F441080

General Info

Members Datasets Scaffolds Average Seq Length
425 388 194 211

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231002|2511244257
Length 241
Sequence LPGRRRSAPSGGSEVHEVTSVGAIVYALEMKLHNYFRSSSSFRVRIAMELKGLSYDYIPVHIAKGEHKQPPYAALAADTLVPLLEVDGEKLSQSMAIIEYLDEKHPTPALLPADALGRAKVRALAQSIACEIHPVNNLRVLKYLVKELKLDETAKNAWYVHWCREGLEAFERQLAQLPASTYCYGDTPTLADCCLVPQIFNAKRFNVSFDGLPRTMAAFDACMALPAFQKAQPSACPDNEA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
16 2516143018 Ensifer sp. BR816 Isolate Nodule
17 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
18 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
19 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
20 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
21 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
22 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
23 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
24 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
25 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
26 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
27 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
28 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
29 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
30 2643221557 Ensifer sp. Root558 Isolate Unclassified
31 2643221610 Ensifer sp. Root74 Isolate Unclassified
32 2643221668 Ensifer sp. Root423 Isolate Unclassified
33 2643221675 Ensifer sp. Root1298 Isolate Unclassified
34 2643221680 Ensifer sp. Root1312 Isolate Unclassified
35 2643221688 Rhizobium sp. Root482 Isolate Unclassified
36 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
37 2643221726 Ensifer sp. Root954 Isolate Unclassified
38 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
39 2738543013 Variovorax sp. BT01 Isolate Unclassified
40 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
41 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
42 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
43 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
44 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
45 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
46 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
47 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
48 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
49 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
50 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
51 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
52 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
53 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
54 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
55 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
56 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
57 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
58 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
59 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
60 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
61 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
62 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
63 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
64 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
65 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
66 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
67 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
68 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
69 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
70 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
71 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
72 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
73 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
74 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
75 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
76 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
77 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
78 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
79 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
80 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
81 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
82 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
83 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
84 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
85 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
86 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
87 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
88 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
89 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
90 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
91 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
92 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
93 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
94 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
95 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
96 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
97 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
98 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
99 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
100 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
101 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
102 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
103 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
104 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
105 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
106 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
107 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
108 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
109 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
110 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
111 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
112 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
113 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
114 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
115 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
116 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
117 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
118 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
119 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
120 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
121 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
122 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
123 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
124 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
125 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
126 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
127 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
128 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
129 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
130 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
131 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
132 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
133 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
134 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
135 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
136 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
137 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
138 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
139 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
140 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
141 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
142 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
143 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
144 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
145 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
146 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
147 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
148 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
149 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
150 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
151 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
152 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
153 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
154 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
155 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
156 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
157 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
158 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
159 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
160 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
161 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
162 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
163 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
164 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
165 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
166 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
167 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
168 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
169 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
170 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
171 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
172 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
173 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
174 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
175 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
176 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
177 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
178 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
179 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
180 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
181 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
182 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
183 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
184 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
185 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
186 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
187 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
188 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
189 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
190 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
191 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
192 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
193 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
194 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
195 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
196 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
197 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
198 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
199 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
200 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
201 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
202 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
203 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
204 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
205 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
206 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
207 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
208 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
209 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
210 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
211 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
212 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
213 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
214 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
215 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
216 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
217 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
218 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
219 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
220 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
221 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
222 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
223 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
224 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
225 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
226 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
227 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
228 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
229 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
230 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
231 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
232 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
233 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
234 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
235 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
236 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
237 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
238 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
239 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
240 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
241 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
242 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
243 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
244 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
245 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
246 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
247 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
248 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
249 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
250 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
251 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
252 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
253 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
254 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
255 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
256 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
257 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
258 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
259 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
260 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
261 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
262 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
263 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
264 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
265 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
266 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
267 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
268 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
269 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
270 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
271 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
272 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
273 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
274 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
275 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
276 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
277 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
278 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
279 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
280 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
281 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
282 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
283 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
284 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
285 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
286 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
287 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
288 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
289 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
290 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
291 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
292 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
293 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
294 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
295 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
296 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
297 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
298 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
299 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
301 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
304 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
305 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
306 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
308 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
309 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
332 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
337 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
338 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
339 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
340 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
341 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
342 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
343 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
344 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
345 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
346 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
347 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
348 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
349 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
350 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
351 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
352 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
353 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
354 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
355 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
356 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
357 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
358 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
359 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
360 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
361 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
362 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
363 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
372 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
373 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
381 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
382 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
383 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
384 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
385 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
386 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
387 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
388 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.65
Metatranscriptomes 0
Isolates 54.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.41
Nodule 52.47
Rhizoplane 0.94
Rhizosphere 25.18
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000008 3300002704 Bacteria 236146
2 JGI25156J39149_1000002 3300002705 Bacteria 343501
3 JGI25154J39366_1000010 3300002738 Bacteria 297985
4 JGI25157J39369_1000001 3300002741 Bacteria 363277
5 JGI25150J39212_1001035 3300002774 Bacteria 8516
6 JGI25159J45721_1000202 3300002987 Bacteria 27648
7 JGI25159J45721_1001674 3300002987 Bacteria 8990
8 JGI25151J46595_10008085 3300003187 Bacteria 5096
9 rootH1_10174387 3300003316 Bacteria 1233
10 JGI25160J50197_1000156 3300003354 Bacteria 60358
11 JGI25161J50226_1000043 3300003374 Bacteria 120741
12 Ga0055526_1016724 3300003771 Bacteria 2850
13 Ga0055524_1000530 3300003775 Bacteria 29086
14 Ga0055536_1000085 3300003781 Bacteria 80741
15 Ga0055534_1001681 3300003784 Bacteria 8475
16 Ga0055530_10000254 3300003791 Bacteria 48098
17 Ga0055540_1000079 3300003792 Bacteria 112817
18 Ga0055531_10000402 3300003794 Bacteria 41572
19 Ga0055543_1000160 3300004625 Bacteria 56093
20 Ga0065165_1004962 3300005262 Bacteria 7816
21 Ga0065165_1012629 3300005262 Bacteria 3422
22 Ga0068869_100298051 3300005334 Bacteria 1301
23 Ga0068869_100571926 3300005334 Bacteria 952
24 Ga0070660_100193898 3300005339 Bacteria 1646
25 Ga0070689_100247932 3300005340 Bacteria 1469
26 Ga0070675_100016484 3300005354 Bacteria 5868
27 Ga0070674_100133432 3300005356 Bacteria 1855
28 Ga0070674_100268137 3300005356 Bacteria 1348
29 Ga0070674_100335700 3300005356 Bacteria 1216
30 Ga0070674_100636675 3300005356 Bacteria 905
31 Ga0070659_100084190 3300005366 Bacteria 2543
32 Ga0070659_100195169 3300005366 Bacteria 1665
33 Ga0070700_100221277 3300005441 Bacteria 1341
34 Ga0070700_100237502 3300005441 Bacteria 1300
35 Ga0070678_100140553 3300005456 Bacteria 1931
36 Ga0070707_100280905 3300005468 Bacteria 1618
37 Ga0070679_100047309 3300005530 Bacteria 4288
38 Ga0070672_100002375 3300005543 Bacteria 11913
39 Ga0068855_100090578 3300005563 Bacteria 3529
40 Ga0068857_100997198 3300005577 Bacteria 806
41 Ga0068852_100005912 3300005616 Bacteria 8799
42 Ga0068852_100255569 3300005616 Bacteria 1680
43 Ga0068859_100276537 3300005617 Bacteria 1772
44 Ga0068851_10002659 3300005834 Bacteria 7872
45 Ga0068870_10032725 3300005840 Bacteria 2647
46 Ga0075368_10126202 3300006042 Bacteria 1062
47 Ga0075364_10016511 3300006051 Bacteria 4594
48 Ga0075432_10001748 3300006058 Bacteria 7153
49 Ga0075362_10116351 3300006177 Bacteria 1262
50 Ga0075367_10201150 3300006178 Bacteria 1245
51 Ga0097621_100111579 3300006237 Bacteria 2311
52 Ga0068871_100032643 3300006358 Bacteria 4115
53 Ga0075428_100055792 3300006844 Bacteria 4329
54 Ga0075431_100416212 3300006847 Bacteria 1343
55 Ga0075433_10037034 3300006852 Bacteria 4205
56 Ga0097620_100276532 3300006931 Bacteria 1772
57 Ga0079104_1000986 3300006946 Bacteria 22164
58 Ga0079104_1027955 3300006946 Bacteria 1439
59 Ga0105240_10055818 3300009093 Bacteria 4945
60 Ga0111539_10680716 3300009094 Bacteria 1197
61 Ga0105245_10769496 3300009098 Bacteria 999
62 Ga0114129_10055563 3300009147 Bacteria 5548
63 Ga0114129_10150761 3300009147 Bacteria 3182
64 Ga0105243_10302683 3300009148 Bacteria 1450
65 Ga0105248_10167705 3300009177 Bacteria 2475
66 Ga0105238_10025282 3300009551 Bacteria 6052
67 Ga0105033_105234 3300009986 Bacteria 1114
68 Ga0157369_10001974 3300013105 Bacteria 24742
69 Ga0171463_1014 3300013249 Bacteria 83917
70 Ga0157374_10316527 3300013296 Bacteria 1546
71 Ga0157372_10083620 3300013307 Bacteria 3616
72 Ga0157372_10958498 3300013307 Bacteria 992
73 Ga0183363_1028 3300015690 Bacteria 50706
74 Ga0163161_10039009 3300017792 Bacteria 3408
75 Ga0214544_1000123 3300021320 Bacteria 110258
76 Ga0214542_1000141 3300021321 Bacteria 104386
77 Ga0214543_1000008 3300021327 Bacteria 385680
78 Ga0214543_1000026 3300021327 Bacteria 220652
79 Ga0228711_1001864 3300022739 Bacteria 31722
80 Ga0228710_1001994 3300022740 Bacteria 31627
81 Ga0209435_100001 3300025206 Bacteria 1424171
82 Ga0207425_1001152 3300025245 Bacteria 11850
83 Ga0207425_1004304 3300025245 Bacteria 4306
84 Ga0209646_1000001 3300025246 Bacteria 3092932
85 Ga0209026_1000001 3300025250 Bacteria 1228671
86 Ga0209759_1000001 3300025256 Bacteria 2799452
87 Ga0209673_1046228 3300025273 Bacteria 1190
88 Ga0209130_1000041 3300025284 Bacteria 261078
89 Ga0209130_1027632 3300025284 Bacteria 1202
90 Ga0209675_1004891 3300025291 Bacteria 5788
91 Ga0209675_1005504 3300025291 Bacteria 5287
92 Ga0209675_1025735 3300025291 Bacteria 1478
93 Ga0209676_1000054 3300025292 Bacteria 365890
94 Ga0209676_1003715 3300025292 Bacteria 9106
95 Ga0209676_1006880 3300025292 Bacteria 5499
96 Ga0209025_1004305 3300025294 Bacteria 12474
97 Ga0209025_1010741 3300025294 Bacteria 6157
98 Ga0209025_1042327 3300025294 Bacteria 1937
99 Ga0209564_1000463 3300025295 Bacteria 68043
100 Ga0209564_1014305 3300025295 Bacteria 3310
101 Ga0209758_1011663 3300025297 Bacteria 5053
102 Ga0209050_1000066 3300025298 Bacteria 305458
103 Ga0209050_1008728 3300025298 Bacteria 5340
104 Ga0209050_1023662 3300025298 Bacteria 2152
105 Ga0209256_1000456 3300025299 Bacteria 61717
106 Ga0207426_1000061 3300025302 Bacteria 362507
107 Ga0207426_1002771 3300025302 Bacteria 10554
108 Ga0209051_1000044 3300025303 Bacteria 305458
109 Ga0209257_1000082 3300025304 Bacteria 305458
110 Ga0209257_1024374 3300025304 Bacteria 2096
111 Ga0207656_10001998 3300025321 Bacteria 6800
112 Ga0207688_10182571 3300025901 Bacteria 1252
113 Ga0207643_10040749 3300025908 Bacteria 2615
114 Ga0207705_10170317 3300025909 Bacteria 1639
115 Ga0207695_10097446 3300025913 Bacteria 2942
116 Ga0207681_10651520 3300025923 Bacteria 873
117 Ga0207694_10018247 3300025924 Bacteria 5303
118 Ga0207690_10037918 3300025932 Bacteria 3133
119 Ga0207706_10350466 3300025933 Bacteria 1284
120 Ga0207669_10235922 3300025937 Bacteria 1353
121 Ga0207669_10261837 3300025937 Bacteria 1294
122 Ga0207711_10141548 3300025941 Bacteria 2165
123 Ga0207689_10115986 3300025942 Bacteria 2202
124 Ga0207689_10550831 3300025942 Bacteria 969
125 Ga0207661_10103164 3300025944 Bacteria 2400
126 Ga0207667_10040123 3300025949 Bacteria 4985
127 Ga0207667_10337313 3300025949 Bacteria 1539
128 Ga0207651_10048261 3300025960 Bacteria 2877
129 Ga0207708_10363384 3300026075 Bacteria 1190
130 Ga0207648_10016107 3300026089 Bacteria 6847
131 Ga0207674_10103066 3300026116 Bacteria 2833
132 Ga0207683_10110249 3300026121 Bacteria 2464
133 Ga0207698_10001424 3300026142 Bacteria 13887
134 Ga0207698_10006552 3300026142 Bacteria 7277
135 Ga0207698_10148461 3300026142 Bacteria 2031
136 Ga0209281_1000141 3300027111 Bacteria 175634
137 Ga0209281_1000731 3300027111 Bacteria 32139
138 Ga0209969_1000950 3300027360 Bacteria 3935
139 Ga0209981_1009861 3300027378 Bacteria 1308
140 Ga0210000_1000213 3300027462 Bacteria 8380
141 Ga0209995_1002301 3300027471 Bacteria 3013
142 Ga0209999_1005087 3300027543 Bacteria 2363
143 Ga0209282_1000203 3300027666 Bacteria 31858
144 Ga0209966_1028232 3300027695 Bacteria 1126
145 Ga0307513_10000021 3300031456 Bacteria 228078
146 Ga0307513_10114173 3300031456 Bacteria 2687
147 Ga0307408_100001995 3300031548 Bacteria 14740
148 Ga0307516_10013650 3300031730 Bacteria 8631
149 Ga0307405_10507363 3300031731 Bacteria 968
150 Ga0307406_10014288 3300031901 Bacteria 4565
151 Ga0315914_1001932 3300031967 Bacteria 31627
152 Ga0307409_100495068 3300031995 Bacteria 1189
153 Ga0307416_100483131 3300032002 Bacteria 1299
154 Ga0307414_10196287 3300032004 Bacteria 1638
155 Ga0315913_1000745 3300033430 Bacteria 31622
156 Ga0315915_1000005 3300033464 Bacteria 397591
157 Ga0395899_0026534 3300037312 Bacteria 4371
158 Ga0395905_0008590 3300037471 Bacteria 10068
159 Ga0439461_0001368 3300041410 Bacteria 3759
160 Ga0451807_1901993 3300041486 Bacteria 701
161 Ga0439431_0030327 3300041997 Bacteria 1339
162 Ga0439433_0005618 3300041999 Bacteria 2692
163 Ga0439449_0028237 3300042007 Bacteria 2091
164 Ga0439449_0042239 3300042007 Bacteria 1694
165 Ga0439446_0088985 3300042156 Bacteria 964
166 Ga0439434_0000549 3300042435 Bacteria 10765
167 Ga0439435_0000051 3300042436 Bacteria 13320
168 Ga0466966_0071829 3300044684 Bacteria 2168
169 Ga0466957_0050119 3300044842 Bacteria 2540
170 Ga0466959_0168705 3300045049 Bacteria 1536
171 Ga0466958_0121140 3300045836 Bacteria 1638
172 Ga0496104_0068232 3300048907 Bacteria 3379
173 Ga0496105_0342863 3300048908 Bacteria 1194
174 Ga0496111_0118328 3300048914 Bacteria 1956
175 Ga0496126_0593850 3300048929 Bacteria 873
176 Ga0501034_0000340 3300049571 Bacteria 81287
177 Ga0501036_0773219 3300049572 Bacteria 792
178 Ga0501072_0318166 3300049588 Bacteria 1237
179 nmdc:mga03683_309757_c1 3300050489 Bacteria 742
180 nmdc:mga03n38_206020_c1 3300050490 Bacteria 1020
181 nmdc:mga00v17_17025_c1 3300050491 Bacteria 4105
182 nmdc:mga06z11_155109_c1 3300050494 Bacteria 1305
183 nmdc:mga05p37_118241_c1 3300050507 Bacteria 3257
184 nmdc:mga09592_96930_c1 3300050508 Bacteria 2523
185 nmdc:mga06r32_218995_c1 3300050510 Bacteria 1892
186 nmdc:mga08y16_623561_c1 3300050511 Bacteria 1085
187 nmdc:mga0a205_67815_c1 3300050515 Bacteria 3446
188 Ga0500644_0001434 3300053088 Bacteria 6307
189 Ga0500651_0010282 3300053093 Bacteria 5604
190 Ga0500593_000233 3300053117 Bacteria 22924
191 Ga0500645_000229 3300053730 Bacteria 42795
192 Ga0500645_002065 3300053730 Bacteria 9316
193 Ga0500645_122728 3300053730 Bacteria 724
194 Ga0500661_035652 3300055283 Bacteria 879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0000340 Ga0501034_0000340_37841_38455 185
2 3300041410 Ga0439461_0001368 Ga0439461_0001368_1109_1750 186
3 3300041997 Ga0439431_0030327 Ga0439431_0030327_679_1320 186
4 3300041999 Ga0439433_0005618 Ga0439433_0005618_1091_1732 186
5 3300042156 Ga0439446_0088985 Ga0439446_0088985_136_777 186
6 3300042435 Ga0439434_0000549 Ga0439434_0000549_3535_4176 186
7 3300042436 Ga0439435_0000051 Ga0439435_0000051_4695_5336 186
8 3300027360 Ga0209969_1000950 Ga0209969_10009503 188
9 3300027378 Ga0209981_1009861 Ga0209981_10098612 188
10 3300027462 Ga0210000_1000213 Ga0210000_10002135 188
11 3300027471 Ga0209995_1002301 Ga0209995_10023014 188
12 3300027543 Ga0209999_1005087 Ga0209999_10050874 188
13 3300027695 Ga0209966_1028232 Ga0209966_10282322 188
14 3300003316 rootH1_10174387 rootH1_101743872 190
15 3300003775 Ga0055524_1000530 Ga0055524_10005305 191
16 3300006946 Ga0079104_1000986 Ga0079104_10009862 191
17 3300009986 Ga0105033_105234 Ga0105033_1052342 191
18 3300013249 Ga0171463_1014 Ga0171463_101425 191
19 3300015690 Ga0183363_1028 Ga0183363_102812 191
20 3300021327 Ga0214543_1000008 Ga0214543_1000008315 191
21 3300022739 Ga0228711_1001864 Ga0228711_100186432 191
22 3300022740 Ga0228710_1001994 Ga0228710_10019942 191
23 3300025299 Ga0209256_1000456 Ga0209256_100045627 191
24 3300025901 Ga0207688_10182571 Ga0207688_101825712 191
25 3300027111 Ga0209281_1000141 Ga0209281_1000141127 191
26 3300027111 Ga0209281_1000731 Ga0209281_10007312 191
27 3300027666 Ga0209282_1000203 Ga0209282_10002032 191
28 3300031967 Ga0315914_1001932 Ga0315914_100193232 191
29 3300033430 Ga0315913_1000745 Ga0315913_100074532 191
30 3300033464 Ga0315915_1000005 Ga0315915_1000005344 191
31 3300042007 Ga0439449_0028237 Ga0439449_0028237_1404_2057 191
32 3300042007 Ga0439449_0042239 Ga0439449_0042239_34_675 191
33 iso_pu_bacteria 2508501122 2509110167 191
34 iso_pu_bacteria 2509276019 2509378899 191
35 iso_pu_bacteria 2510065057 2510307949 191
36 iso_pu_bacteria 2511231052 2511503085 191
37 iso_pu_bacteria 2512047086 2512534348 191
38 iso_pu_bacteria 2512875026 2512973832 191
39 iso_pu_bacteria 2513237086 2513586788 191
40 iso_pu_bacteria 2513237089 2513606912 191
41 iso_pu_bacteria 2513237091 2513620350 191
42 iso_pu_bacteria 2513237140 2513886646 191
43 iso_pu_bacteria 2513237143 2513906648 191
44 iso_pu_bacteria 2513237156 2513987631 191
45 iso_pu_bacteria 2513237160 2514008619 191
46 iso_pu_bacteria 2515154107 2515613111 191
47 iso_pu_bacteria 2516143018 2516205349 191
48 iso_pu_bacteria 2516653046 2516894489 191
49 iso_pu_bacteria 2517487022 2517571106 191
50 iso_pu_bacteria 2524023207 2524453912 191
51 iso_pu_bacteria 2551306084 2551678586 191
52 iso_pu_bacteria 2551306084 2551681778 191
53 iso_pu_bacteria 2551306085 2551685590 191
54 iso_pu_bacteria 2551306086 2551692289 191
55 iso_pu_bacteria 2551306087 2551697812 191
56 iso_pu_bacteria 2551306089 2551715135 191
57 iso_pu_bacteria 2551306090 2551718924 191
58 iso_pu_bacteria 2551306091 2551727909 191
59 iso_pu_bacteria 2551306092 2551739040 191
60 iso_pu_bacteria 2551306093 2551740255 191
61 iso_pu_bacteria 2558860100 2558860506 191
62 iso_pu_bacteria 2643221557 2643809666 191
63 iso_pu_bacteria 2643221610 2644063846 191
64 iso_pu_bacteria 2643221668 2644381368 191
65 iso_pu_bacteria 2643221675 2644415679 191
66 iso_pu_bacteria 2643221680 2644448719 191
67 iso_pu_bacteria 2643221726 2644686887 191
68 iso_pu_bacteria 2690316117 2692320027 191
69 iso_pu_bacteria 2751185821 2753460987 191
70 iso_pu_bacteria 2791355091 2792623661 191
71 iso_pu_bacteria 2791355092 2792625622 191
72 iso_pu_bacteria 2791355094 2792643491 191
73 iso_pu_bacteria 2802428858 2802721756 191
74 iso_pu_bacteria 2802428859 2802725345 191
75 iso_pu_bacteria 2802428860 2802734556 191
76 iso_pu_bacteria 2802428861 2802741122 191
77 iso_pu_bacteria 2802428862 2802747403 191
78 iso_pu_bacteria 2802428863 2802753063 191
79 iso_pu_bacteria 2838074704 2838077534 191
80 iso_pu_bacteria 2847417321 2847420546 191
81 iso_pu_bacteria 2848992105 2848995418 191
82 iso_pu_bacteria 2850079185 2850082403 191
83 iso_pu_bacteria 2855825444 2855827125 191
84 iso_pu_bacteria 2855839649 2855842522 191
85 iso_pu_bacteria 2855872281 2855876431 191
86 iso_pu_bacteria 2858800743 2858803338 191
87 iso_pu_bacteria 2896384573 2896387621 191
88 iso_pu_bacteria 2915980308 2915985102 191
89 iso_pu_bacteria 2915986958 2915990197 191
90 iso_pu_bacteria 2915993759 2915997701 191
91 iso_pu_bacteria 2916000859 2916006920 191
92 iso_pu_bacteria 2916007675 2916009454 191
93 iso_pu_bacteria 2916014648 2916019512 191
94 iso_pu_bacteria 2916021584 2916026616 191
95 iso_pu_bacteria 2916028427 2916033671 191
96 iso_pu_bacteria 2916035215 2916036858 191
97 iso_pu_bacteria 2916041962 2916047500 191
98 iso_pu_bacteria 2916048683 2916053408 191
99 iso_pu_bacteria 2916055098 2916060255 191
100 iso_pu_bacteria 2916061851 2916067302 191
101 iso_pu_bacteria 2916068649 2916071790 191
102 iso_pu_bacteria 2916076590 2916080693 191
103 iso_pu_bacteria 2920760137 2920760656 191
104 iso_pu_bacteria 2920822456 2920828383 191
105 iso_pu_bacteria 2921201388 2921201421 191
106 iso_pu_bacteria 2921208531 2921213856 191
107 iso_pu_bacteria 2921237296 2921237504 191
108 iso_pu_bacteria 2921244191 2921244313 191
109 iso_pu_bacteria 2921250672 2921255976 191
110 iso_pu_bacteria 2921257292 2921262422 191
111 iso_pu_bacteria 2921263974 2921269183 191
112 iso_pu_bacteria 2921282425 2921286323 191
113 iso_pu_bacteria 2921289301 2921293333 191
114 iso_pu_bacteria 2921296804 2921298236 191
115 iso_pu_bacteria 2924144063 2924148724 191
116 iso_pu_bacteria 2924150972 2924154953 191
117 iso_pu_bacteria 2924158325 2924164169 191
118 iso_pu_bacteria 2924165586 2924166574 191
119 iso_pu_bacteria 2924172951 2924178358 191
120 iso_pu_bacteria 2924179722 2924182292 191
121 iso_pu_bacteria 2924186466 2924188524 191
122 iso_pu_bacteria 2924193448 2924193869 191
123 iso_pu_bacteria 2924200457 2924206604 191
124 iso_pu_bacteria 2924207177 2924213036 191
125 iso_pu_bacteria 2924214083 2924221295 191
126 iso_pu_bacteria 2924221636 2924224640 191
127 iso_pu_bacteria 2924228884 2924231986 191
128 iso_pu_bacteria 2936996657 2937000157 191
129 iso_pu_bacteria 2937002841 2937006894 191
130 iso_pu_bacteria 2937009748 2937015024 191
131 iso_pu_bacteria 2937016420 2937018083 191
132 iso_pu_bacteria 2937023124 2937024287 191
133 iso_pu_bacteria 2937029754 2937032899 191
134 iso_pu_bacteria 2937036028 2937041554 191
135 iso_pu_bacteria 2937042894 2937048156 191
136 iso_pu_bacteria 2937049772 2937054877 191
137 iso_pu_bacteria 2937056579 2937062022 191
138 iso_pu_bacteria 2937063883 2937070119 191
139 iso_pu_bacteria 2937071275 2937071308 191
140 iso_pu_bacteria 2937078374 2937083340 191
141 iso_pu_bacteria 2937084907 2937088102 191
142 iso_pu_bacteria 2937091812 2937097359 191
143 iso_pu_bacteria 2937098957 2937104807 191
144 iso_pu_bacteria 2937106411 2937110547 191
145 iso_pu_bacteria 2937113482 2937114481 191
146 iso_pu_bacteria 2937119839 2937123791 191
147 iso_pu_bacteria 2937126314 2937129231 191
148 iso_pu_bacteria 2957375807 2957380590 191
149 iso_pu_bacteria 2957382221 2957385992 191
150 iso_pu_bacteria 2957388812 2957390076 191
151 iso_pu_bacteria 2957395598 2957400435 191
152 iso_pu_bacteria 2957402308 2957406173 191
153 iso_pu_bacteria 2957408893 2957408926 191
154 iso_pu_bacteria 2957415311 2957421967 191
155 iso_pu_bacteria 2957422303 2957426111 191
156 iso_pu_bacteria 2957430029 2957430624 191
157 iso_pu_bacteria 2957437181 2957442332 191
158 iso_pu_bacteria 2957443900 2957444438 191
159 iso_pu_bacteria 2957450854 2957454452 191
160 iso_pu_bacteria 2957457609 2957459447 191
161 iso_pu_bacteria 2957464669 2957468288 191
162 iso_pu_bacteria 2957471148 2957477978 191
163 iso_pu_bacteria 2957478035 2957483080 191
164 iso_pu_bacteria 2957484790 2957485590 191
165 iso_pu_bacteria 2957491536 2957497724 191
166 iso_pu_bacteria 2957498199 2957500319 191
167 iso_pu_bacteria 2957505466 2957506963 191
168 iso_pu_bacteria 2960584000 2960587525 191
169 iso_pu_bacteria 2960591022 2960591371 191
170 iso_pu_bacteria 2960597568 2960602870 191
171 iso_pu_bacteria 2960603979 2960609866 191
172 iso_pu_bacteria 2960610863 2960615800 191
173 iso_pu_bacteria 2960617483 2960622229 191
174 iso_pu_bacteria 2960624210 2960629729 191
175 iso_pu_bacteria 2960631154 2960636491 191
176 iso_pu_bacteria 2960637947 2960638794 191
177 iso_pu_bacteria 2960645483 2960646655 191
178 iso_pu_bacteria 2960652885 2960657873 191
179 iso_pu_bacteria 2960660292 2960665784 191
180 iso_pu_bacteria 2960667422 2960671405 191
181 iso_pu_bacteria 2960674078 2960675393 191
182 iso_pu_bacteria 2960680706 2960685879 191
183 iso_pu_bacteria 2960687367 2960689216 191
184 iso_pu_bacteria 2960693952 2960700054 191
185 iso_pu_bacteria 2964607997 2964613660 191
186 iso_pu_bacteria 2964615318 2964618552 191
187 iso_pu_bacteria 2964621998 2964624870 191
188 iso_pu_bacteria 2964628898 2964631393 191
189 iso_pu_bacteria 2964636051 2964641701 191
190 iso_pu_bacteria 2964643177 2964648238 191
191 iso_pu_bacteria 2964649959 2964650953 191
192 iso_pu_bacteria 2964656573 2964659065 191
193 iso_pu_bacteria 2964663802 2964668766 191
194 iso_pu_bacteria 2964678106 2964681700 191
195 iso_pu_bacteria 2964685014 2964689429 191
196 iso_pu_bacteria 2964691889 2964697142 191
197 iso_pu_bacteria 2964698721 2964704048 191
198 iso_pu_bacteria 2964705432 2964711509 191
199 iso_pu_bacteria 2964712639 2964719136 191
200 iso_pu_bacteria 2964719344 2964724313 191
201 iso_pu_bacteria 2967664464 2967669963 191
202 iso_pu_bacteria 2967671571 2967673175 191
203 iso_pu_bacteria 2967678726 2967682974 191
204 iso_pu_bacteria 2967686174 2967691790 191
205 iso_pu_bacteria 2967693043 2967696068 191
206 iso_pu_bacteria 2967699805 2967699954 191
207 iso_pu_bacteria 2967706974 2967709493 191
208 iso_pu_bacteria 2967714385 2967715872 191
209 iso_pu_bacteria 2967721400 2967726497 191
210 iso_pu_bacteria 2967728569 2967732393 191
211 iso_pu_bacteria 2967735183 2967735479 191
212 iso_pu_bacteria 2967742019 2967748777 191
213 iso_pu_bacteria 2967748971 2967750185 191
214 iso_pu_bacteria 2967755722 2967760642 191
215 iso_pu_bacteria 2967762386 2967769115 191
216 iso_pu_bacteria 2967769361 2967774496 191
217 iso_pu_bacteria 2967775926 2967781230 191
218 iso_pu_bacteria 2970019648 2970025026 191
219 iso_pu_bacteria 2970026789 2970029406 191
220 iso_pu_bacteria 2970033650 2970036358 191
221 iso_pu_bacteria 2970040964 2970041817 191
222 iso_pu_bacteria 2970047711 2970053703 191
223 iso_pu_bacteria 2970054988 2970061001 191
224 iso_pu_bacteria 2970061556 2970067797 191
225 iso_pu_bacteria 2970068827 2970071863 191
226 iso_pu_bacteria 2970076120 2970082065 191
227 iso_pu_bacteria 2970082768 2970084198 191
228 iso_pu_bacteria 2970088815 2970095446 191
229 iso_pu_bacteria 2970095765 2970099028 191
230 iso_pu_bacteria 2970102677 2970108774 191
231 iso_pu_bacteria 2970109326 2970115201 191
232 iso_pu_bacteria 2970116247 2970119263 191
233 iso_pu_bacteria 2970122695 2970128033 191
234 iso_pu_bacteria 2970129317 2970134243 191
235 iso_pu_bacteria 2970136068 2970142336 191
236 iso_pu_bacteria 2970143518 2970148863 191
237 iso_pu_bacteria 2970149975 2970155702 191
238 iso_pu_bacteria 2970156795 2970162446 191
239 iso_pu_bacteria 2970164137 2970165947 191
240 iso_pu_bacteria 2970170962 2970176112 191
241 iso_pu_bacteria 2970177841 2970179784 191
242 iso_pu_bacteria 2970184632 2970186470 191
243 iso_pu_bacteria 2970191845 2970194453 191
244 iso_pu_bacteria 2977516862 2977522680 191
245 iso_pu_bacteria 2977523885 2977530140 191
246 iso_pu_bacteria 2977530762 2977536310 191
247 iso_pu_bacteria 2977537788 2977540913 191
248 iso_pu_bacteria 2977544691 2977550804 191
249 iso_pu_bacteria 2977551784 2977556793 191
250 iso_pu_bacteria 2977558990 2977565542 191
251 iso_pu_bacteria 2977565890 2977569055 191
252 iso_pu_bacteria 2977572785 2977578066 191
253 iso_pu_bacteria 2977579622 2977579656 191
254 iso_pu_bacteria 643692032 643827184 191
255 iso_pu_bacteria 648276728 648735753 191
256 iso_pu_bacteria 8003992118 8003995063 191
257 iso_pu_bacteria 8003999396 8004002824 191
258 3300005334 Ga0068869_100298051 Ga0068869_1002980512 192
259 3300005340 Ga0070689_100247932 Ga0070689_1002479322 192
260 3300005354 Ga0070675_100016484 Ga0070675_1000164843 192
261 3300005356 Ga0070674_100133432 Ga0070674_1001334323 192
262 3300005441 Ga0070700_100221277 Ga0070700_1002212772 192
263 3300005441 Ga0070700_100237502 Ga0070700_1002375022 192
264 3300005577 Ga0068857_100997198 Ga0068857_1009971982 192
265 3300005617 Ga0068859_100276537 Ga0068859_1002765372 192
266 3300005840 Ga0068870_10032725 Ga0068870_100327252 192
267 3300006844 Ga0075428_100055792 Ga0075428_1000557924 192
268 3300006847 Ga0075431_100416212 Ga0075431_1004162122 192
269 3300006931 Ga0097620_100276532 Ga0097620_1002765322 192
270 3300009094 Ga0111539_10680716 Ga0111539_106807161 192
271 3300009147 Ga0114129_10055563 Ga0114129_100555633 192
272 3300025908 Ga0207643_10040749 Ga0207643_100407495 192
273 3300025923 Ga0207681_10651520 Ga0207681_106515202 192
274 3300025942 Ga0207689_10115986 Ga0207689_101159863 192
275 3300025960 Ga0207651_10048261 Ga0207651_100482614 192
276 3300026075 Ga0207708_10363384 Ga0207708_103633842 192
277 3300026116 Ga0207674_10103066 Ga0207674_101030664 192
278 3300031731 Ga0307405_10507363 Ga0307405_105073632 192
279 3300031995 Ga0307409_100495068 Ga0307409_1004950682 192
280 3300049588 Ga0501072_0318166 Ga0501072_0318166_131_766 192
281 3300050507 nmdc:mga05p37_118241_c1 nmdc:mga05p37_118241_c1_1219_1854 192
282 3300050508 nmdc:mga09592_96930_c1 nmdc:mga09592_96930_c1_1324_1959 192
283 3300050510 nmdc:mga06r32_218995_c1 nmdc:mga06r32_218995_c1_679_1314 192
284 3300050511 nmdc:mga08y16_623561_c1 nmdc:mga08y16_623561_c1_370_1005 192
285 iso_pu_bacteria 2643221689 2644500242 192
286 3300005334 Ga0068869_100571926 Ga0068869_1005719262 193
287 3300005339 Ga0070660_100193898 Ga0070660_1001938982 193
288 3300005356 Ga0070674_100268137 Ga0070674_1002681372 193
289 3300005356 Ga0070674_100335700 Ga0070674_1003357002 193
290 3300005356 Ga0070674_100636675 Ga0070674_1006366751 193
291 3300005366 Ga0070659_100084190 Ga0070659_1000841903 193
292 3300005366 Ga0070659_100195169 Ga0070659_1001951693 193
293 3300005456 Ga0070678_100140553 Ga0070678_1001405533 193
294 3300005530 Ga0070679_100047309 Ga0070679_1000473092 193
295 3300005543 Ga0070672_100002375 Ga0070672_10000237510 193
296 3300005563 Ga0068855_100090578 Ga0068855_1000905783 193
297 3300005616 Ga0068852_100005912 Ga0068852_1000059124 193
298 3300005834 Ga0068851_10002659 Ga0068851_100026598 193
299 3300006237 Ga0097621_100111579 Ga0097621_1001115792 193
300 3300006358 Ga0068871_100032643 Ga0068871_1000326432 193
301 3300006852 Ga0075433_10037034 Ga0075433_100370344 193
302 3300009093 Ga0105240_10055818 Ga0105240_100558182 193
303 3300009098 Ga0105245_10769496 Ga0105245_107694962 193
304 3300009147 Ga0114129_10150761 Ga0114129_101507613 193
305 3300009148 Ga0105243_10302683 Ga0105243_103026832 193
306 3300009177 Ga0105248_10167705 Ga0105248_101677051 193
307 3300009551 Ga0105238_10025282 Ga0105238_100252829 193
308 3300013105 Ga0157369_10001974 Ga0157369_1000197425 193
309 3300013296 Ga0157374_10316527 Ga0157374_103165272 193
310 3300013307 Ga0157372_10083620 Ga0157372_100836203 193
311 3300021320 Ga0214544_1000123 Ga0214544_1000123102 193
312 3300021321 Ga0214542_1000141 Ga0214542_10001412 193
313 3300021327 Ga0214543_1000026 Ga0214543_1000026102 193
314 3300025294 Ga0209025_1010741 Ga0209025_10107415 193
315 3300025321 Ga0207656_10001998 Ga0207656_100019988 193
316 3300025909 Ga0207705_10170317 Ga0207705_101703172 193
317 3300025913 Ga0207695_10097446 Ga0207695_100974465 193
318 3300025924 Ga0207694_10018247 Ga0207694_100182472 193
319 3300025932 Ga0207690_10037918 Ga0207690_100379183 193
320 3300025933 Ga0207706_10350466 Ga0207706_103504661 193
321 3300025937 Ga0207669_10235922 Ga0207669_102359222 193
322 3300025937 Ga0207669_10261837 Ga0207669_102618372 193
323 3300025941 Ga0207711_10141548 Ga0207711_101415481 193
324 3300025942 Ga0207689_10550831 Ga0207689_105508312 193
325 3300025944 Ga0207661_10103164 Ga0207661_101031643 193
326 3300025949 Ga0207667_10040123 Ga0207667_100401235 193
327 3300026089 Ga0207648_10016107 Ga0207648_100161078 193
328 3300026121 Ga0207683_10110249 Ga0207683_101102494 193
329 3300026142 Ga0207698_10001424 Ga0207698_100014249 193
330 3300026142 Ga0207698_10006552 Ga0207698_100065525 193
331 3300044684 Ga0466966_0071829 Ga0466966_0071829_337_972 193
332 3300044842 Ga0466957_0050119 Ga0466957_0050119_1042_1677 193
333 3300045049 Ga0466959_0168705 Ga0466959_0168705_91_726 193
334 3300045836 Ga0466958_0121140 Ga0466958_0121140_68_703 193
335 3300048907 Ga0496104_0068232 Ga0496104_0068232_686_1321 193
336 3300048908 Ga0496105_0342863 Ga0496105_0342863_185_820 193
337 3300048914 Ga0496111_0118328 Ga0496111_0118328_499_1134 193
338 3300049572 Ga0501036_0773219 Ga0501036_0773219_17_658 193
339 3300050515 nmdc:mga0a205_67815_c1 nmdc:mga0a205_67815_c1_1195_1878 193
340 iso_pu_bacteria 2913295892 2913299926 193
341 3300002704 JGI25155J39150_1000008 JGI25155J39150_100000851 194
342 3300002705 JGI25156J39149_1000002 JGI25156J39149_1000002205 194
343 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010113 194
344 3300002741 JGI25157J39369_1000001 JGI25157J39369_1000001226 194
345 3300002774 JGI25150J39212_1001035 JGI25150J39212_10010357 194
346 3300002987 JGI25159J45721_1000202 JGI25159J45721_100020226 194
347 3300002987 JGI25159J45721_1001674 JGI25159J45721_10016746 194
348 3300003187 JGI25151J46595_10008085 JGI25151J46595_100080855 194
349 3300003354 JGI25160J50197_1000156 JGI25160J50197_100015634 194
350 3300003374 JGI25161J50226_1000043 JGI25161J50226_100004358 194
351 3300003771 Ga0055526_1016724 Ga0055526_10167242 194
352 3300003781 Ga0055536_1000085 Ga0055536_100008533 194
353 3300003784 Ga0055534_1001681 Ga0055534_10016813 194
354 3300003791 Ga0055530_10000254 Ga0055530_1000025430 194
355 3300003792 Ga0055540_1000079 Ga0055540_100007961 194
356 3300003794 Ga0055531_10000402 Ga0055531_100004026 194
357 3300004625 Ga0055543_1000160 Ga0055543_100016030 194
358 3300005262 Ga0065165_1004962 Ga0065165_10049622 194
359 3300005262 Ga0065165_1012629 Ga0065165_10126293 194
360 3300005468 Ga0070707_100280905 Ga0070707_1002809052 194
361 3300005616 Ga0068852_100255569 Ga0068852_1002555692 194
362 3300006042 Ga0075368_10126202 Ga0075368_101262022 194
363 3300006051 Ga0075364_10016511 Ga0075364_100165116 194
364 3300006058 Ga0075432_10001748 Ga0075432_100017484 194
365 3300006177 Ga0075362_10116351 Ga0075362_101163511 194
366 3300006178 Ga0075367_10201150 Ga0075367_102011502 194
367 3300006946 Ga0079104_1027955 Ga0079104_10279551 194
368 3300013307 Ga0157372_10958498 Ga0157372_109584981 194
369 3300017792 Ga0163161_10039009 Ga0163161_100390093 194
370 3300025206 Ga0209435_100001 Ga0209435_1000011093 194
371 3300025245 Ga0207425_1001152 Ga0207425_10011525 194
372 3300025245 Ga0207425_1004304 Ga0207425_10043041 194
373 3300025246 Ga0209646_1000001 Ga0209646_10000011462 194
374 3300025250 Ga0209026_1000001 Ga0209026_1000001114 194
375 3300025256 Ga0209759_1000001 Ga0209759_10000011093 194
376 3300025273 Ga0209673_1046228 Ga0209673_10462282 194
377 3300025284 Ga0209130_1000041 Ga0209130_1000041129 194
378 3300025284 Ga0209130_1027632 Ga0209130_10276322 194
379 3300025291 Ga0209675_1004891 Ga0209675_10048912 194
380 3300025291 Ga0209675_1005504 Ga0209675_10055044 194
381 3300025291 Ga0209675_1025735 Ga0209675_10257352 194
382 3300025292 Ga0209676_1000054 Ga0209676_1000054241 194
383 3300025292 Ga0209676_1003715 Ga0209676_10037159 194
384 3300025292 Ga0209676_1006880 Ga0209676_10068805 194
385 3300025294 Ga0209025_1004305 Ga0209025_10043056 194
386 3300025294 Ga0209025_1042327 Ga0209025_10423272 194
387 3300025295 Ga0209564_1000463 Ga0209564_100046336 194
388 3300025295 Ga0209564_1014305 Ga0209564_10143052 194
389 3300025297 Ga0209758_1011663 Ga0209758_10116635 194
390 3300025298 Ga0209050_1000066 Ga0209050_1000066241 194
391 3300025298 Ga0209050_1008728 Ga0209050_10087282 194
392 3300025298 Ga0209050_1023662 Ga0209050_10236622 194
393 3300025302 Ga0207426_1000061 Ga0207426_1000061112 194
394 3300025302 Ga0207426_1002771 Ga0207426_10027716 194
395 3300025303 Ga0209051_1000044 Ga0209051_1000044241 194
396 3300025304 Ga0209257_1000082 Ga0209257_1000082241 194
397 3300025304 Ga0209257_1024374 Ga0209257_10243741 194
398 3300025949 Ga0207667_10337313 Ga0207667_103373132 194
399 3300026142 Ga0207698_10148461 Ga0207698_101484613 194
400 3300031456 Ga0307513_10000021 Ga0307513_1000002140 194
401 3300031456 Ga0307513_10114173 Ga0307513_101141733 194
402 3300031548 Ga0307408_100001995 Ga0307408_10000199514 194
403 3300031730 Ga0307516_10013650 Ga0307516_100136506 194
404 3300031901 Ga0307406_10014288 Ga0307406_100142882 194
405 3300032002 Ga0307416_100483131 Ga0307416_1004831312 194
406 3300032004 Ga0307414_10196287 Ga0307414_101962871 194
407 3300037312 Ga0395899_0026534 Ga0395899_0026534_1692_2330 194
408 3300037471 Ga0395905_0008590 Ga0395905_0008590_158_796 194
409 3300041486 Ga0451807_1901993 Ga0451807_1901993_23_664 194
410 3300048929 Ga0496126_0593850 Ga0496126_0593850_34_687 194
411 3300050489 nmdc:mga03683_309757_c1 nmdc:mga03683_309757_c1_20_676 194
412 3300050490 nmdc:mga03n38_206020_c1 nmdc:mga03n38_206020_c1_256_897 194
413 3300050491 nmdc:mga00v17_17025_c1 nmdc:mga00v17_17025_c1_763_1401 194
414 3300050494 nmdc:mga06z11_155109_c1 nmdc:mga06z11_155109_c1_351_992 194
415 3300053088 Ga0500644_0001434 Ga0500644_0001434_1525_2232 194
416 3300053093 Ga0500651_0010282 Ga0500651_0010282_2992_3633 194
417 3300053117 Ga0500593_000233 Ga0500593_000233_6885_7577 194
418 3300053730 Ga0500645_000229 Ga0500645_000229_38448_39086 194
419 3300053730 Ga0500645_002065 Ga0500645_002065_1932_2570 194
420 3300053730 Ga0500645_122728 Ga0500645_122728_126_710 194
421 3300055283 Ga0500661_035652 Ga0500661_035652_117_773 194
422 iso_pu_bacteria 2511231002 2511244257 194
423 iso_pu_bacteria 2643221688 2644496330 194
424 iso_pu_bacteria 2738543013 2739248668 194
425 iso_pu_bacteria 2919704043 2919705428 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

28

103

0.97

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

37

104

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

32

109

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

163

226

0.85

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

163

228

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9253 3 193
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.9238 2 194
3niv-assembly1.cif.gz_A the crystal structure of glutathione s-transferase from legionella pneumophila 0.9153 3 188
3niv-assembly2.cif.gz_D the crystal structure of glutathione s-transferase from legionella pneumophila 0.9135 34 188
1fw1-assembly1.cif.gz_A-2 glutathione transferase zeta/maleylacetoacetate isomerase 0.9117 2 194
ID Description Score Start End Superfamily
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9305 4 58 3.40.30.10
2v6kB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9304 2 60 3.40.30.10
4mpgB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9251 2 61 3.40.30.10
af_Q9FHE1_1_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9238 2 59 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9226 1 59 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A286B413-F1-model_v4 Maleylacetoacetate isomerase 0.9522 3 194 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A1S8FS86-F1-model_v4 deleted 0.9518 2 194
AF-J2KZ79-F1-model_v4 Maleylacetoacetate isomerase 0.9512 1 194 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A7Y0BV17-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9511 2 194 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A109D4N4-F1-model_v4 deleted 0.9506 3 194

Feature Viewer

pLDDT pTM Quality
89.68 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map