3300005616 Bacteria 8049
75 Ga0068852_100009777 3300005616 Bacteria 7130
76 Ga0068852_100057020 3300005616 Bacteria 3379
77 Ga0068852_100161733 3300005616 Bacteria 2091
78 Ga0068859_100041238 3300005617 Bacteria 4637
79 Ga0068864_100183996 3300005618 Bacteria 1912
80 Ga0068861_100967724 3300005719 Bacteria 810
81 Ga0068851_10006517 3300005834 Bacteria 5331
82 Ga0068851_10014361 3300005834 Bacteria 3760
83 Ga0068851_10062154 3300005834 Bacteria 1916
84 Ga0068851_10279038 3300005834 Bacteria 955
85 Ga0068851_10289806 3300005834 Bacteria 938
86 Ga0068851_10753486 3300005834 Unclassified 602
87 Ga0068870_10840276 3300005840 Bacteria 644
88 Ga0068863_100153401 3300005841 Bacteria 2204
89 Ga0068858_100007565 3300005842 Bacteria 10494
90 Ga0068858_100118085 3300005842 Bacteria 2479
91 Ga0068860_100000556 3300005843 Bacteria 45389
92 Ga0068862_100503982 3300005844 Bacteria 1149
93 Ga0081540_1010419 3300005983 Bacteria 6298
94 Ga0070717_10344577 3300006028 Unclassified 1331
95 Ga0097621_100010237 3300006237 Bacteria 6849
96 Ga0097621_100863599 3300006237 Unclassified 841
97 Ga0068871_100046777 3300006358 Bacteria 3486
98 Ga0068865_100092854 3300006881 Bacteria 2193
99 Ga0097620_100041240 3300006931 Bacteria 4637
100 Ga0105240_10000130 3300009093 Bacteria 154390
101 Ga0105240_10000312 3300009093 Bacteria 93459
102 Ga0105240_10002414 3300009093 Bacteria 30034
103 Ga0105240_10009459 3300009093 Bacteria 13797
104 Ga0105240_10020078 3300009093 Bacteria 8920
105 Ga0105240_10055810 3300009093 Bacteria 4945
106 Ga0105240_10199926 3300009093 Unclassified 2343
107 Ga0105240_10218025 3300009093 Bacteria 2225
108 Ga0105240_10443565 3300009093 Bacteria 1454
109 Ga0105240_11410861 3300009093 Bacteria 732
110 Ga0105245_10000597 3300009098 Bacteria 32665
111 Ga0105245_10203797 3300009098 Unclassified 1901
112 Ga0105245_10526632 3300009098 Unclassified 1201
113 Ga0105247_10067446 3300009101 Bacteria 2229
114 Ga0105247_10109574 3300009101 Bacteria 1775
115 Ga0105241_10000074 3300009174 Bacteria 75523
116 Ga0105241_10000338 3300009174 Bacteria 35475
117 Ga0105241_10000993 3300009174 Bacteria 21493
118 Ga0105241_10019757 3300009174 Bacteria 4972
119 Ga0105241_10108898 3300009174 Bacteria 2215
120 Ga0105241_10123181 3300009174 Bacteria 2091
121 Ga0105241_10133327 3300009174 Bacteria 2014
122 Ga0105241_10203403 3300009174 Unclassified 1655
123 Ga0105241_10212821 3300009174 Bacteria 1620
124 Ga0105241_10258831 3300009174 Bacteria 1478
125 Ga0105242_10590415 3300009176 Bacteria 1071
126 Ga0105248_10000002 3300009177 Bacteria 1054120
127 Ga0105248_10010546 3300009177 Bacteria 10180
128 Ga0105248_10140131 3300009177 Bacteria 2728
129 Ga0105248_10573959 3300009177 Bacteria 1273
130 Ga0105237_10064156 3300009545 Bacteria 3670
131 Ga0105237_10082234 3300009545 Bacteria 3211
132 Ga0105237_10124815 3300009545 Bacteria 2569
133 Ga0105237_10219419 3300009545 Bacteria 1902
134 Ga0105237_10270933 3300009545 Unclassified 1701
135 Ga0105237_10375083 3300009545 Bacteria 1427
136 Ga0105237_10519532 3300009545 Unclassified 1197
137 Ga0105238_10004975 3300009551 Bacteria 13141
138 Ga0105238_10011181 3300009551 Bacteria 9029
139 Ga0105238_10026501 3300009551 Bacteria 5911
140 Ga0105238_10027775 3300009551 Bacteria 5767
141 Ga0105238_10036091 3300009551 Bacteria 5025
142 Ga0105238_10074609 3300009551 Bacteria 3384
143 Ga0105238_10083898 3300009551 Bacteria 3175
144 Ga0105238_10105718 3300009551 Bacteria 2796
145 Ga0105238_10291020 3300009551 Bacteria 1615
146 Ga0105238_10408778 3300009551 Bacteria 1351
147 Ga0105239_10194580 3300010375 Bacteria 2270
148 Ga0105239_10201258 3300010375 Bacteria 2231
149 Ga0105239_10236110 3300010375 Bacteria 2052
150 Ga0105239_10742806 3300010375 Bacteria 1123
151 Ga0105246_10001354 3300011119 Bacteria 14450
152 Ga0157373_10185081 3300013100 Bacteria 1467
153 Ga0157373_10294810 3300013100 Bacteria 1150
154 Ga0157373_10359504 3300013100 Unclassified 1039
155 Ga0157371_10292612 3300013102 Unclassified 1178
156 Ga0157371_10296342 3300013102 Bacteria 1170
157 Ga0157371_10389596 3300013102 Unclassified 1018
158 Ga0157371_10765946 3300013102 Unclassified 726
159 Ga0157370_10000164 3300013104 Bacteria 81413
160 Ga0157370_10025942 3300013104 Bacteria 5793
161 Ga0157370_10770393 3300013104 Unclassified 876
162 Ga0157369_10000209 3300013105 Bacteria 81584
163 Ga0157369_10006182 3300013105 Bacteria 13896
164 Ga0157369_10030594 3300013105 Bacteria 5936
165 Ga0157369_10039943 3300013105 Bacteria 5126
166 Ga0157369_10074239 3300013105 Bacteria 3647
167 Ga0157369_10087948 3300013105 Bacteria 3317
168 Ga0157369_10230334 3300013105 Bacteria 1937
169 Ga0157369_10262810 3300013105 Bacteria 1800
170 Ga0157369_10300891 3300013105 Unclassified 1668
171 Ga0157369_10777641 3300013105 Bacteria 984
172 Ga0157374_10004204 3300013296 Bacteria 12099
173 Ga0157374_10009547 3300013296 Bacteria 8332
174 Ga0157374_10105761 3300013296 Bacteria 2703
175 Ga0157374_10120201 3300013296 Bacteria 2535
176 Ga0157374_10218029 3300013296 Bacteria 1872
177 Ga0157374_10304859 3300013296 Bacteria 1576
178 Ga0157378_10014218 3300013297 Bacteria 6966
179 Ga0157378_10094064 3300013297 Unclassified 2729
180 Ga0157378_10255151 3300013297 Bacteria 1680
181 Ga0157378_10377538 3300013297 Bacteria 1391
182 Ga0157378_10380672 3300013297 Unclassified 1386
183 Ga0163162_10014802 3300013306 Bacteria 7619
184 Ga0163162_10084160 3300013306 Unclassified 3256
185 Ga0157372_10001822 3300013307 Bacteria 23107
186 Ga0157372_10003679 3300013307 Bacteria 16484
187 Ga0157372_10010824 3300013307 Bacteria 9712
188 Ga0157372_10011332 3300013307 Bacteria 9481
189 Ga0157372_10090464 3300013307 Bacteria 3479
190 Ga0157372_10100095 3300013307 Bacteria 3307
191 Ga0157372_10121109 3300013307 Bacteria 3005
192 Ga0157372_10181421 3300013307 Bacteria 2437
193 Ga0157372_10311707 3300013307 Bacteria 1832
194 Ga0157372_10385182 3300013307 Unclassified 1634
195 Ga0157375_10008717 3300013308 Bacteria 8885
196 Ga0157375_10188059 3300013308 Bacteria 2219
197 Ga0157375_10455567 3300013308 Bacteria 1445
198 Ga0157375_11453927 3300013308 Unclassified 808
199 Ga0163163_10000679 3300014325 Bacteria 29109
200 Ga0157379_10002279 3300014968 Bacteria 15984
201 Ga0157379_10035375 3300014968 Bacteria 4453
202 Ga0157379_10468152 3300014968 Bacteria 1165
203 Ga0157379_10603325 3300014968 Bacteria 1025
204 Ga0157376_10008029 3300014969 Bacteria 7580
205 Ga0157376_10012640 3300014969 Bacteria 6275
206 Ga0157376_10135672 3300014969 Bacteria 2202
207 Ga0157376_10185457 3300014969 Bacteria 1905
208 Ga0157376_11631503 3300014969 Unclassified 679
209 Ga0206350_10765219 3300020080 Bacteria 1382
210 Ga0213872_10008058 3300021361 Bacteria 5122
211 Ga0207697_10048555 3300025315 Bacteria 1751
212 Ga0207656_10012858 3300025321 Bacteria 3188
213 Ga0207656_10320694 3300025321 Unclassified 769
214 Ga0207710_10002071 3300025900 Bacteria 9510
215 Ga0207647_10120376 3300025904 Bacteria 1548
216 Ga0207647_10331269 3300025904 Bacteria 863
217 Ga0207705_10064773 3300025909 Unclassified 2641
218 Ga0207654_10000612 3300025911 Bacteria 20135
219 Ga0207654_10000773 3300025911 Bacteria 17586
220 Ga0207654_10097662 3300025911 Bacteria 1804
221 Ga0207654_10139063 3300025911 Unclassified 1546
222 Ga0207654_10512649 3300025911 Unclassified 848
223 Ga0207707_10606557 3300025912 Bacteria 926
224 Ga0207695_10000028 3300025913 Bacteria 551835
225 Ga0207695_10000030 3300025913 Bacteria 533735
226 Ga0207695_10000292 3300025913 Bacteria 123721
227 Ga0207695_10018054 3300025913 Bacteria 8167
228 Ga0207695_10040953 3300025913 Bacteria 4961
229 Ga0207695_10062832 3300025913 Bacteria 3831
230 Ga0207695_10084359 3300025913 Bacteria 3208
231 Ga0207695_10101790 3300025913 Bacteria 2867
232 Ga0207671_10000487 3300025914 Bacteria 53821
233 Ga0207671_10051482 3300025914 Bacteria 3052
234 Ga0207671_10162188 3300025914 Bacteria 1732
235 Ga0207671_10275010 3300025914 Bacteria 1327
236 Ga0207671_10782353 3300025914 Unclassified 757
237 Ga0207693_10502312 3300025915 Bacteria 947
238 Ga0207693_10966732 3300025915 Bacteria 651
239 Ga0207660_10124880 3300025917 Bacteria 1953
240 Ga0207657_10014396 3300025919 Bacteria 7724
241 Ga0207657_10245644 3300025919 Bacteria 1428
242 Ga0207649_10007100 3300025920 Bacteria 6087
243 Ga0207649_10043414 3300025920 Unclassified 2749
244 Ga0207649_10138663 3300025920 Bacteria 1661
245 Ga0207649_10148054 3300025920 Bacteria 1614
246 Ga0207649_10845390 3300025920 Unclassified 716
247 Ga0207652_10335769 3300025921 Bacteria 1364
248 Ga0207694_10000160 3300025924 Bacteria 68770
249 Ga0207694_10004246 3300025924 Bacteria 11225
250 Ga0207694_10007101 3300025924 Bacteria 8510
251 Ga0207694_10011747 3300025924 Bacteria 6608
252 Ga0207694_10037196 3300025924 Unclassified 3737
253 Ga0207694_10191753 3300025924 Bacteria 1660
254 Ga0207694_10229385 3300025924 Bacteria 1516
255 Ga0207650_10006584 3300025925 Bacteria 7921
256 Ga0207687_10095181 3300025927 Bacteria 2181
257 Ga0207687_10229241 3300025927 Bacteria 1467
258 Ga0207700_10069114 3300025928 Bacteria 2710
259 Ga0207700_10160289 3300025928 Unclassified 1868
260 Ga0207700_10303792 3300025928 Bacteria 1379
261 Ga0207664_10037931 3300025929 Bacteria 3733
262 Ga0207690_10523895 3300025932 Unclassified 961
263 Ga0207706_10004501 3300025933 Bacteria 13087
264 Ga0207691_10010108 3300025940 Bacteria 9057
265 Ga0207711_10000076 3300025941 Bacteria 106663
266 Ga0207711_10054172 3300025941 Bacteria 3441
267 Ga0207711_10184940 3300025941 Bacteria 1896
268 Ga0207711_10579438 3300025941 Bacteria 1047
269 Ga0207689_10008077 3300025942 Bacteria 9179
270 Ga0207689_10036605 3300025942 Bacteria 4074
271 Ga0207661_10003957 3300025944 Bacteria 10347
272 Ga0207661_10009281 3300025944 Bacteria 7051
273 Ga0207661_10022139 3300025944 Bacteria 4779
274 Ga0207661_10403163 3300025944 Bacteria 1240
275 Ga0207661_10945373 3300025944 Bacteria 794
276 Ga0207679_10249523 3300025945 Bacteria 1508
277 Ga0207667_10003157 3300025949 Bacteria 20386
278 Ga0207667_10017972 3300025949 Bacteria 7945
279 Ga0207667_10037489 3300025949 Bacteria 5181
280 Ga0207667_10073995 3300025949 Unclassified 3539
281 Ga0207667_10075476 3300025949 Bacteria 3500
282 Ga0207667_10229992 3300025949 Bacteria 1899
283 Ga0207667_10512120 3300025949 Bacteria 1216
284 Ga0207651_10138695 3300025960 Unclassified 1875
285 Ga0207668_10325524 3300025972 Bacteria 1277
286 Ga0207640_10099328 3300025981 Bacteria 2037
287 Ga0207658_10000549 3300025986 Bacteria 34004
288 Ga0207658_10319293 3300025986 Bacteria 1344
289 Ga0207677_10000055 3300026023 Bacteria 98214
290 Ga0207703_10005159 3300026035 Bacteria 10560
291 Ga0207703_10995343 3300026035 Bacteria 804
292 Ga0207639_10000145 3300026041 Bacteria 53212
293 Ga0207639_10006440 3300026041 Bacteria 7984
294 Ga0207639_10936944 3300026041 Unclassified 810
295 Ga0207678_10047506 3300026067 Bacteria 3712
296 Ga0207702_10013724 3300026078 Bacteria 6730
297 Ga0207702_10055912 3300026078 Bacteria 3348
298 Ga0207702_10227229 3300026078 Unclassified 1742
299 Ga0207702_10963693 3300026078 Unclassified 846
300 Ga0207641_10016408 3300026088 Bacteria 6064
301 Ga0207641_10683528 3300026088 Bacteria 1010
302 Ga0207676_10008244 3300026095 Bacteria 7412
303 Ga0207676_11422097 3300026095 Bacteria 690
304 Ga0207674_10000799 3300026116 Bacteria 40975
305 Ga0207674_10001106 3300026116 Bacteria 35038
306 Ga0207674_10047109 3300026116 Bacteria 4422
307 Ga0207674_10484458 3300026116 Unclassified 1195
308 Ga0207674_10640970 3300026116 Bacteria 1026
309 Ga0207675_101059324 3300026118 Bacteria 830
310 Ga0207683_10003009 3300026121 Bacteria 14727
311 Ga0207698_10000045 3300026142 Bacteria 93629
312 Ga0207698_10044115 3300026142 Bacteria 3347
313 Ga0207698_10062554 3300026142 Bacteria 2907
314 Ga0207698_10064499 3300026142 Bacteria 2871
315 Ga0207698_10098537 3300026142 Bacteria 2416
316 Ga0207698_10280816 3300026142 Unclassified 1540
317 Ga0207698_10314828 3300026142 Unclassified 1463
318 Ga0207698_11121590 3300026142 Bacteria 800
319 Ga0268266_10002193 3300028379 Bacteria 21353
320 Ga0268266_10104601 3300028379 Bacteria 2500
321 Ga0268265_10178791 3300028380 Bacteria 1821
322 Ga0268264_10000433 3300028381 Bacteria 57744
323 Ga0268264_11048932 3300028381 Bacteria 823
324 Ga0265318_10006756 3300028577 Bacteria 5250
325 Ga0265323_10018050 3300028653 Unclassified 2735
326 Ga0265336_10002707 3300028666 Bacteria 7174
327 Ga0265336_10027634 3300028666 Bacteria 1775
328 Ga0265338_10002827 3300028800 Bacteria 25346
329 Ga0265338_10007614 3300028800 Bacteria 13369
330 Ga0265338_10012765 3300028800 Bacteria 9554
331 Ga0265338_10042425 3300028800 Bacteria 4236
332 Ga0265338_10125826 3300028800 Bacteria 2034
333 Ga0265338_10256325 3300028800 Unclassified 1288
334 Ga0265338_10544515 3300028800 Bacteria 813
335 Ga0265760_10177517 3300031090 Unclassified 710
336 Ga0265330_10000816 3300031235 Bacteria 19651
337 Ga0265330_10003204 3300031235 Bacteria 8638
338 Ga0265330_10015555 3300031235 Bacteria 3518
339 Ga0265330_10118529 3300031235 Unclassified 1128
340 Ga0265332_10015162 3300031238 Unclassified 3404
341 Ga0265332_10057576 3300031238 Bacteria 1665
342 Ga0265332_10163411 3300031238 Bacteria 930
343 Ga0265328_10002960 3300031239 Bacteria 7588
344 Ga0265328_10013165 3300031239 Bacteria 3279
345 Ga0265328_10046777 3300031239 Bacteria 1590
346 Ga0265320_10042479 3300031240 Bacteria 2255
347 Ga0265320_10052680 3300031240 Unclassified 1969
348 Ga0265325_10000020 3300031241 Bacteria 125088
349 Ga0265325_10001864 3300031241 Bacteria 14566
350 Ga0265325_10015258 3300031241 Bacteria 4324
351 Ga0265325_10026538 3300031241 Unclassified 3136
352 Ga0265325_10039071 3300031241 Bacteria 2501
353 Ga0265325_10113508 3300031241 Bacteria 1314
354 Ga0265329_10034349 3300031242 Unclassified 1638
355 Ga0265340_10004071 3300031247 Bacteria 8210
356 Ga0265340_10024741 3300031247 Bacteria 3047
357 Ga0265340_10074338 3300031247 Bacteria 1607
358 Ga0265340_10078547 3300031247 Bacteria 1556
359 Ga0265339_10000099 3300031249 Bacteria 72992
360 Ga0265339_10005494 3300031249 Bacteria 8442
361 Ga0265339_10008144 3300031249 Bacteria 6691
362 Ga0265339_10019890 3300031249 Bacteria 3930
363 Ga0265339_10050488 3300031249 Bacteria 2274
364 Ga0265339_10129451 3300031249 Bacteria 1292
365 Ga0265331_10029162 3300031250 Unclassified 2756
366 Ga0265331_10080842 3300031250 Unclassified 1510
367 Ga0265331_10261246 3300031250 Bacteria 776
368 Ga0265316_10001487 3300031344 Bacteria 25109
369 Ga0265316_10006456 3300031344 Bacteria 11203
370 Ga0265316_10007401 3300031344 Bacteria 10348
371 Ga0265316_10014670 3300031344 Bacteria 6883
372 Ga0265316_10028017 3300031344 Bacteria 4652
373 Ga0265316_10098147 3300031344 Unclassified 2229
374 Ga0265316_10325168 3300031344 Unclassified 1116
375 Ga0265313_10001608 3300031595 Bacteria 20979
376 Ga0265313_10003466 3300031595 Bacteria 12737
377 Ga0265313_10031102 3300031595 Unclassified 2739
378 Ga0265314_10000033 3300031711 Bacteria 254594
379 Ga0265314_10047808 3300031711 Bacteria 3008
380 Ga0265314_10101232 3300031711 Bacteria 1851
381 Ga0265314_10104515 3300031711 Bacteria 1813
382 Ga0265314_10184422 3300031711 Bacteria 1247
383 Ga0265314_10319477 3300031711 Unclassified 864
384 Ga0265342_10000858 3300031712 Bacteria 30317
385 Ga0265342_10002462 3300031712 Bacteria 15963
386 Ga0265342_10003866 3300031712 Bacteria 12052
387 Ga0265342_10006202 3300031712 Bacteria 8937
388 Ga0265342_10135738 3300031712 Bacteria 1375
389 Ga0265342_10138441 3300031712 Bacteria 1359
390 Ga0265342_10182660 3300031712 Bacteria 1148
391 Ga0265342_10245442 3300031712 Bacteria 957
392 Ga0373954_0168507 3300035118 Bacteria 1072
393 Ga0373957_0142746 3300035120 Bacteria 980
394 Ga0373955_0429987 3300035172 Bacteria 804
395 Ga0373933_0007238 3300035724 Bacteria 6049
396 Ga0373937_0006329 3300036401 Bacteria 10209
397 Ga0395900_1158340 3300037418 Bacteria 689
398 Ga0395901_0579203 3300038443 Bacteria 1134
399 Ga0395901_0884752 3300038443 Bacteria 876
400 Ga0436360_0525527 3300039438 Bacteria 3317
401 Ga0436360_0572458 3300039438 Bacteria 1135
402 Ga0436361_0612059 3300039447 Bacteria 18589
403 Ga0436361_0907623 3300039447 Bacteria 31912
404 Ga0436361_0982291 3300039447 Bacteria 9851
405 Ga0439448_0206122 3300042005 Bacteria 690
406 Ga0451577_0145521 3300042876 Bacteria 2131
407 Ga0466963_0017492 3300044694 Bacteria 4469
408 Ga0466958_0376891 3300045836 Bacteria 915
409 Ga0466958_0480202 3300045836 Bacteria 806
410 Ga0495629_0037824 3300046459 Bacteria 3401
411 Ga0495651_0331203 3300046462 Bacteria 1012
412 Ga0495665_0153136 3300046531 Bacteria 1203
413 Ga0495600_0518932 3300046809 Bacteria 731
414 Ga0495684_0421917 3300047471 Bacteria 932
415 Ga0495686_0004114 3300047472 Bacteria 12111
416 Ga0495602_0057044 3300048088 Bacteria 3430
417 Ga0495602_0223921 3300048088 Bacteria 1418
418 Ga0496101_0255481 3300048904 Bacteria 1366
419 Ga0496104_0338565 3300048907 Bacteria 1417
420 Ga0496106_0165074 3300048909 Bacteria 1753
421 Ga0496106_0915797 3300048909 Unclassified 692
422 Ga0496113_0747625 3300048916 Bacteria 779
423 Ga0496114_0028115 3300048917 Bacteria 4612
424 Ga0496114_0145421 3300048917 Bacteria 2055
425 Ga0500595_025743 3300053119 Bacteria 2034
426 Ga0587117_020648 3300059627 Unclassified 915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0153136 Ga0495665_0153136_562_1119 137
2 3300014968 Ga0157379_10035375 Ga0157379_100353754 149
3 3300014969 Ga0157376_11631503 Ga0157376_116315031 149
4 3300048917 Ga0496114_0145421 Ga0496114_0145421_1056_1613 149
5 3300009177 Ga0105248_10140131 Ga0105248_101401313 150
6 3300005834 Ga0068851_10753486 Ga0068851_107534861 151
7 3300028800 Ga0265338_10256325 Ga0265338_102563253 154
8 3300031595 Ga0265313_10031102 Ga0265313_100311022 154
9 3300005563 Ga0068855_100235411 Ga0068855_1002354112 155
10 3300025949 Ga0207667_10229992 Ga0207667_102299922 155
11 3300048909 Ga0496106_0915797 Ga0496106_0915797_11_484 156
12 3300005548 Ga0070665_100129179 Ga0070665_1001291793 157
13 3300028379 Ga0268266_10104601 Ga0268266_101046012 157
14 3300037418 Ga0395900_1158340 Ga0395900_1158340_168_665 157
15 3300005344 Ga0070661_100014768 Ga0070661_1000147687 158
16 3300005455 Ga0070663_100077936 Ga0070663_1000779363 158
17 3300005548 Ga0070665_100013491 Ga0070665_1000134912 158
18 3300005616 Ga0068852_100161733 Ga0068852_1001617332 158
19 3300005840 Ga0068870_10840276 Ga0068870_108402761 158
20 3300006237 Ga0097621_100863599 Ga0097621_1008635992 158
21 3300009093 Ga0105240_10009459 Ga0105240_1000945910 158
22 3300009098 Ga0105245_10526632 Ga0105245_105266322 158
23 3300009174 Ga0105241_10019757 Ga0105241_100197573 158
24 3300009177 Ga0105248_10010546 Ga0105248_100105469 158
25 3300009545 Ga0105237_10219419 Ga0105237_102194192 158
26 3300009551 Ga0105238_10004975 Ga0105238_1000497510 158
27 3300013296 Ga0157374_10009547 Ga0157374_100095474 158
28 3300013297 Ga0157378_10380672 Ga0157378_103806722 158
29 3300013306 Ga0163162_10084160 Ga0163162_100841605 158
30 3300014968 Ga0157379_10468152 Ga0157379_104681521 158
31 3300014969 Ga0157376_10135672 Ga0157376_101356721 158
32 3300025913 Ga0207695_10000030 Ga0207695_1000003079 158
33 3300025915 Ga0207693_10966732 Ga0207693_109667321 158
34 3300025920 Ga0207649_10043414 Ga0207649_100434142 158
35 3300025924 Ga0207694_10007101 Ga0207694_100071015 158
36 3300025941 Ga0207711_10184940 Ga0207711_101849403 158
37 3300026067 Ga0207678_10047506 Ga0207678_100475063 158
38 3300026095 Ga0207676_11422097 Ga0207676_114220971 158
39 3300026142 Ga0207698_10098537 Ga0207698_100985372 158
40 3300028379 Ga0268266_10002193 Ga0268266_1000219312 158
41 3300031090 Ga0265760_10177517 Ga0265760_101775172 158
42 3300031239 Ga0265328_10002960 Ga0265328_100029609 159
43 3300031249 Ga0265339_10000099 Ga0265339_1000009930 159
44 3300031712 Ga0265342_10000858 Ga0265342_1000085810 159
45 3300005334 Ga0068869_100413603 Ga0068869_1004136032 161
46 3300005338 Ga0068868_100012867 Ga0068868_1000128675 161
47 3300005354 Ga0070675_100155917 Ga0070675_1001559173 161
48 3300005456 Ga0070678_100186119 Ga0070678_1001861192 161
49 3300005543 Ga0070672_100028815 Ga0070672_1000288154 161
50 3300005564 Ga0070664_100516406 Ga0070664_1005164062 161
51 3300005614 Ga0068856_101027003 Ga0068856_1010270031 161
52 3300005834 Ga0068851_10279038 Ga0068851_102790382 161
53 3300013296 Ga0157374_10105761 Ga0157374_101057613 161
54 3300013297 Ga0157378_10094064 Ga0157378_100940643 161
55 3300013308 Ga0157375_11453927 Ga0157375_114539272 161
56 3300025321 Ga0207656_10320694 Ga0207656_103206941 161
57 3300025933 Ga0207706_10004501 Ga0207706_100045017 161
58 3300025940 Ga0207691_10010108 Ga0207691_100101082 161
59 3300025942 Ga0207689_10036605 Ga0207689_100366052 161
60 3300026088 Ga0207641_10683528 Ga0207641_106835282 161
61 3300026121 Ga0207683_10003009 Ga0207683_1000300911 161
62 3300028666 Ga0265336_10002707 Ga0265336_100027077 161
63 3300048916 Ga0496113_0747625 Ga0496113_0747625_65_625 161
64 3300028800 Ga0265338_10544515 Ga0265338_105445152 163
65 3300031235 Ga0265330_10003204 Ga0265330_100032045 163
66 3300031250 Ga0265331_10261246 Ga0265331_102612461 163
67 3300031344 Ga0265316_10325168 Ga0265316_103251682 163
68 3300035172 Ga0373955_0429987 Ga0373955_0429987_17_577 165
69 3300046462 Ga0495651_0331203 Ga0495651_0331203_78_638 165
70 3300046809 Ga0495600_0518932 Ga0495600_0518932_107_667 165
71 3300005327 Ga0070658_10036945 Ga0070658_100369451 166
72 3300005339 Ga0070660_100048679 Ga0070660_1000486793 166
73 3300005458 Ga0070681_10109967 Ga0070681_101099673 166
74 3300005530 Ga0070679_100044808 Ga0070679_1000448085 166
75 3300005535 Ga0070684_100192708 Ga0070684_1001927082 166
76 3300005563 Ga0068855_101116622 Ga0068855_1011166221 166
77 3300005578 Ga0068854_100274762 Ga0068854_1002747622 166
78 3300005614 Ga0068856_100315964 Ga0068856_1003159643 166
79 3300005616 Ga0068852_100007323 Ga0068852_1000073235 166
80 3300009093 Ga0105240_10199926 Ga0105240_101999262 166
81 3300009545 Ga0105237_10270933 Ga0105237_102709333 166
82 3300009551 Ga0105238_10026501 Ga0105238_100265015 166
83 3300013102 Ga0157371_10296342 Ga0157371_102963422 166
84 3300013104 Ga0157370_10025942 Ga0157370_100259423 166
85 3300013105 Ga0157369_10300891 Ga0157369_103008913 166
86 3300013296 Ga0157374_10304859 Ga0157374_103048591 166
87 3300013307 Ga0157372_10011332 Ga0157372_100113326 166
88 3300025909 Ga0207705_10064773 Ga0207705_100647732 166
89 3300025914 Ga0207671_10275010 Ga0207671_102750102 166
90 3300025915 Ga0207693_10502312 Ga0207693_105023122 166
91 3300025919 Ga0207657_10014396 Ga0207657_100143963 166
92 3300025921 Ga0207652_10335769 Ga0207652_103357692 166
93 3300025924 Ga0207694_10011747 Ga0207694_100117477 166
94 3300025944 Ga0207661_10945373 Ga0207661_109453732 166
95 3300025949 Ga0207667_10073995 Ga0207667_100739955 166
96 3300026078 Ga0207702_10227229 Ga0207702_102272293 166
97 3300026142 Ga0207698_10314828 Ga0207698_103148282 166
98 3300038443 Ga0395901_0579203 Ga0395901_0579203_314_862 166
99 3300047472 Ga0495686_0004114 Ga0495686_0004114_6465_7040 166
100 3300028653 Ga0265323_10018050 Ga0265323_100180503 167
101 3300031241 Ga0265325_10039071 Ga0265325_100390713 167
102 3300031247 Ga0265340_10024741 Ga0265340_100247412 167
103 3300031344 Ga0265316_10014670 Ga0265316_100146708 167
104 3300031712 Ga0265342_10002462 Ga0265342_100024626 167
105 3300039447 Ga0436361_0982291 Ga0436361_0982291_3430_3987 167
106 3300003320 rootH2_10250967 rootH2_102509672 168
107 3300048909 Ga0496106_0165074 Ga0496106_0165074_273_833 169
108 3300005983 Ga0081540_1010419 Ga0081540_10104196 170
109 3300014969 Ga0157376_10008029 Ga0157376_100080293 170
110 3300031344 Ga0265316_10098147 Ga0265316_100981474 170
111 3300031711 Ga0265314_10319477 Ga0265314_103194772 170
112 3300005336 Ga0070680_100545485 Ga0070680_1005454852 173
113 3300005347 Ga0070668_100388098 Ga0070668_1003880982 173
114 3300005367 Ga0070667_100196466 Ga0070667_1001964662 173
115 3300005458 Ga0070681_10415709 Ga0070681_104157093 173
116 3300009174 Ga0105241_10258831 Ga0105241_102588313 173
117 3300013102 Ga0157371_10292612 Ga0157371_102926122 173
118 3300013105 Ga0157369_10777641 Ga0157369_107776412 173
119 3300025912 Ga0207707_10606557 Ga0207707_106065571 173
120 3300025917 Ga0207660_10124880 Ga0207660_101248803 173
121 3300025919 Ga0207657_10245644 Ga0207657_102456442 173
122 3300025932 Ga0207690_10523895 Ga0207690_105238952 173
123 3300025986 Ga0207658_10319293 Ga0207658_103192932 173
124 3300028800 Ga0265338_10125826 Ga0265338_101258264 173
125 3300031235 Ga0265330_10015555 Ga0265330_100155552 173
126 3300031241 Ga0265325_10001864 Ga0265325_1000186411 173
127 3300031249 Ga0265339_10008144 Ga0265339_100081445 173
128 3300031344 Ga0265316_10006456 Ga0265316_100064569 173
129 3300031595 Ga0265313_10003466 Ga0265313_100034669 173
130 3300031711 Ga0265314_10184422 Ga0265314_101844222 173
131 3300031712 Ga0265342_10006202 Ga0265342_100062023 173
132 3300005327 Ga0070658_10711333 Ga0070658_107113332 174
133 3300031235 Ga0265330_10118529 Ga0265330_101185292 174
134 3300031238 Ga0265332_10057576 Ga0265332_100575763 174
135 3300031241 Ga0265325_10015258 Ga0265325_100152582 174
136 3300031247 Ga0265340_10074338 Ga0265340_100743383 174
137 3300031249 Ga0265339_10129451 Ga0265339_101294512 174
138 3300031712 Ga0265342_10135738 Ga0265342_101357382 174
139 3300031712 Ga0265342_10182660 Ga0265342_101826603 174
140 3300031712 Ga0265342_10245442 Ga0265342_102454421 174
141 3300013297 Ga0157378_10255151 Ga0157378_102551512 175
142 3300025928 Ga0207700_10303792 Ga0207700_103037922 175
143 3300028577 Ga0265318_10006756 Ga0265318_100067567 175
144 3300028666 Ga0265336_10027634 Ga0265336_100276341 175
145 3300028800 Ga0265338_10002827 Ga0265338_100028279 175
146 3300028800 Ga0265338_10042425 Ga0265338_100424256 175
147 3300031235 Ga0265330_10000816 Ga0265330_100008163 175
148 3300031238 Ga0265332_10015162 Ga0265332_100151623 175
149 3300031239 Ga0265328_10013165 Ga0265328_100131654 175
150 3300031240 Ga0265320_10052680 Ga0265320_100526802 175
151 3300031241 Ga0265325_10000020 Ga0265325_10000020102 175
152 3300031242 Ga0265329_10034349 Ga0265329_100343492 175
153 3300031247 Ga0265340_10004071 Ga0265340_100040717 175
154 3300031249 Ga0265339_10005494 Ga0265339_100054947 175
155 3300031250 Ga0265331_10080842 Ga0265331_100808422 175
156 3300031344 Ga0265316_10001487 Ga0265316_100014878 175
157 3300031595 Ga0265313_10001608 Ga0265313_1000160815 175
158 3300031711 Ga0265314_10000033 Ga0265314_1000003334 175
159 3300031711 Ga0265314_10047808 Ga0265314_100478084 175
160 3300031712 Ga0265342_10003866 Ga0265342_1000386610 175
161 3300042876 Ga0451577_0145521 Ga0451577_0145521_1082_1630 175
162 3300009101 Ga0105247_10109574 Ga0105247_101095742 176
163 3300021361 Ga0213872_10008058 Ga0213872_100080582 176
164 3300039438 Ga0436360_0525527 Ga0436360_0525527_2551_3108 176
165 3300039438 Ga0436360_0572458 Ga0436360_0572458_323_877 176
166 3300039447 Ga0436361_0612059 Ga0436361_0612059_2876_3433 176
167 3300039447 Ga0436361_0907623 Ga0436361_0907623_1337_1915 176
168 3300005437 Ga0070710_10136535 Ga0070710_101365352 177
169 3300009093 Ga0105240_11410861 Ga0105240_114108612 177
170 3300009177 Ga0105248_10000002 Ga0105248_10000002845 177
171 3300009177 Ga0105248_10573959 Ga0105248_105739591 177
172 3300009551 Ga0105238_10408778 Ga0105238_104087781 177
173 3300025928 Ga0207700_10069114 Ga0207700_100691142 177
174 3300025941 Ga0207711_10000076 Ga0207711_100000768 177
175 3300025941 Ga0207711_10054172 Ga0207711_100541722 177
176 3300025941 Ga0207711_10579438 Ga0207711_105794381 177
177 3300028800 Ga0265338_10012765 Ga0265338_100127658 177
178 3300031239 Ga0265328_10046777 Ga0265328_100467771 177
179 3300031240 Ga0265320_10042479 Ga0265320_100424794 177
180 3300031241 Ga0265325_10026538 Ga0265325_100265383 177
181 3300031241 Ga0265325_10113508 Ga0265325_101135082 177
182 3300031247 Ga0265340_10078547 Ga0265340_100785472 177
183 3300031249 Ga0265339_10050488 Ga0265339_100504882 177
184 3300031250 Ga0265331_10029162 Ga0265331_100291622 177
185 3300031344 Ga0265316_10028017 Ga0265316_100280174 177
186 3300031711 Ga0265314_10104515 Ga0265314_101045152 177
187 3300035118 Ga0373954_0168507 Ga0373954_0168507_481_1038 177
188 3300035120 Ga0373957_0142746 Ga0373957_0142746_153_710 177
189 3300035724 Ga0373933_0007238 Ga0373933_0007238_2285_2842 177
190 3300036401 Ga0373937_0006329 Ga0373937_0006329_7946_8503 177
191 3300047471 Ga0495684_0421917 Ga0495684_0421917_183_740 177
192 3300048088 Ga0495602_0223921 Ga0495602_0223921_540_1097 177
193 3300053119 Ga0500595_025743 Ga0500595_025743_703_1263 177
194 3300003320 rootH2_10056152 rootH2_100561529 178
195 3300003323 rootH1_10234201 rootH1_102342011 178
196 3300005327 Ga0070658_10126228 Ga0070658_101262283 178
197 3300005327 Ga0070658_10296367 Ga0070658_102963672 178
198 3300005329 Ga0070683_100002284 Ga0070683_1000022848 178
199 3300005329 Ga0070683_100005781 Ga0070683_1000057812 178
200 3300005329 Ga0070683_100113199 Ga0070683_1001131993 178
201 3300005329 Ga0070683_100223918 Ga0070683_1002239182 178
202 3300005329 Ga0070683_100564969 Ga0070683_1005649692 178
203 3300005331 Ga0070670_100010703 Ga0070670_1000107034 178
204 3300005335 Ga0070666_10302227 Ga0070666_103022272 178
205 3300005338 Ga0068868_100000110 Ga0068868_10000011023 178
206 3300005338 Ga0068868_100020327 Ga0068868_1000203276 178
207 3300005344 Ga0070661_100008297 Ga0070661_1000082976 178
208 3300005344 Ga0070661_100211968 Ga0070661_1002119682 178
209 3300005344 Ga0070661_100396048 Ga0070661_1003960483 178
210 3300005355 Ga0070671_100008461 Ga0070671_1000084618 178
211 3300005364 Ga0070673_100239164 Ga0070673_1002391642 178
212 3300005367 Ga0070667_100000289 Ga0070667_10000028912 178
213 3300005435 Ga0070714_100011594 Ga0070714_1000115944 178
214 3300005436 Ga0070713_100074438 Ga0070713_1000744385 178
215 3300005436 Ga0070713_100307157 Ga0070713_1003071573 178
216 3300005458 Ga0070681_10345050 Ga0070681_103450503 178
217 3300005535 Ga0070684_100024584 Ga0070684_1000245843 178
218 3300005535 Ga0070684_100053692 Ga0070684_1000536922 178
219 3300005539 Ga0068853_100001002 Ga0068853_10000100217 178
220 3300005539 Ga0068853_100112609 Ga0068853_1001126092 178
221 3300005563 Ga0068855_100001519 Ga0068855_10000151925 178
222 3300005563 Ga0068855_100001966 Ga0068855_10000196614 178
223 3300005563 Ga0068855_100030086 Ga0068855_1000300863 178
224 3300005563 Ga0068855_100032121 Ga0068855_1000321215 178
225 3300005564 Ga0070664_100074629 Ga0070664_1000746292 178
226 3300005577 Ga0068857_100032897 Ga0068857_1000328976 178
227 3300005577 Ga0068857_100055464 Ga0068857_1000554644 178
228 3300005577 Ga0068857_100237699 Ga0068857_1002376992 178
229 3300005577 Ga0068857_100334006 Ga0068857_1003340062 178
230 3300005578 Ga0068854_100437154 Ga0068854_1004371541 178
231 3300005614 Ga0068856_100000992 Ga0068856_10000099211 178
232 3300005614 Ga0068856_100028065 Ga0068856_1000280651 178
233 3300005614 Ga0068856_100038886 Ga0068856_1000388865 178
234 3300005614 Ga0068856_100051475 Ga0068856_1000514753 178
235 3300005614 Ga0068856_100160005 Ga0068856_1001600052 178
236 3300005614 Ga0068856_100196276 Ga0068856_1001962762 178
237 3300005614 Ga0068856_100479441 Ga0068856_1004794412 178
238 3300005614 Ga0068856_101018482 Ga0068856_1010184822 178
239 3300005616 Ga0068852_100000040 Ga0068852_10000004076 178
240 3300005616 Ga0068852_100009777 Ga0068852_1000097772 178
241 3300005616 Ga0068852_100057020 Ga0068852_1000570204 178
242 3300005617 Ga0068859_100041238 Ga0068859_1000412385 178
243 3300005618 Ga0068864_100183996 Ga0068864_1001839962 178
244 3300005719 Ga0068861_100967724 Ga0068861_1009677242 178
245 3300005834 Ga0068851_10006517 Ga0068851_100065174 178
246 3300005834 Ga0068851_10014361 Ga0068851_100143615 178
247 3300005834 Ga0068851_10062154 Ga0068851_100621543 178
248 3300005834 Ga0068851_10289806 Ga0068851_102898062 178
249 3300005841 Ga0068863_100153401 Ga0068863_1001534012 178
250 3300005842 Ga0068858_100007565 Ga0068858_1000075656 178
251 3300005842 Ga0068858_100118085 Ga0068858_1001180853 178
252 3300005843 Ga0068860_100000556 Ga0068860_10000055624 178
253 3300005844 Ga0068862_100503982 Ga0068862_1005039821 178
254 3300006028 Ga0070717_10344577 Ga0070717_103445772 178
255 3300006237 Ga0097621_100010237 Ga0097621_1000102374 178
256 3300006358 Ga0068871_100046777 Ga0068871_1000467774 178
257 3300006881 Ga0068865_100092854 Ga0068865_1000928542 178
258 3300006931 Ga0097620_100041240 Ga0097620_1000412405 178
259 3300009093 Ga0105240_10000130 Ga0105240_1000013054 178
260 3300009093 Ga0105240_10000312 Ga0105240_1000031213 178
261 3300009093 Ga0105240_10002414 Ga0105240_1000241424 178
262 3300009093 Ga0105240_10020078 Ga0105240_100200787 178
263 3300009093 Ga0105240_10055810 Ga0105240_100558102 178
264 3300009093 Ga0105240_10218025 Ga0105240_102180253 178
265 3300009093 Ga0105240_10443565 Ga0105240_104435652 178
266 3300009098 Ga0105245_10000597 Ga0105245_100005975 178
267 3300009098 Ga0105245_10203797 Ga0105245_102037972 178
268 3300009101 Ga0105247_10067446 Ga0105247_100674462 178
269 3300009174 Ga0105241_10000074 Ga0105241_1000007441 178
270 3300009174 Ga0105241_10000338 Ga0105241_1000033813 178
271 3300009174 Ga0105241_10000993 Ga0105241_100009934 178
272 3300009174 Ga0105241_10108898 Ga0105241_101088983 178
273 3300009174 Ga0105241_10123181 Ga0105241_101231813 178
274 3300009174 Ga0105241_10133327 Ga0105241_101333273 178
275 3300009174 Ga0105241_10203403 Ga0105241_102034032 178
276 3300009174 Ga0105241_10212821 Ga0105241_102128211 178
277 3300009176 Ga0105242_10590415 Ga0105242_105904151 178
278 3300009545 Ga0105237_10064156 Ga0105237_100641564 178
279 3300009545 Ga0105237_10082234 Ga0105237_100822342 178
280 3300009545 Ga0105237_10124815 Ga0105237_101248154 178
281 3300009545 Ga0105237_10375083 Ga0105237_103750832 178
282 3300009545 Ga0105237_10519532 Ga0105237_105195322 178
283 3300009551 Ga0105238_10011181 Ga0105238_100111816 178
284 3300009551 Ga0105238_10027775 Ga0105238_100277753 178
285 3300009551 Ga0105238_10036091 Ga0105238_100360914 178
286 3300009551 Ga0105238_10074609 Ga0105238_100746095 178
287 3300009551 Ga0105238_10083898 Ga0105238_100838982 178
288 3300009551 Ga0105238_10105718 Ga0105238_101057183 178
289 3300009551 Ga0105238_10291020 Ga0105238_102910202 178
290 3300010375 Ga0105239_10194580 Ga0105239_101945804 178
291 3300010375 Ga0105239_10201258 Ga0105239_102012582 178
292 3300010375 Ga0105239_10236110 Ga0105239_102361102 178
293 3300010375 Ga0105239_10742806 Ga0105239_107428063 178
294 3300011119 Ga0105246_10001354 Ga0105246_100013542 178
295 3300013100 Ga0157373_10185081 Ga0157373_101850812 178
296 3300013100 Ga0157373_10294810 Ga0157373_102948102 178
297 3300013100 Ga0157373_10359504 Ga0157373_103595042 178
298 3300013102 Ga0157371_10389596 Ga0157371_103895962 178
299 3300013102 Ga0157371_10765946 Ga0157371_107659461 178
300 3300013104 Ga0157370_10000164 Ga0157370_1000016457 178
301 3300013104 Ga0157370_10770393 Ga0157370_107703931 178
302 3300013105 Ga0157369_10000209 Ga0157369_1000020958 178
303 3300013105 Ga0157369_10006182 Ga0157369_100061828 178
304 3300013105 Ga0157369_10030594 Ga0157369_100305948 178
305 3300013105 Ga0157369_10039943 Ga0157369_100399435 178
306 3300013105 Ga0157369_10074239 Ga0157369_100742394 178
307 3300013105 Ga0157369_10087948 Ga0157369_100879484 178
308 3300013105 Ga0157369_10230334 Ga0157369_102303343 178
309 3300013105 Ga0157369_10262810 Ga0157369_102628102 178
310 3300013296 Ga0157374_10004204 Ga0157374_1000420413 178
311 3300013296 Ga0157374_10120201 Ga0157374_101202014 178
312 3300013296 Ga0157374_10218029 Ga0157374_102180292 178
313 3300013297 Ga0157378_10014218 Ga0157378_100142186 178
314 3300013297 Ga0157378_10377538 Ga0157378_103775382 178
315 3300013306 Ga0163162_10014802 Ga0163162_100148025 178
316 3300013307 Ga0157372_10001822 Ga0157372_1000182213 178
317 3300013307 Ga0157372_10003679 Ga0157372_100036797 178
318 3300013307 Ga0157372_10010824 Ga0157372_100108248 178
319 3300013307 Ga0157372_10090464 Ga0157372_100904645 178
320 3300013307 Ga0157372_10100095 Ga0157372_101000952 178
321 3300013307 Ga0157372_10121109 Ga0157372_101211093 178
322 3300013307 Ga0157372_10181421 Ga0157372_101814213 178
323 3300013307 Ga0157372_10311707 Ga0157372_103117073 178
324 3300013307 Ga0157372_10385182 Ga0157372_103851823 178
325 3300013308 Ga0157375_10008717 Ga0157375_1000871710 178
326 3300013308 Ga0157375_10188059 Ga0157375_101880593 178
327 3300013308 Ga0157375_10455567 Ga0157375_104555672 178
328 3300014325 Ga0163163_10000679 Ga0163163_100006793 178
329 3300014968 Ga0157379_10002279 Ga0157379_100022795 178
330 3300014968 Ga0157379_10603325 Ga0157379_106033252 178
331 3300014969 Ga0157376_10012640 Ga0157376_100126402 178
332 3300014969 Ga0157376_10185457 Ga0157376_101854572 178
333 3300020080 Ga0206350_10765219 Ga0206350_107652192 178
334 3300025315 Ga0207697_10048555 Ga0207697_100485553 178
335 3300025321 Ga0207656_10012858 Ga0207656_100128584 178
336 3300025900 Ga0207710_10002071 Ga0207710_100020718 178
337 3300025904 Ga0207647_10120376 Ga0207647_101203762 178
338 3300025904 Ga0207647_10331269 Ga0207647_103312692 178
339 3300025911 Ga0207654_10000612 Ga0207654_100006122 178
340 3300025911 Ga0207654_10000773 Ga0207654_100007735 178
341 3300025911 Ga0207654_10097662 Ga0207654_100976622 178
342 3300025911 Ga0207654_10139063 Ga0207654_101390632 178
343 3300025911 Ga0207654_10512649 Ga0207654_105126491 178
344 3300025913 Ga0207695_10000028 Ga0207695_10000028231 178
345 3300025913 Ga0207695_10000292 Ga0207695_1000029254 178
346 3300025913 Ga0207695_10018054 Ga0207695_100180542 178
347 3300025913 Ga0207695_10040953 Ga0207695_100409534 178
348 3300025913 Ga0207695_10062832 Ga0207695_100628324 178
349 3300025913 Ga0207695_10084359 Ga0207695_100843592 178
350 3300025913 Ga0207695_10101790 Ga0207695_101017903 178
351 3300025914 Ga0207671_10000487 Ga0207671_1000048723 178
352 3300025914 Ga0207671_10051482 Ga0207671_100514822 178
353 3300025914 Ga0207671_10162188 Ga0207671_101621883 178
354 3300025914 Ga0207671_10782353 Ga0207671_107823531 178
355 3300025920 Ga0207649_10007100 Ga0207649_100071004 178
356 3300025920 Ga0207649_10138663 Ga0207649_101386632 178
357 3300025920 Ga0207649_10148054 Ga0207649_101480542 178
358 3300025920 Ga0207649_10845390 Ga0207649_108453902 178
359 3300025924 Ga0207694_10000160 Ga0207694_1000016036 178
360 3300025924 Ga0207694_10004246 Ga0207694_100042462 178
361 3300025924 Ga0207694_10037196 Ga0207694_100371964 178
362 3300025924 Ga0207694_10191753 Ga0207694_101917532 178
363 3300025924 Ga0207694_10229385 Ga0207694_102293852 178
364 3300025925 Ga0207650_10006584 Ga0207650_100065844 178
365 3300025927 Ga0207687_10095181 Ga0207687_100951812 178
366 3300025927 Ga0207687_10229241 Ga0207687_102292413 178
367 3300025928 Ga0207700_10160289 Ga0207700_101602892 178
368 3300025929 Ga0207664_10037931 Ga0207664_100379314 178
369 3300025942 Ga0207689_10008077 Ga0207689_100080773 178
370 3300025944 Ga0207661_10003957 Ga0207661_100039572 178
371 3300025944 Ga0207661_10009281 Ga0207661_100092813 178
372 3300025944 Ga0207661_10022139 Ga0207661_100221394 178
373 3300025944 Ga0207661_10403163 Ga0207661_104031633 178
374 3300025945 Ga0207679_10249523 Ga0207679_102495232 178
375 3300025949 Ga0207667_10003157 Ga0207667_1000315711 178
376 3300025949 Ga0207667_10017972 Ga0207667_100179722 178
377 3300025949 Ga0207667_10037489 Ga0207667_100374892 178
378 3300025949 Ga0207667_10075476 Ga0207667_100754764 178
379 3300025949 Ga0207667_10512120 Ga0207667_105121203 178
380 3300025960 Ga0207651_10138695 Ga0207651_101386954 178
381 3300025972 Ga0207668_10325524 Ga0207668_103255242 178
382 3300025981 Ga0207640_10099328 Ga0207640_100993282 178
383 3300025986 Ga0207658_10000549 Ga0207658_100005491 178
384 3300026023 Ga0207677_10000055 Ga0207677_1000005554 178
385 3300026035 Ga0207703_10005159 Ga0207703_100051595 178
386 3300026035 Ga0207703_10995343 Ga0207703_109953432 178
387 3300026041 Ga0207639_10000145 Ga0207639_1000014516 178
388 3300026041 Ga0207639_10006440 Ga0207639_100064404 178
389 3300026041 Ga0207639_10936944 Ga0207639_109369442 178
390 3300026078 Ga0207702_10013724 Ga0207702_100137248 178
391 3300026078 Ga0207702_10055912 Ga0207702_100559124 178
392 3300026078 Ga0207702_10963693 Ga0207702_109636931 178
393 3300026088 Ga0207641_10016408 Ga0207641_100164083 178
394 3300026095 Ga0207676_10008244 Ga0207676_100082442 178
395 3300026116 Ga0207674_10000799 Ga0207674_100007998 178
396 3300026116 Ga0207674_10001106 Ga0207674_1000110611 178
397 3300026116 Ga0207674_10047109 Ga0207674_100471092 178
398 3300026116 Ga0207674_10484458 Ga0207674_104844582 178
399 3300026116 Ga0207674_10640970 Ga0207674_106409701 178
400 3300026118 Ga0207675_101059324 Ga0207675_1010593242 178
401 3300026142 Ga0207698_10000045 Ga0207698_1000004572 178
402 3300026142 Ga0207698_10044115 Ga0207698_100441153 178
403 3300026142 Ga0207698_10062554 Ga0207698_100625541 178
404 3300026142 Ga0207698_10064499 Ga0207698_100644992 178
405 3300026142 Ga0207698_10280816 Ga0207698_102808163 178
406 3300026142 Ga0207698_11121590 Ga0207698_111215902 178
407 3300028380 Ga0268265_10178791 Ga0268265_101787912 178
408 3300028381 Ga0268264_10000433 Ga0268264_1000043331 178
409 3300028381 Ga0268264_11048932 Ga0268264_110489322 178
410 3300028800 Ga0265338_10007614 Ga0265338_100076148 178
411 3300031238 Ga0265332_10163411 Ga0265332_101634112 178
412 3300031249 Ga0265339_10019890 Ga0265339_100198901 178
413 3300031344 Ga0265316_10007401 Ga0265316_100074013 178
414 3300031711 Ga0265314_10101232 Ga0265314_101012323 178
415 3300031712 Ga0265342_10138441 Ga0265342_101384412 178
416 3300038443 Ga0395901_0884752 Ga0395901_0884752_262_822 178
417 3300042005 Ga0439448_0206122 Ga0439448_0206122_14_574 178
418 3300044694 Ga0466963_0017492 Ga0466963_0017492_1484_2044 178
419 3300045836 Ga0466958_0376891 Ga0466958_0376891_131_694 178
420 3300045836 Ga0466958_0480202 Ga0466958_0480202_103_663 178
421 3300046459 Ga0495629_0037824 Ga0495629_0037824_2229_2789 178
422 3300048088 Ga0495602_0057044 Ga0495602_0057044_708_1268 178
423 3300048904 Ga0496101_0255481 Ga0496101_0255481_449_1009 178
424 3300048907 Ga0496104_0338565 Ga0496104_0338565_763_1323 178
425 3300048917 Ga0496114_0028115 Ga0496114_0028115_3049_3609 178
426 3300059627 Ga0587117_020648 Ga0587117_020648_315_875 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04238

DUF420

Protein of unknown function (DUF420)

61

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v6y-assembly1.cif.gz_A structure of the mit domain from a s. solfataricus vps4-like atpase 0.6396 48 152
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.5903 11 172
2v6y-assembly1.cif.gz_A structure of the mit domain from a s. solfataricus vps4-like atpase 0.5903 48 152
2nw7-assembly1.cif.gz_D crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferric heme. northeast structural genomics target xcr13 0.5748 11 84
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.5624 36 178
ID Description Score Start End Superfamily
af_P38825_113_224_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8205 48 93 1.25.40.10
af_A0A0R0KC15_1_63_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8055 48 93 1.25.40.10
af_A0A1P8B3S0_1_63_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7864 50 94 1.25.40.10
af_K7MRE2_4_121_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.784 41 95 1.25.40.10
af_E1JHX0_2_82_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7819 51 94 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A3D1H795-F1-model_v4 DUF420 domain-containing protein 0.9287 72 175 GO:0016020
AF-A0A0C2TBR4-F1-model_v4 deleted 0.8828 60 173
AF-A0A2S6DN13-F1-model_v4 deleted 0.8772 44 166
AF-A0A3D1H795-F1-model_v4 DUF420 domain-containing protein 0.873 72 175 GO:0016020
AF-A0A1H1RT48-F1-model_v4 Putative membrane protein 0.872 40 170 GO:0004129
GO:0016020
GO:0022904

Feature Viewer

pLDDT pTM Quality
75 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map