F441179

General Info

Members Datasets Scaffolds Average Seq Length
426 220 852 260

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10205122|Ga0105245_102051222
Length 274
Sequence MLRLVFQGVPMGLMDGKKGLILNIANDRSIATHIANNVIKQGAICGFGFLPMDNPEKSQRRVRKAMEENGFADSWLHPCDVSSDESIEKFFAGVRDQFGTIDFVVHSLAFANRDYLKKEPGNFTSTPRDVFKQAVDVSAYSLIALARAAAPLMPNGGSIIALTYLGANQVIPGYNVMGVAKAALEAAARYLAFDLGSKQIRVNTLSAGPVKTLSAMAVGGIDEMFAHTEKKAPLKRNIDADEVGKTALYLLSDLSSGVTGENIFVDSGFNIVGL

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.47
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 1.88
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10205122 3300009098 Bacteria 1895
2 CNXas_1000238 3300000545 Bacteria 6774
3 JGI25406J46586_10000087 3300003203 Bacteria 42198
4 rootL2_10064669 3300003322 Bacteria 1350
5 Ga0065704_10003947 3300005289 Bacteria 8418
6 Ga0065712_10092543 3300005290 Bacteria 2328
7 Ga0065715_10089213 3300005293 Bacteria 12438
8 Ga0070676_10031801 3300005328 Bacteria 3019
9 Ga0070683_100544585 3300005329 Bacteria 1110
10 Ga0070670_100004213 3300005331 Bacteria 12041
11 Ga0070670_100011834 3300005331 Bacteria 7461
12 Ga0070670_100072487 3300005331 Unclassified 2958
13 Ga0070677_10067348 3300005333 Bacteria 1496
14 Ga0070666_10086841 3300005335 Bacteria 2144
15 Ga0068868_100058898 3300005338 Bacteria 3037
16 Ga0068868_100206705 3300005338 Unclassified 1639
17 Ga0068868_100244641 3300005338 Bacteria 1508
18 Ga0070689_100585245 3300005340 Unclassified 965
19 Ga0070691_10199984 3300005341 Bacteria 1049
20 Ga0070668_100025030 3300005347 Bacteria 4523
21 Ga0070669_100036917 3300005353 Unclassified 3543
22 Ga0070669_100045299 3300005353 Bacteria 3206
23 Ga0070675_100065877 3300005354 Bacteria 2995
24 Ga0070675_100304209 3300005354 Unclassified 1405
25 Ga0070675_100455677 3300005354 Bacteria 1147
26 Ga0070671_100011550 3300005355 Bacteria 7102
27 Ga0070671_100051073 3300005355 Bacteria 3439
28 Ga0070671_100265793 3300005355 Bacteria 1458
29 Ga0070671_100380085 3300005355 Bacteria 1207
30 Ga0070671_100384570 3300005355 Bacteria 1199
31 Ga0070674_100030354 3300005356 Bacteria 3570
32 Ga0070674_100044723 3300005356 Bacteria 3021
33 Ga0070673_100008155 3300005364 Bacteria 6950
34 Ga0070673_100186689 3300005364 Bacteria 1778
35 Ga0070673_100192713 3300005364 Bacteria 1751
36 Ga0070673_100223723 3300005364 Bacteria 1630
37 Ga0070673_100422350 3300005364 Bacteria 1195
38 Ga0070673_100682532 3300005364 Bacteria 942
39 Ga0070688_100002218 3300005365 Bacteria 9802
40 Ga0070659_100183113 3300005366 Bacteria 1720
41 Ga0070667_100011034 3300005367 Bacteria 7473
42 Ga0070667_100019074 3300005367 Bacteria 5688
43 Ga0070709_10347694 3300005434 Bacteria 1095
44 Ga0070714_100023176 3300005435 Bacteria 5096
45 Ga0070714_100062359 3300005435 Bacteria 3204
46 Ga0070714_100148108 3300005435 Bacteria 2113
47 Ga0070713_100036025 3300005436 Bacteria 3989
48 Ga0070713_100152752 3300005436 Bacteria 2055
49 Ga0070713_100178157 3300005436 Bacteria 1909
50 Ga0070705_100493469 3300005440 Unclassified 928
51 Ga0070708_100005723 3300005445 Bacteria 9862
52 Ga0070708_100070257 3300005445 Bacteria 3150
53 Ga0070708_100175343 3300005445 Bacteria 2003
54 Ga0070708_100349266 3300005445 Bacteria 1394
55 Ga0070678_100014209 3300005456 Bacteria 5016
56 Ga0070678_100054338 3300005456 Bacteria 2917
57 Ga0070662_100188019 3300005457 Bacteria 1631
58 Ga0070662_100462295 3300005457 Bacteria 1055
59 Ga0068867_100008401 3300005459 Bacteria 7281
60 Ga0070706_100000269 3300005467 Bacteria 63203
61 Ga0070706_100014266 3300005467 Bacteria 7343
62 Ga0070706_100042823 3300005467 Bacteria 4183
63 Ga0070707_100009067 3300005468 Bacteria 9223
64 Ga0070707_100023376 3300005468 Bacteria 5848
65 Ga0070707_100130080 3300005468 Bacteria 2448
66 Ga0070707_100229209 3300005468 Bacteria 1809
67 Ga0070707_100444456 3300005468 Unclassified 1257
68 Ga0070698_100005105 3300005471 Bacteria 14372
69 Ga0070698_100014183 3300005471 Bacteria 8424
70 Ga0070698_100032468 3300005471 Bacteria 5408
71 Ga0070698_100078737 3300005471 Bacteria 3294
72 Ga0070698_100402028 3300005471 Bacteria 1303
73 Ga0070699_100029474 3300005518 Bacteria 4731
74 Ga0070699_100044446 3300005518 Unclassified 3846
75 Ga0070699_100314784 3300005518 Bacteria 1406
76 Ga0070699_100692919 3300005518 Bacteria 931
77 Ga0070684_100143572 3300005535 Bacteria 2160
78 Ga0070684_100445358 3300005535 Bacteria 1197
79 Ga0070697_100005830 3300005536 Bacteria 9503
80 Ga0070697_100031860 3300005536 Bacteria 4242
81 Ga0070697_100136041 3300005536 Bacteria 2063
82 Ga0070672_100010171 3300005543 Bacteria 6515
83 Ga0070672_100049070 3300005543 Bacteria 3282
84 Ga0070672_100174912 3300005543 Unclassified 1787
85 Ga0070672_100244246 3300005543 Bacteria 1511
86 Ga0070686_100445478 3300005544 Bacteria 994
87 Ga0070695_100036635 3300005545 Bacteria 3087
88 Ga0070695_100169721 3300005545 Bacteria 1538
89 Ga0070696_100050480 3300005546 Bacteria 2891
90 Ga0070665_100000533 3300005548 Bacteria 53800
91 Ga0070665_100049265 3300005548 Bacteria 4227
92 Ga0070665_100052540 3300005548 Bacteria 4086
93 Ga0070665_100082256 3300005548 Bacteria 3225
94 Ga0068855_100018948 3300005563 Bacteria 8273
95 Ga0068855_100088874 3300005563 Bacteria 3568
96 Ga0068855_100191035 3300005563 Bacteria 2310
97 Ga0068855_100267760 3300005563 Bacteria 1901
98 Ga0070664_100338599 3300005564 Bacteria 1366
99 Ga0068856_100000421 3300005614 Bacteria 46619
100 Ga0068856_100050354 3300005614 Bacteria 4106
101 Ga0068852_100499735 3300005616 Unclassified 1211
102 Ga0068852_100558438 3300005616 Bacteria 1146
103 Ga0068864_100753160 3300005618 Bacteria 954
104 Ga0068866_10201333 3300005718 Bacteria 1190
105 Ga0068863_100225178 3300005841 Bacteria 1808
106 Ga0068863_100794492 3300005841 Bacteria 944
107 Ga0068858_100034559 3300005842 Bacteria 4689
108 Ga0068860_100078846 3300005843 Bacteria 3132
109 Ga0068860_100164136 3300005843 Bacteria 2143
110 Ga0068860_101011759 3300005843 Bacteria 849
111 Ga0081455_10004809 3300005937 Bacteria 15003
112 Ga0081455_10017062 3300005937 Bacteria 6978
113 Ga0081455_10046243 3300005937 Bacteria 3778
114 Ga0081540_1000036 3300005983 Bacteria 140805
115 Ga0081539_10001132 3300005985 Bacteria 48398
116 Ga0081539_10009073 3300005985 Bacteria 8431
117 Ga0081539_10012287 3300005985 Bacteria 6627
118 Ga0081539_10054939 3300005985 Bacteria 2219
119 Ga0070717_10000989 3300006028 Bacteria 19045
120 Ga0070717_10001230 3300006028 Bacteria 17421
121 Ga0070717_10043004 3300006028 Bacteria 3686
122 Ga0070717_10254468 3300006028 Unclassified 1552
123 Ga0070716_100148490 3300006173 Bacteria 1505
124 Ga0070712_100029965 3300006175 Bacteria 3652
125 Ga0070712_100336780 3300006175 Bacteria 1231
126 Ga0097621_100018011 3300006237 Bacteria 5383
127 Ga0097621_100238824 3300006237 Bacteria 1588
128 Ga0097621_100309713 3300006237 Bacteria 1397
129 Ga0097621_100583693 3300006237 Bacteria 1020
130 Ga0068871_100015683 3300006358 Bacteria 5682
131 Ga0068871_100022055 3300006358 Bacteria 4906
132 Ga0068871_100074726 3300006358 Bacteria 2796
133 Ga0068871_100234392 3300006358 Bacteria 1594
134 Ga0068871_100552323 3300006358 Bacteria 1043
135 Ga0075428_100366129 3300006844 Bacteria 1546
136 Ga0075428_100601749 3300006844 Bacteria 1174
137 Ga0075430_100069069 3300006846 Bacteria 2964
138 Ga0075430_100387260 3300006846 Bacteria 1154
139 Ga0075431_100122207 3300006847 Bacteria 2686
140 Ga0075434_100164072 3300006871 Bacteria 2242
141 Ga0075434_100354564 3300006871 Bacteria 1488
142 Ga0075434_100726744 3300006871 Bacteria 1010
143 Ga0075429_100014255 3300006880 Bacteria 6893
144 Ga0068865_100016186 3300006881 Bacteria 4766
145 Ga0068865_100084875 3300006881 Bacteria 2283
146 Ga0075436_100032838 3300006914 Bacteria 3577
147 Ga0075436_100131547 3300006914 Bacteria 1755
148 Ga0075435_100228198 3300007076 Bacteria 1582
149 Ga0105240_10041686 3300009093 Bacteria 5855
150 Ga0105240_10329102 3300009093 Bacteria 1739
151 Ga0105240_10330763 3300009093 Bacteria 1734
152 Ga0105240_10811982 3300009093 Unclassified 1012
153 Ga0111539_10076623 3300009094 Bacteria 3937
154 Ga0111539_10630075 3300009094 Bacteria 1249
155 Ga0105245_10027760 3300009098 Bacteria 4987
156 Ga0105245_10128662 3300009098 Bacteria 2373
157 Ga0105245_10182623 3300009098 Unclassified 2005
158 Ga0114129_10000880 3300009147 Bacteria 39098
159 Ga0114129_11087456 3300009147 Bacteria 1002
160 Ga0105241_10199831 3300009174 Bacteria 1669
161 Ga0105248_10095768 3300009177 Bacteria 3342
162 Ga0105248_10484416 3300009177 Bacteria 1394
163 Ga0105248_11069070 3300009177 Bacteria 912
164 Ga0105237_10326005 3300009545 Bacteria 1540
165 Ga0105238_10098994 3300009551 Bacteria 2899
166 Ga0099796_10096319 3300010159 Unclassified 1107
167 Ga0105239_10013624 3300010375 Bacteria 9027
168 Ga0105239_10343677 3300010375 Unclassified 1684
169 Ga0157373_10099667 3300013100 Bacteria 2045
170 Ga0157371_10047969 3300013102 Bacteria 3036
171 Ga0157370_10073993 3300013104 Bacteria 3214
172 Ga0157370_10078720 3300013104 Bacteria 3104
173 Ga0157370_10463257 3300013104 Unclassified 1165
174 Ga0157369_10310660 3300013105 Bacteria 1639
175 Ga0157369_10507846 3300013105 Bacteria 1247
176 Ga0157369_10709877 3300013105 Bacteria 1035
177 Ga0157374_10010433 3300013296 Bacteria 7988
178 Ga0157374_10178574 3300013296 Bacteria 2073
179 Ga0157374_10346825 3300013296 Bacteria 1475
180 Ga0157378_10007440 3300013297 Bacteria 9566
181 Ga0157378_10152869 3300013297 Bacteria 2151
182 Ga0163162_10007511 3300013306 Bacteria 10613
183 Ga0163162_10176250 3300013306 Bacteria 2264
184 Ga0163162_10222594 3300013306 Bacteria 2017
185 Ga0163162_10335443 3300013306 Bacteria 1644
186 Ga0163162_10602799 3300013306 Bacteria 1224
187 Ga0157372_10032294 3300013307 Bacteria 5740
188 Ga0157372_10038612 3300013307 Bacteria 5269
189 Ga0157372_10140818 3300013307 Bacteria 2778
190 Ga0157372_10223896 3300013307 Bacteria 2181
191 Ga0157372_10252273 3300013307 Bacteria 2048
192 Ga0157372_10483513 3300013307 Unclassified 1444
193 Ga0157372_10603834 3300013307 Bacteria 1279
194 Ga0157375_10034503 3300013308 Bacteria 4821
195 Ga0157375_10091128 3300013308 Bacteria 3109
196 Ga0157375_10118331 3300013308 Unclassified 2756
197 Ga0157375_10323272 3300013308 Bacteria 1707
198 Ga0163163_10461105 3300014325 Bacteria 1331
199 Ga0157380_10712287 3300014326 Bacteria 1010
200 Ga0182008_10096470 3300014497 Bacteria 1459
201 Ga0157376_10105376 3300014969 Bacteria 2472
202 Ga0182006_1010233 3300015261 Bacteria 4178
203 Ga0182005_1075000 3300015265 Bacteria 931
204 Ga0163161_10463641 3300017792 Bacteria 1026
205 Ga0197907_10704851 3300020069 Bacteria 950
206 Ga0206352_10489137 3300020078 Bacteria 2288
207 Ga0207666_1004669 3300025271 Bacteria 1725
208 Ga0207697_10001050 3300025315 Bacteria 15289
209 Ga0207697_10008198 3300025315 Bacteria 4592
210 Ga0207697_10012425 3300025315 Bacteria 3570
211 Ga0207697_10109657 3300025315 Bacteria 1181
212 Ga0207692_10177061 3300025898 Bacteria 1240
213 Ga0207688_10002383 3300025901 Bacteria 10115
214 Ga0207680_10037879 3300025903 Bacteria 2787
215 Ga0207680_10152849 3300025903 Bacteria 1540
216 Ga0207645_10003565 3300025907 Bacteria 11780
217 Ga0207645_10007954 3300025907 Bacteria 7444
218 Ga0207684_10000134 3300025910 Bacteria 133720
219 Ga0207684_10005714 3300025910 Bacteria 11425
220 Ga0207684_10008007 3300025910 Bacteria 9438
221 Ga0207684_10025186 3300025910 Bacteria 5071
222 Ga0207684_10025671 3300025910 Bacteria 5021
223 Ga0207684_10057759 3300025910 Bacteria 3292
224 Ga0207684_10241708 3300025910 Bacteria 1558
225 Ga0207684_10280834 3300025910 Unclassified 1436
226 Ga0207707_10073982 3300025912 Bacteria 2972
227 Ga0207695_10000900 3300025913 Bacteria 53457
228 Ga0207695_10208849 3300025913 Bacteria 1864
229 Ga0207695_10538830 3300025913 Unclassified 1049
230 Ga0207693_10057880 3300025915 Bacteria 3037
231 Ga0207693_10089678 3300025915 Bacteria 2410
232 Ga0207693_10165944 3300025915 Bacteria 1738
233 Ga0207693_10269566 3300025915 Bacteria 1334
234 Ga0207663_10172358 3300025916 Bacteria 1538
235 Ga0207657_10153203 3300025919 Bacteria 1876
236 Ga0207646_10005308 3300025922 Bacteria 13584
237 Ga0207646_10108889 3300025922 Bacteria 2486
238 Ga0207646_10148169 3300025922 Bacteria 2115
239 Ga0207646_10202506 3300025922 Bacteria 1793
240 Ga0207646_10442678 3300025922 Bacteria 1172
241 Ga0207646_10447285 3300025922 Unclassified 1166
242 Ga0207646_10708146 3300025922 Bacteria 900
243 Ga0207681_10031668 3300025923 Bacteria 3456
244 Ga0207681_10073612 3300025923 Bacteria 2390
245 Ga0207681_10081412 3300025923 Bacteria 2286
246 Ga0207650_10018232 3300025925 Bacteria 4923
247 Ga0207650_10072141 3300025925 Bacteria 2599
248 Ga0207650_10211040 3300025925 Bacteria 1559
249 Ga0207650_10255211 3300025925 Unclassified 1421
250 Ga0207659_10050298 3300025926 Bacteria 2960
251 Ga0207659_10233058 3300025926 Bacteria 1486
252 Ga0207659_10421392 3300025926 Bacteria 1120
253 Ga0207687_10103663 3300025927 Bacteria 2098
254 Ga0207687_10147343 3300025927 Bacteria 1792
255 Ga0207687_10197760 3300025927 Bacteria 1569
256 Ga0207700_10041116 3300025928 Bacteria 3380
257 Ga0207664_10054198 3300025929 Bacteria 3177
258 Ga0207664_10103878 3300025929 Bacteria 2352
259 Ga0207644_10019515 3300025931 Bacteria 4599
260 Ga0207644_10243878 3300025931 Bacteria 1431
261 Ga0207644_10268048 3300025931 Bacteria 1367
262 Ga0207644_10566197 3300025931 Bacteria 941
263 Ga0207706_10176729 3300025933 Bacteria 1876
264 Ga0207686_10203359 3300025934 Bacteria 1420
265 Ga0207669_10066451 3300025937 Bacteria 2242
266 Ga0207669_10591290 3300025937 Bacteria 901
267 Ga0207704_10074718 3300025938 Bacteria 2164
268 Ga0207665_10058503 3300025939 Bacteria 2606
269 Ga0207691_10002414 3300025940 Bacteria 18290
270 Ga0207691_10118780 3300025940 Bacteria 2345
271 Ga0207691_10135064 3300025940 Bacteria 2176
272 Ga0207691_10383310 3300025940 Bacteria 1200
273 Ga0207661_10098381 3300025944 Bacteria 2452
274 Ga0207661_10230284 3300025944 Bacteria 1641
275 Ga0207679_10282744 3300025945 Bacteria 1423
276 Ga0207667_10032019 3300025949 Bacteria 5669
277 Ga0207667_10095265 3300025949 Bacteria 3073
278 Ga0207667_10135612 3300025949 Bacteria 2535
279 Ga0207667_10468399 3300025949 Bacteria 1279
280 Ga0207651_10007819 3300025960 Bacteria 5722
281 Ga0207651_10153318 3300025960 Bacteria 1797
282 Ga0207651_10431921 3300025960 Bacteria 1126
283 Ga0207658_10011021 3300025986 Bacteria 6154
284 Ga0207658_10056213 3300025986 Bacteria 2919
285 Ga0207677_10182727 3300026023 Unclassified 1651
286 Ga0207677_10267223 3300026023 Bacteria 1397
287 Ga0207703_10289780 3300026035 Bacteria 1489
288 Ga0207678_10191305 3300026067 Bacteria 1749
289 Ga0207702_10001699 3300026078 Bacteria 21740
290 Ga0207702_10114515 3300026078 Bacteria 2403
291 Ga0207641_10562708 3300026088 Bacteria 1113
292 Ga0207648_10014340 3300026089 Bacteria 7326
293 Ga0207676_10270476 3300026095 Bacteria 1539
294 Ga0207674_10018631 3300026116 Bacteria 7540
295 Ga0207683_10008556 3300026121 Bacteria 8757
296 Ga0207683_10033005 3300026121 Bacteria 4496
297 Ga0207683_10072495 3300026121 Bacteria 3046
298 Ga0207698_10370275 3300026142 Bacteria 1360
299 Ga0268266_10001520 3300028379 Bacteria 27166
300 Ga0268266_10002793 3300028379 Bacteria 18203
301 Ga0268266_10167502 3300028379 Bacteria 1992
302 Ga0268264_10078893 3300028381 Bacteria 2808
303 Ga0268264_10198213 3300028381 Bacteria 1835
304 Ga0265337_1000020 3300028556 Bacteria 74117
305 Ga0265337_1028095 3300028556 Bacteria 1691
306 Ga0265320_10020920 3300031240 Bacteria 3533
307 Ga0265327_10027465 3300031251 Bacteria 3275
308 Ga0307513_10057374 3300031456 Bacteria 4148
309 Ga0307408_100227401 3300031548 Bacteria 1526
310 Ga0265313_10001769 3300031595 Bacteria 19806
311 Ga0265314_10031875 3300031711 Bacteria 3885
312 Ga0307410_10010911 3300031852 Bacteria 5173
313 Ga0307406_10078767 3300031901 Bacteria 2184
314 Ga0307407_10031220 3300031903 Bacteria 2883
315 Ga0307409_100038894 3300031995 Bacteria 3524
316 Ga0307409_100502427 3300031995 Bacteria 1181
317 Ga0307416_100558613 3300032002 Bacteria 1219
318 Ga0307411_10153449 3300032005 Bacteria 1715
319 Ga0307411_10709879 3300032005 Bacteria 877
320 Ga0307415_100324212 3300032126 Bacteria 1286
321 Ga0373956_0015570 3300035119 Bacteria 3186
322 Ga0373956_0138028 3300035119 Bacteria 1144
323 Ga0373957_0084110 3300035120 Bacteria 1259
324 Ga0373931_0012455 3300035691 Bacteria 4120
325 Ga0373931_0064691 3300035691 Bacteria 1980
326 Ga0373935_0005576 3300035692 Bacteria 7418
327 Ga0373935_0041986 3300035692 Bacteria 2875
328 Ga0373927_0073636 3300035695 Bacteria 2212
329 Ga0373933_0404012 3300035724 Bacteria 891
330 Ga0373947_0046546 3300035725 Bacteria 2598
331 Ga0373937_0005341 3300036401 Bacteria 10983
332 Ga0373937_0031504 3300036401 Bacteria 4806
333 Ga0373937_0081113 3300036401 Bacteria 3001
334 Ga0373937_0135633 3300036401 Bacteria 2301
335 Ga0373925_0010394 3300037068 Bacteria 6752
336 Ga0373925_0123639 3300037068 Unclassified 2011
337 Ga0373925_0288910 3300037068 Bacteria 1322
338 Ga0373925_0402145 3300037068 Bacteria 1117
339 Ga0395899_0000655 3300037312 Bacteria 35289
340 Ga0395899_0235509 3300037312 Bacteria 1262
341 Ga0395900_0000033 3300037418 Bacteria 260271
342 Ga0395900_0004228 3300037418 Bacteria 15243
343 Ga0395900_0009879 3300037418 Bacteria 9773
344 Ga0395900_0210740 3300037418 Bacteria 1962
345 Ga0395900_0366239 3300037418 Bacteria 1412
346 Ga0395900_0383417 3300037418 Bacteria 1373
347 Ga0395898_0000057 3300037466 Bacteria 277915
348 Ga0395898_0004958 3300037466 Bacteria 14449
349 Ga0395898_0242504 3300037466 Bacteria 1719
350 Ga0395898_0452429 3300037466 Bacteria 1223
351 Ga0395905_0024173 3300037471 Bacteria 5735
352 Ga0395901_0001492 3300038443 Bacteria 24334
353 Ga0395901_0354926 3300038443 Bacteria 1513
354 Ga0395901_0479245 3300038443 Unclassified 1269
355 Ga0395901_0698293 3300038443 Bacteria 1012
356 Ga0436365_0925115 3300039437 Bacteria 1750
357 Ga0436365_1416355 3300039437 Bacteria 117881
358 Ga0436361_0192133 3300039447 Bacteria 40746
359 Ga0436363_0298909 3300039450 Bacteria 1381
360 Ga0436362_0231123 3300039453 Bacteria 1253
361 Ga0466964_0048990 3300044706 Bacteria 1729
362 Ga0466957_0166396 3300044842 Bacteria 1434
363 Ga0451576_0001470 3300045051 Bacteria 39937
364 Ga0466967_0224826 3300045976 Bacteria 1785
365 Ga0466967_0667160 3300045976 Bacteria 1029
366 Ga0495651_0016665 3300046462 Bacteria 5691
367 Ga0495653_0198870 3300046463 Bacteria 1362
368 Ga0495580_0140035 3300046472 Bacteria 1677
369 Ga0495639_0031359 3300046475 Bacteria 2366
370 Ga0495618_0001508 3300046514 Bacteria 15629
371 Ga0495628_0029492 3300046516 Bacteria 4447
372 Ga0495630_0042511 3300046517 Bacteria 3394
373 Ga0495630_0108164 3300046517 Bacteria 2106
374 Ga0495630_0302150 3300046517 Bacteria 1223
375 Ga0495666_0139762 3300046526 Bacteria 1129
376 Ga0495640_0115489 3300046533 Bacteria 1749
377 Ga0495586_0096841 3300046535 Bacteria 1634
378 Ga0495598_0005053 3300046537 Bacteria 2900
379 Ga0495667_0053848 3300046559 Bacteria 2649
380 Ga0495634_0004187 3300046642 Bacteria 11394
381 Ga0495647_0047710 3300046681 Bacteria 1654
382 Ga0495658_0012284 3300046683 Bacteria 4332
383 Ga0495658_0359533 3300046683 Bacteria 926
384 Ga0495613_0029578 3300046689 Bacteria 4072
385 Ga0495624_0040386 3300046690 Bacteria 2988
386 Ga0495674_0036043 3300047319 Bacteria 4456
387 Ga0495680_0170952 3300047322 Bacteria 1573
388 Ga0495675_0015174 3300047444 Bacteria 4870
389 Ga0495677_0129547 3300047445 Bacteria 965
390 Ga0495684_0007093 3300047471 Bacteria 8697
391 Ga0495684_0007174 3300047471 Bacteria 8652
392 Ga0495684_0262605 3300047471 Bacteria 1252
393 Ga0496107_0127488 3300048910 Bacteria 1878
394 Ga0496109_0088718 3300048912 Bacteria 2858
395 Ga0496109_0656149 3300048912 Bacteria 986
396 Ga0496112_0095099 3300048915 Bacteria 2950
397 Ga0496112_0395075 3300048915 Bacteria 1323
398 Ga0496113_0145469 3300048916 Bacteria 1867
399 Ga0496115_0346129 3300048918 Bacteria 1213
400 Ga0501034_0000512 3300049571 Bacteria 62257
401 Ga0501034_0064581 3300049571 Bacteria 3674
402 Ga0501034_0185486 3300049571 Bacteria 2044
403 Ga0501037_0137836 3300049573 Bacteria 1747
404 Ga0501047_0208340 3300049581 Bacteria 1814
405 Ga0501047_0439205 3300049581 Bacteria 1135
406 Ga0501217_080357 3300049661 Bacteria 901
407 Ga0501083_0016949 3300049744 Bacteria 5088
408 Ga0501083_0284652 3300049744 Bacteria 1075
409 Ga0501044_0005220 3300049823 Bacteria 14454
410 Ga0501044_0026078 3300049823 Bacteria 6190
411 nmdc:mga05p37_629148_c1 3300050507 Bacteria 1206
412 nmdc:mga05p37_66297_c1 3300050507 Bacteria 4441
413 nmdc:mga09592_125519_c1 3300050508 Bacteria 2206
414 nmdc:mga0qj67_357593_c1 3300050509 Bacteria 1180
415 nmdc:mga0qj67_95823_c1 3300050509 Bacteria 2389
416 nmdc:mga06r32_363086_c1 3300050510 Bacteria 1432
417 nmdc:mga08y16_329988_c1 3300050511 Bacteria 1569
418 nmdc:mga08y16_420389_c1 3300050511 Bacteria 1366
419 nmdc:mga0n895_342016_c1 3300050512 Bacteria 1515
420 nmdc:mga0rr50_531480_c1 3300050513 Bacteria 1001
421 nmdc:mga08x19_25249_c1 3300050514 Bacteria 3700
422 Ga0495655_0008622 3300053083 Bacteria 1945
423 Ga0495619_0229218 3300053085 Bacteria 1287
424 Ga0500650_0011547 3300053098 Bacteria 3641
425 Ga0500645_022924 3300053730 Bacteria 1916
426 2787434926 2786546517 Bacteria 6614109
427 Ga0105245_10205122
428 CNXas_1000238
429 JGI25406J46586_10000087
430 rootL2_10064669
431 Ga0065704_10003947
432 Ga0065712_10092543
433 Ga0065715_10089213
434 Ga0070676_10031801
435 Ga0070683_100544585
436 Ga0070670_100004213
437 Ga0070670_100011834
438 Ga0070670_100072487
439 Ga0070677_10067348
440 Ga0070666_10086841
441 Ga0068868_100058898
442 Ga0068868_100206705
443 Ga0068868_100244641
444 Ga0070689_100585245
445 Ga0070691_10199984
446 Ga0070668_100025030
447 Ga0070669_100036917
448 Ga0070669_100045299
449 Ga0070675_100065877
450 Ga0070675_100304209
451 Ga0070675_100455677
452 Ga0070671_100011550
453 Ga0070671_100051073
454 Ga0070671_100265793
455 Ga0070671_100380085
456 Ga0070671_100384570
457 Ga0070674_100030354
458 Ga0070674_100044723
459 Ga0070673_100008155
460 Ga0070673_100186689
461 Ga0070673_100192713
462 Ga0070673_100223723
463 Ga0070673_100422350
464 Ga0070673_100682532
465 Ga0070688_100002218
466 Ga0070659_100183113
467 Ga0070667_100011034
468 Ga0070667_100019074
469 Ga0070709_10347694
470 Ga0070714_100023176
471 Ga0070714_100062359
472 Ga0070714_100148108
473 Ga0070713_100036025
474 Ga0070713_100152752
475 Ga0070713_100178157
476 Ga0070705_100493469
477 Ga0070708_100005723
478 Ga0070708_100070257
479 Ga0070708_100175343
480 Ga0070708_100349266
481 Ga0070678_100014209
482 Ga0070678_100054338
483 Ga0070662_100188019
484 Ga0070662_100462295
485 Ga0068867_100008401
486 Ga0070706_100000269
487 Ga0070706_100014266
488 Ga0070706_100042823
489 Ga0070707_100009067
490 Ga0070707_100023376
491 Ga0070707_100130080
492 Ga0070707_100229209
493 Ga0070707_100444456
494 Ga0070698_100005105
495 Ga0070698_100014183
496 Ga0070698_100032468
497 Ga0070698_100078737
498 Ga0070698_100402028
499 Ga0070699_100029474
500 Ga0070699_100044446
501 Ga0070699_100314784
502 Ga0070699_100692919
503 Ga0070684_100143572
504 Ga0070684_100445358
505 Ga0070697_100005830
506 Ga0070697_100031860
507 Ga0070697_100136041
508 Ga0070672_100010171
509 Ga0070672_100049070
510 Ga0070672_100174912
511 Ga0070672_100244246
512 Ga0070686_100445478
513 Ga0070695_100036635
514 Ga0070695_100169721
515 Ga0070696_100050480
516 Ga0070665_100000533
517 Ga0070665_100049265
518 Ga0070665_100052540
519 Ga0070665_100082256
520 Ga0068855_100018948
521 Ga0068855_100088874
522 Ga0068855_100191035
523 Ga0068855_100267760
524 Ga0070664_100338599
525 Ga0068856_100000421
526 Ga0068856_100050354
527 Ga0068852_100499735
528 Ga0068852_100558438
529 Ga0068864_100753160
530 Ga0068866_10201333
531 Ga0068863_100225178
532 Ga0068863_100794492
533 Ga0068858_100034559
534 Ga0068860_100078846
535 Ga0068860_100164136
536 Ga0068860_101011759
537 Ga0081455_10004809
538 Ga0081455_10017062
539 Ga0081455_10046243
540 Ga0081540_1000036
541 Ga0081539_10001132
542 Ga0081539_10009073
543 Ga0081539_10012287
544 Ga0081539_10054939
545 Ga0070717_10000989
546 Ga0070717_10001230
547 Ga0070717_10043004
548 Ga0070717_10254468
549 Ga0070716_100148490
550 Ga0070712_100029965
551 Ga0070712_100336780
552 Ga0097621_100018011
553 Ga0097621_100238824
554 Ga0097621_100309713
555 Ga0097621_100583693
556 Ga0068871_100015683
557 Ga0068871_100022055
558 Ga0068871_100074726
559 Ga0068871_100234392
560 Ga0068871_100552323
561 Ga0075428_100366129
562 Ga0075428_100601749
563 Ga0075430_100069069
564 Ga0075430_100387260
565 Ga0075431_100122207
566 Ga0075434_100164072
567 Ga0075434_100354564
568 Ga0075434_100726744
569 Ga0075429_100014255
570 Ga0068865_100016186
571 Ga0068865_100084875
572 Ga0075436_100032838
573 Ga0075436_100131547
574 Ga0075435_100228198
575 Ga0105240_10041686
576 Ga0105240_10329102
577 Ga0105240_10330763
578 Ga0105240_10811982
579 Ga0111539_10076623
580 Ga0111539_10630075
581 Ga0105245_10027760
582 Ga0105245_10128662
583 Ga0105245_10182623
584 Ga0114129_10000880
585 Ga0114129_11087456
586 Ga0105241_10199831
587 Ga0105248_10095768
588 Ga0105248_10484416
589 Ga0105248_11069070
590 Ga0105237_10326005
591 Ga0105238_10098994
592 Ga0099796_10096319
593 Ga0105239_10013624
594 Ga0105239_10343677
595 Ga0157373_10099667
596 Ga0157371_10047969
597 Ga0157370_10073993
598 Ga0157370_10078720
599 Ga0157370_10463257
600 Ga0157369_10310660
601 Ga0157369_10507846
602 Ga0157369_10709877
603 Ga0157374_10010433
604 Ga0157374_10178574
605 Ga0157374_10346825
606 Ga0157378_10007440
607 Ga0157378_10152869
608 Ga0163162_10007511
609 Ga0163162_10176250
610 Ga0163162_10222594
611 Ga0163162_10335443
612 Ga0163162_10602799
613 Ga0157372_10032294
614 Ga0157372_10038612
615 Ga0157372_10140818
616 Ga0157372_10223896
617 Ga0157372_10252273
618 Ga0157372_10483513
619 Ga0157372_10603834
620 Ga0157375_10034503
621 Ga0157375_10091128
622 Ga0157375_10118331
623 Ga0157375_10323272
624 Ga0163163_10461105
625 Ga0157380_10712287
626 Ga0182008_10096470
627 Ga0157376_10105376
628 Ga0182006_1010233
629 Ga0182005_1075000
630 Ga0163161_10463641
631 Ga0197907_10704851
632 Ga0206352_10489137
633 Ga0207666_1004669
634 Ga0207697_10001050
635 Ga0207697_10008198
636 Ga0207697_10012425
637 Ga0207697_10109657
638 Ga0207692_10177061
639 Ga0207688_10002383
640 Ga0207680_10037879
641 Ga0207680_10152849
642 Ga0207645_10003565
643 Ga0207645_10007954
644 Ga0207684_10000134
645 Ga0207684_10005714
646 Ga0207684_10008007
647 Ga0207684_10025186
648 Ga0207684_10025671
649 Ga0207684_10057759
650 Ga0207684_10241708
651 Ga0207684_10280834
652 Ga0207707_10073982
653 Ga0207695_10000900
654 Ga0207695_10208849
655 Ga0207695_10538830
656 Ga0207693_10057880
657 Ga0207693_10089678
658 Ga0207693_10165944
659 Ga0207693_10269566
660 Ga0207663_10172358
661 Ga0207657_10153203
662 Ga0207646_10005308
663 Ga0207646_10108889
664 Ga0207646_10148169
665 Ga0207646_10202506
666 Ga0207646_10442678
667 Ga0207646_10447285
668 Ga0207646_10708146
669 Ga0207681_10031668
670 Ga0207681_10073612
671 Ga0207681_10081412
672 Ga0207650_10018232
673 Ga0207650_10072141
674 Ga0207650_10211040
675 Ga0207650_10255211
676 Ga0207659_10050298
677 Ga0207659_10233058
678 Ga0207659_10421392
679 Ga0207687_10103663
680 Ga0207687_10147343
681 Ga0207687_10197760
682 Ga0207700_10041116
683 Ga0207664_10054198
684 Ga0207664_10103878
685 Ga0207644_10019515
686 Ga0207644_10243878
687 Ga0207644_10268048
688 Ga0207644_10566197
689 Ga0207706_10176729
690 Ga0207686_10203359
691 Ga0207669_10066451
692 Ga0207669_10591290
693 Ga0207704_10074718
694 Ga0207665_10058503
695 Ga0207691_10002414
696 Ga0207691_10118780
697 Ga0207691_10135064
698 Ga0207691_10383310
699 Ga0207661_10098381
700 Ga0207661_10230284
701 Ga0207679_10282744
702 Ga0207667_10032019
703 Ga0207667_10095265
704 Ga0207667_10135612
705 Ga0207667_10468399
706 Ga0207651_10007819
707 Ga0207651_10153318
708 Ga0207651_10431921
709 Ga0207658_10011021
710 Ga0207658_10056213
711 Ga0207677_10182727
712 Ga0207677_10267223
713 Ga0207703_10289780
714 Ga0207678_10191305
715 Ga0207702_10001699
716 Ga0207702_10114515
717 Ga0207641_10562708
718 Ga0207648_10014340
719 Ga0207676_10270476
720 Ga0207674_10018631
721 Ga0207683_10008556
722 Ga0207683_10033005
723 Ga0207683_10072495
724 Ga0207698_10370275
725 Ga0268266_10001520
726 Ga0268266_10002793
727 Ga0268266_10167502
728 Ga0268264_10078893
729 Ga0268264_10198213
730 Ga0265337_1000020
731 Ga0265337_1028095
732 Ga0265320_10020920
733 Ga0265327_10027465
734 Ga0307513_10057374
735 Ga0307408_100227401
736 Ga0265313_10001769
737 Ga0265314_10031875
738 Ga0307410_10010911
739 Ga0307406_10078767
740 Ga0307407_10031220
741 Ga0307409_100038894
742 Ga0307409_100502427
743 Ga0307416_100558613
744 Ga0307411_10153449
745 Ga0307411_10709879
746 Ga0307415_100324212
747 Ga0373956_0015570
748 Ga0373956_0138028
749 Ga0373957_0084110
750 Ga0373931_0012455
751 Ga0373931_0064691
752 Ga0373935_0005576
753 Ga0373935_0041986
754 Ga0373927_0073636
755 Ga0373933_0404012
756 Ga0373947_0046546
757 Ga0373937_0005341
758 Ga0373937_0031504
759 Ga0373937_0081113
760 Ga0373937_0135633
761 Ga0373925_0010394
762 Ga0373925_0123639
763 Ga0373925_0288910
764 Ga0373925_0402145
765 Ga0395899_0000655
766 Ga0395899_0235509
767 Ga0395900_0000033
768 Ga0395900_0004228
769 Ga0395900_0009879
770 Ga0395900_0210740
771 Ga0395900_0366239
772 Ga0395900_0383417
773 Ga0395898_0000057
774 Ga0395898_0004958
775 Ga0395898_0242504
776 Ga0395898_0452429
777 Ga0395905_0024173
778 Ga0395901_0001492
779 Ga0395901_0354926
780 Ga0395901_0479245
781 Ga0395901_0698293
782 Ga0436365_0925115
783 Ga0436365_1416355
784 Ga0436361_0192133
785 Ga0436363_0298909
786 Ga0436362_0231123
787 Ga0466964_0048990
788 Ga0466957_0166396
789 Ga0451576_0001470
790 Ga0466967_0224826
791 Ga0466967_0667160
792 Ga0495651_0016665
793 Ga0495653_0198870
794 Ga0495580_0140035
795 Ga0495639_0031359
796 Ga0495618_0001508
797 Ga0495628_0029492
798 Ga0495630_0042511
799 Ga0495630_0108164
800 Ga0495630_0302150
801 Ga0495666_0139762
802 Ga0495640_0115489
803 Ga0495586_0096841
804 Ga0495598_0005053
805 Ga0495667_0053848
806 Ga0495634_0004187
807 Ga0495647_0047710
808 Ga0495658_0012284
809 Ga0495658_0359533
810 Ga0495613_0029578
811 Ga0495624_0040386
812 Ga0495674_0036043
813 Ga0495680_0170952
814 Ga0495675_0015174
815 Ga0495677_0129547
816 Ga0495684_0007093
817 Ga0495684_0007174
818 Ga0495684_0262605
819 Ga0496107_0127488
820 Ga0496109_0088718
821 Ga0496109_0656149
822 Ga0496112_0095099
823 Ga0496112_0395075
824 Ga0496113_0145469
825 Ga0496115_0346129
826 Ga0501034_0000512
827 Ga0501034_0064581
828 Ga0501034_0185486
829 Ga0501037_0137836
830 Ga0501047_0208340
831 Ga0501047_0439205
832 Ga0501217_080357
833 Ga0501083_0016949
834 Ga0501083_0284652
835 Ga0501044_0005220
836 Ga0501044_0026078
837 nmdc:mga05p37_629148_c1
838 nmdc:mga05p37_66297_c1
839 nmdc:mga09592_125519_c1
840 nmdc:mga0qj67_357593_c1
841 nmdc:mga0qj67_95823_c1
842 nmdc:mga06r32_363086_c1
843 nmdc:mga08y16_329988_c1
844 nmdc:mga08y16_420389_c1
845 nmdc:mga0n895_342016_c1
846 nmdc:mga0rr50_531480_c1
847 nmdc:mga08x19_25249_c1
848 Ga0495655_0008622
849 Ga0495619_0229218
850 Ga0500650_0011547
851 Ga0500645_022924
852 2787434926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

24

270

0.94

PF00106

adh_short

short chain dehydrogenase

18

220

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yw9-assembly1.cif.gz_A crystal structure of tt0143 from thermus thermophilus hb8 0.973 6 255
2yw9-assembly2.cif.gz_F crystal structure of tt0143 from thermus thermophilus hb8 0.9696 6 258
5ycr-assembly1.cif.gz_D x-ray structure of enoyl-acyl carrier protein reductase from bacillus anthracis with nad+ 0.9695 5 255
5ycr-assembly1.cif.gz_B x-ray structure of enoyl-acyl carrier protein reductase from bacillus anthracis with nad+ 0.9678 5 255
2yw9-assembly2.cif.gz_E crystal structure of tt0143 from thermus thermophilus hb8 0.9666 6 258
ID Description Score Start End Superfamily
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 5 258 3.40.50.720
2p91C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 6 258 3.40.50.720
2wyuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.957 1 258 3.40.50.720
af_P0AEK4_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 5 255 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 5 258 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V5MYE0-F1-model_v4 NADH-specific enoyl-ACP reductase 0.9883 1 147 GO:0004318
GO:0006633
AF-A0A520J856-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9852 3 187 GO:0004318
GO:0006633
AF-A0A1B3SNY8-F1-model_v4 SEL-1-like domain containing protein 0.9833 3 195 GO:0004318
GO:0006633
AF-A0A357X796-F1-model_v4 deleted 0.9833 3 190
AF-A0A3L7XT90-F1-model_v4 SDR family oxidoreductase 0.983 6 187 GO:0004318
GO:0006633

Map