F441069

General Info

Members Datasets Scaffolds Average Seq Length
425 252 425 147

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0251169|Ga0501074_0251169_732_1187
Length 151
Sequence MTDLSRDQQMLAIALEEARRGLSEGGIPVGAALFDAEGRLLGRGRNRRVQEADPSIHGETDAFRKAGRQKSYRDKTMVTTLAPCWYCSGLVRQFGIGRLLVGDSVNFAGGVAWLRESGVLVVDLASEECIAMMREFIAARPELWNEDIGVD

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
155 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 2.35
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10047416 3300003320 Bacteria 22721
2 rootH2_10054790 3300003320 Bacteria 15899
3 rootH1_10235554 3300003323 Bacteria 2985
4 Ga0055530_10015743 3300003791 Bacteria 2452
5 Ga0058862_10286407 3300004803 Bacteria 1159
6 Ga0065715_10340480 3300005293 Bacteria 968
7 Ga0070658_10243713 3300005327 Bacteria 1524
8 Ga0070690_100029313 3300005330 Bacteria 3412
9 Ga0068869_100570379 3300005334 Bacteria 953
10 Ga0068869_100866816 3300005334 Unclassified 780
11 Ga0070666_10001203 3300005335 Bacteria 15634
12 Ga0070666_10629712 3300005335 Bacteria 784
13 Ga0070689_100008334 3300005340 Bacteria 7297
14 Ga0070675_100000004 3300005354 Bacteria 361974
15 Ga0070675_100048480 3300005354 Bacteria 3483
16 Ga0070688_100041686 3300005365 Bacteria 2819
17 Ga0070688_100986044 3300005365 Bacteria 669
18 Ga0070688_101185417 3300005365 Bacteria 613
19 Ga0070667_100046027 3300005367 Bacteria 3669
20 Ga0070667_101804918 3300005367 Bacteria 575
21 Ga0070713_100056449 3300005436 Bacteria 3267
22 Ga0070663_100099195 3300005455 Bacteria 2171
23 Ga0070663_101203320 3300005455 Bacteria 666
24 Ga0070662_100600502 3300005457 Bacteria 926
25 Ga0070681_10377435 3300005458 Bacteria 1328
26 Ga0070685_10001524 3300005466 Bacteria 12224
27 Ga0070685_10049981 3300005466 Bacteria 2414
28 Ga0070685_10208399 3300005466 Bacteria 1274
29 Ga0070706_100007788 3300005467 Bacteria 10009
30 Ga0070707_100015842 3300005468 Bacteria 7078
31 Ga0070698_100756800 3300005471 Unclassified 915
32 Ga0070699_100118456 3300005518 Bacteria 2327
33 Ga0070699_100148812 3300005518 Bacteria 2070
34 Ga0070699_100795980 3300005518 Bacteria 865
35 Ga0070679_100376531 3300005530 Bacteria 1366
36 Ga0068853_100113582 3300005539 Bacteria 2408
37 Ga0068853_100238902 3300005539 Bacteria 1664
38 Ga0068853_100382561 3300005539 Bacteria 1314
39 Ga0070672_100043895 3300005543 Bacteria 3451
40 Ga0070686_100055744 3300005544 Bacteria 2533
41 Ga0070693_101019789 3300005547 Bacteria 627
42 Ga0070665_100000275 3300005548 Bacteria 84583
43 Ga0070665_100024577 3300005548 Bacteria 6070
44 Ga0070665_100205122 3300005548 Bacteria 1972
45 Ga0070704_100857540 3300005549 Bacteria 815
46 Ga0068855_100024603 3300005563 Bacteria 7204
47 Ga0068855_100476336 3300005563 Bacteria 1359
48 Ga0068855_100635870 3300005563 Bacteria 1147
49 Ga0070664_100214481 3300005564 Bacteria 1721
50 Ga0068857_100590933 3300005577 Bacteria 1049
51 Ga0068857_100743502 3300005577 Bacteria 934
52 Ga0068854_100002782 3300005578 Bacteria 10864
53 Ga0068856_102168847 3300005614 Bacteria 565
54 Ga0068852_100092404 3300005616 Bacteria 2710
55 Ga0068859_100440311 3300005617 Bacteria 1399
56 Ga0068859_101992619 3300005617 Bacteria 641
57 Ga0068864_100785015 3300005618 Bacteria 935
58 Ga0068866_10968919 3300005718 Bacteria 602
59 Ga0068851_10000257 3300005834 Bacteria 25204
60 Ga0068870_10244637 3300005840 Unclassified 1109
61 Ga0068863_100980198 3300005841 Bacteria 848
62 Ga0068858_100001454 3300005842 Bacteria 24355
63 Ga0068860_100838249 3300005843 Unclassified 934
64 Ga0068860_101715076 3300005843 Bacteria 650
65 Ga0068862_100364211 3300005844 Bacteria 1344
66 Ga0068862_100488631 3300005844 Bacteria 1167
67 Ga0081455_10073157 3300005937 Bacteria 2834
68 Ga0081540_1058413 3300005983 Unclassified 1858
69 Ga0097621_100216302 3300006237 Bacteria 1668
70 Ga0068871_100477305 3300006358 Bacteria 1121
71 Ga0068871_100760441 3300006358 Bacteria 891
72 Ga0075428_100405072 3300006844 Bacteria 1462
73 Ga0075431_100013004 3300006847 Bacteria 8405
74 Ga0075431_101035693 3300006847 Bacteria 787
75 Ga0075433_10032181 3300006852 Bacteria 4491
76 Ga0075429_100160476 3300006880 Bacteria 1969
77 Ga0075429_100282694 3300006880 Bacteria 1453
78 Ga0075429_101846339 3300006880 Unclassified 524
79 Ga0068865_100232835 3300006881 Bacteria 1446
80 Ga0097620_100440307 3300006931 Bacteria 1399
81 Ga0097620_101992207 3300006931 Bacteria 641
82 Ga0075435_100389361 3300007076 Bacteria 1198
83 Ga0105240_10020823 3300009093 Bacteria 8735
84 Ga0105240_10093565 3300009093 Bacteria 3668
85 Ga0105240_10253071 3300009093 Bacteria 2036
86 Ga0105240_10401745 3300009093 Unclassified 1543
87 Ga0111539_10237562 3300009094 Bacteria 2121
88 Ga0111539_10378802 3300009094 Bacteria 1647
89 Ga0111539_11208819 3300009094 Bacteria 878
90 Ga0114129_10042708 3300009147 Bacteria 6381
91 Ga0105243_10014409 3300009148 Bacteria 5985
92 Ga0105243_10231183 3300009148 Bacteria 1641
93 Ga0105241_10024890 3300009174 Bacteria 4447
94 Ga0105241_10072704 3300009174 Bacteria 2673
95 Ga0105241_10133040 3300009174 Bacteria 2016
96 Ga0105241_10397423 3300009174 Bacteria 1208
97 Ga0105248_10244769 3300009177 Bacteria 2019
98 Ga0105237_10112230 3300009545 Bacteria 2718
99 Ga0105237_10151092 3300009545 Bacteria 2319
100 Ga0105237_11115022 3300009545 Unclassified 796
101 Ga0105238_10000666 3300009551 Bacteria 36084
102 Ga0105238_10073392 3300009551 Bacteria 3417
103 Ga0105249_10015723 3300009553 Bacteria 6701
104 Ga0105249_10113380 3300009553 Bacteria 2565
105 Ga0105249_13065265 3300009553 Bacteria 537
106 Ga0105239_10222021 3300010375 Bacteria 2119
107 Ga0105239_10439641 3300010375 Bacteria 1479
108 Ga0105239_10599390 3300010375 Bacteria 1257
109 Ga0157373_10010881 3300013100 Bacteria 6697
110 Ga0157373_11396441 3300013100 Eukaryota 532
111 Ga0157370_10147654 3300013104 Bacteria 2189
112 Ga0157370_10505830 3300013104 Bacteria 1109
113 Ga0157369_10207122 3300013105 Bacteria 2057
114 Ga0157374_10210021 3300013296 Bacteria 1908
115 Ga0157374_10554953 3300013296 Bacteria 1157
116 Ga0163162_10000007 3300013306 Bacteria 368084
117 Ga0163162_10445150 3300013306 Bacteria 1427
118 Ga0157372_10317080 3300013307 Bacteria 1815
119 Ga0157372_10369438 3300013307 Bacteria 1671
120 Ga0157372_10705295 3300013307 Bacteria 1174
121 Ga0157380_10088554 3300014326 Bacteria 2548
122 Ga0157380_11538856 3300014326 Bacteria 719
123 Ga0157379_10638509 3300014968 Bacteria 996
124 Ga0157376_10158950 3300014969 Bacteria 2046
125 Ga0157376_10768307 3300014969 Bacteria 974
126 Ga0206351_10791454 3300020077 Bacteria 538
127 Ga0213876_10101241 3300021384 Bacteria 1527
128 Ga0209233_1005233 3300025261 Bacteria 4329
129 Ga0209050_1001077 3300025298 Bacteria 33401
130 Ga0209050_1056560 3300025298 Bacteria 954
131 Ga0209257_1059842 3300025304 Bacteria 1038
132 Ga0207697_10090805 3300025315 Bacteria 1294
133 Ga0207656_10011847 3300025321 Bacteria 3302
134 Ga0207655_1004802 3300025728 Bacteria 9412
135 Ga0207655_1218878 3300025728 Bacteria 556
136 Ga0207692_10336808 3300025898 Bacteria 927
137 Ga0207680_10003476 3300025903 Bacteria 7417
138 Ga0207647_10003977 3300025904 Bacteria 11031
139 Ga0207643_10240910 3300025908 Bacteria 1112
140 Ga0207705_10534115 3300025909 Bacteria 912
141 Ga0207684_10045983 3300025910 Bacteria 3703
142 Ga0207654_10001500 3300025911 Bacteria 12314
143 Ga0207654_10438036 3300025911 Bacteria 914
144 Ga0207695_10000014 3300025913 Bacteria 812599
145 Ga0207695_10012780 3300025913 Bacteria 10054
146 Ga0207695_10014393 3300025913 Bacteria 9379
147 Ga0207695_10096867 3300025913 Bacteria 2951
148 Ga0207695_10408464 3300025913 Bacteria 1242
149 Ga0207671_10705417 3300025914 Bacteria 802
150 Ga0207693_10093543 3300025915 Bacteria 2356
151 Ga0207662_10177496 3300025918 Bacteria 1369
152 Ga0207649_10059650 3300025920 Bacteria 2395
153 Ga0207652_10469033 3300025921 Bacteria 1134
154 Ga0207646_10015760 3300025922 Bacteria 7119
155 Ga0207694_10000409 3300025924 Bacteria 39948
156 Ga0207694_10001937 3300025924 Bacteria 17128
157 Ga0207700_10113203 3300025928 Bacteria 2187
158 Ga0207664_10008885 3300025929 Bacteria 7033
159 Ga0207690_11005161 3300025932 Bacteria 694
160 Ga0207706_10002455 3300025933 Bacteria 18098
161 Ga0207706_10810044 3300025933 Bacteria 795
162 Ga0207686_11028488 3300025934 Bacteria 669
163 Ga0207709_10021704 3300025935 Bacteria 3636
164 Ga0207704_10250374 3300025938 Bacteria 1329
165 Ga0207691_10361502 3300025940 Bacteria 1241
166 Ga0207689_10232494 3300025942 Bacteria 1523
167 Ga0207689_10397047 3300025942 Bacteria 1149
168 Ga0207661_10126947 3300025944 Unclassified 2179
169 Ga0207661_11871203 3300025944 Bacteria 546
170 Ga0207667_10013900 3300025949 Bacteria 9196
171 Ga0207667_10071238 3300025949 Bacteria 3615
172 Ga0207667_10368117 3300025949 Bacteria 1465
173 Ga0207712_10000189 3300025961 Bacteria 63193
174 Ga0207712_11872687 3300025961 Bacteria 537
175 Ga0207640_10000733 3300025981 Bacteria 18893
176 Ga0207640_10826576 3300025981 Bacteria 804
177 Ga0207658_10021869 3300025986 Bacteria 4446
178 Ga0207658_10058646 3300025986 Bacteria 2865
179 Ga0207677_10781944 3300026023 Bacteria 853
180 Ga0207703_10000497 3300026035 Bacteria 40758
181 Ga0207639_10000226 3300026041 Bacteria 42228
182 Ga0207639_10000535 3300026041 Bacteria 26112
183 Ga0207639_10217145 3300026041 Unclassified 1649
184 Ga0207639_10407532 3300026041 Bacteria 1226
185 Ga0207639_10761997 3300026041 Bacteria 900
186 Ga0207678_10027241 3300026067 Bacteria 4984
187 Ga0207678_10089098 3300026067 Bacteria 2637
188 Ga0207678_10520780 3300026067 Bacteria 1038
189 Ga0207708_10092816 3300026075 Bacteria 2330
190 Ga0207708_10208879 3300026075 Bacteria 1560
191 Ga0207702_10464924 3300026078 Bacteria 1229
192 Ga0207641_10490575 3300026088 Bacteria 1192
193 Ga0207641_11166495 3300026088 Bacteria 769
194 Ga0207648_10101412 3300026089 Bacteria 2522
195 Ga0207648_10358169 3300026089 Bacteria 1316
196 Ga0207674_10150728 3300026116 Bacteria 2283
197 Ga0207674_10657291 3300026116 Bacteria 1012
198 Ga0207674_11070935 3300026116 Bacteria 775
199 Ga0207698_10073083 3300026142 Bacteria 2729
200 Ga0207698_10130653 3300026142 Bacteria 2145
201 Ga0268266_10000013 3300028379 Bacteria 649715
202 Ga0268266_10041390 3300028379 Bacteria 3931
203 Ga0268265_10598897 3300028380 Bacteria 1053
204 Ga0268264_10504621 3300028381 Unclassified 1180
205 Ga0265319_1017934 3300028563 Bacteria 2682
206 Ga0265334_10015722 3300028573 Bacteria 3140
207 Ga0265334_10020291 3300028573 Bacteria 2723
208 Ga0265334_10240199 3300028573 Bacteria 625
209 Ga0265322_10025840 3300028654 Bacteria 1678
210 Ga0265322_10034431 3300028654 Unclassified 1443
211 Ga0265336_10000800 3300028666 Bacteria 16553
212 Ga0265336_10016343 3300028666 Bacteria 2427
213 Ga0265336_10042359 3300028666 Bacteria 1390
214 Ga0265338_10000025 3300028800 Bacteria 296972
215 Ga0265338_10003996 3300028800 Bacteria 20274
216 Ga0265338_10123559 3300028800 Bacteria 2058
217 Ga0265338_10124855 3300028800 Bacteria 2044
218 Ga0265338_10134413 3300028800 Bacteria 1947
219 Ga0265324_10001331 3300029957 Bacteria 14437
220 Ga0265340_10010089 3300031247 Bacteria 5059
221 Ga0265339_10023694 3300031249 Bacteria 3547
222 Ga0265339_10138249 3300031249 Bacteria 1241
223 Ga0265339_10163886 3300031249 Bacteria 1117
224 Ga0265316_10023234 3300031344 Bacteria 5212
225 Ga0265316_10023665 3300031344 Bacteria 5157
226 Ga0265316_10090863 3300031344 Bacteria 2330
227 Ga0265314_10021939 3300031711 Bacteria 4898
228 Ga0265314_10365150 3300031711 Bacteria 790
229 Ga0307405_10807553 3300031731 Bacteria 786
230 Ga0307410_10404024 3300031852 Bacteria 1104
231 Ga0307409_100216945 3300031995 Bacteria 1724
232 Ga0307416_100015643 3300032002 Bacteria 5246
233 Ga0307416_100586142 3300032002 Bacteria 1193
234 Ga0373926_0006254 3300035083 Bacteria 3951
235 Ga0373926_0108262 3300035083 Bacteria 1043
236 Ga0373944_0108810 3300035089 Unclassified 944
237 Ga0373945_0146665 3300035116 Bacteria 954
238 Ga0373953_0055573 3300035117 Bacteria 1608
239 Ga0373954_0043715 3300035118 Bacteria 2089
240 Ga0373956_0012494 3300035119 Bacteria 3522
241 Ga0373956_0261825 3300035119 Bacteria 822
242 Ga0373943_0018108 3300035170 Bacteria 3232
243 Ga0373946_0011300 3300035171 Bacteria 3328
244 Ga0373955_0003036 3300035172 Bacteria 7351
245 Ga0373924_0023251 3300035410 Bacteria 2429
246 Ga0373927_0004850 3300035695 Bacteria 9355
247 Ga0373947_0242284 3300035725 Bacteria 1190
248 Ga0373937_0172554 3300036401 Bacteria 2029
249 Ga0373937_0654556 3300036401 Bacteria 996
250 Ga0373937_0663264 3300036401 Bacteria 989
251 Ga0373925_0048295 3300037068 Bacteria 3171
252 Ga0373925_0124004 3300037068 Bacteria 2008
253 Ga0436365_0572805 3300039437 Bacteria 1968
254 Ga0439453_0021269 3300041408 Bacteria 1169
255 Ga0451793_1720382 3300041452 Bacteria 997
256 Ga0451807_1211958 3300041486 Bacteria 2716
257 Ga0451833_0421601 3300041491 Bacteria 1028
258 Ga0451853_1767403 3300041512 Bacteria 666
259 Ga0451853_3975526 3300041512 Bacteria 845
260 Ga0450923_029910 3300042125 Unclassified 1106
261 Ga0439444_0016036 3300042437 Bacteria 1271
262 Ga0439464_0231919 3300042439 Bacteria 594
263 Ga0451577_0008776 3300042876 Bacteria 9798
264 Ga0451577_0154152 3300042876 Bacteria 2067
265 Ga0453684_0000054 3300044712 Bacteria 543775
266 Ga0453684_0014655 3300044712 Bacteria 12508
267 Ga0451576_0197929 3300045051 Unclassified 2099
268 Ga0495592_0009921 3300046454 Bacteria 7171
269 Ga0495592_0071874 3300046454 Bacteria 2518
270 Ga0495629_0295983 3300046459 Bacteria 1109
271 Ga0495651_0089078 3300046462 Bacteria 2318
272 Ga0495580_0025366 3300046472 Bacteria 4333
273 Ga0495580_0506998 3300046472 Bacteria 805
274 Ga0495582_0174909 3300046473 Bacteria 1223
275 Ga0495639_0437347 3300046475 Bacteria 663
276 Ga0495662_0067093 3300046476 Bacteria 1736
277 Ga0495664_0212829 3300046477 Bacteria 1171
278 Ga0495608_0003346 3300046511 Bacteria 11460
279 Ga0495618_0334336 3300046514 Bacteria 936
280 Ga0495620_0026501 3300046515 Bacteria 2725
281 Ga0495628_0082636 3300046516 Bacteria 2495
282 Ga0495628_0180829 3300046516 Bacteria 1595
283 Ga0495630_0000374 3300046517 Bacteria 35505
284 Ga0495630_0001775 3300046517 Bacteria 15092
285 Ga0495630_0139641 3300046517 Bacteria 1842
286 Ga0495663_0260885 3300046525 Bacteria 617
287 Ga0495666_0090570 3300046526 Bacteria 1443
288 Ga0495640_0446110 3300046533 Bacteria 791
289 Ga0495586_0000496 3300046535 Bacteria 23175
290 Ga0495586_0461691 3300046535 Bacteria 732
291 Ga0495587_0007021 3300046536 Bacteria 7313
292 Ga0495587_0047519 3300046536 Bacteria 2544
293 Ga0495587_0675411 3300046536 Bacteria 567
294 Ga0495645_0040989 3300046543 Bacteria 3376
295 Ga0495645_0304313 3300046543 Bacteria 1040
296 Ga0495667_0086173 3300046559 Bacteria 2038
297 Ga0495667_0422078 3300046559 Bacteria 839
298 Ga0495667_0972109 3300046559 Bacteria 519
299 Ga0495599_0275999 3300046678 Bacteria 1019
300 Ga0495647_0062088 3300046681 Bacteria 1477
301 Ga0495658_0006795 3300046683 Bacteria 5631
302 Ga0495658_0251817 3300046683 Bacteria 1111
303 Ga0495669_0001154 3300046684 Bacteria 10973
304 Ga0495669_0270987 3300046684 Unclassified 816
305 Ga0495613_0003345 3300046689 Bacteria 11985
306 Ga0495613_0367355 3300046689 Bacteria 986
307 Ga0495624_0060391 3300046690 Bacteria 2377
308 Ga0495624_0164110 3300046690 Bacteria 1356
309 Ga0495600_0049569 3300046809 Bacteria 2740
310 Ga0495600_0171513 3300046809 Bacteria 1400
311 Ga0495600_0432322 3300046809 Bacteria 816
312 Ga0495581_0013628 3300047315 Bacteria 4716
313 Ga0495581_0056317 3300047315 Bacteria 2269
314 Ga0495674_0007288 3300047319 Bacteria 10578
315 Ga0495676_0019515 3300047321 Bacteria 5961
316 Ga0495675_0029305 3300047444 Bacteria 3510
317 Ga0495684_0011054 3300047471 Bacteria 6979
318 Ga0495684_0180932 3300047471 Bacteria 1563
319 Ga0495684_0707966 3300047471 Bacteria 667
320 Ga0496100_0408247 3300048903 Unclassified 1036
321 Ga0496104_0003947 3300048907 Bacteria 12839
322 Ga0496105_0038630 3300048908 Bacteria 3933
323 Ga0496107_0428047 3300048910 Bacteria 984
324 Ga0496109_0115723 3300048912 Bacteria 2495
325 Ga0496114_0534539 3300048917 Bacteria 1036
326 Ga0496114_1263394 3300048917 Unclassified 625
327 Ga0496115_0015631 3300048918 Bacteria 5762
328 Ga0496117_0067366 3300048920 Bacteria 2423
329 Ga0496124_0126612 3300048927 Bacteria 2034
330 Ga0501031_0008845 3300049568 Bacteria 6547
331 Ga0501031_0121769 3300049568 Unclassified 1704
332 Ga0501032_0009421 3300049569 Bacteria 7077
333 Ga0501032_0017267 3300049569 Bacteria 5066
334 Ga0501032_0300831 3300049569 Unclassified 1037
335 Ga0501033_0060374 3300049570 Bacteria 2798
336 Ga0501034_0214661 3300049571 Bacteria 1878
337 Ga0501034_0549255 3300049571 Unclassified 1065
338 Ga0501036_0002145 3300049572 Bacteria 15403
339 Ga0501036_0068231 3300049572 Bacteria 3009
340 Ga0501036_0165386 3300049572 Bacteria 1865
341 Ga0501036_1455976 3300049572 Unclassified 555
342 Ga0501037_0001786 3300049573 Bacteria 15607
343 Ga0501037_0064337 3300049573 Bacteria 2673
344 Ga0501037_0305006 3300049573 Bacteria 1105
345 Ga0501038_0127988 3300049574 Bacteria 2088
346 Ga0501038_0441786 3300049574 Bacteria 1001
347 Ga0501038_1300921 3300049574 Bacteria 525
348 Ga0501039_0005797 3300049575 Bacteria 9354
349 Ga0501039_0239641 3300049575 Bacteria 1426
350 Ga0501040_0016974 3300049576 Unclassified 4827
351 Ga0501041_0098808 3300049577 Unclassified 1805
352 Ga0501041_0244016 3300049577 Bacteria 1129
353 Ga0501042_0004345 3300049578 Bacteria 9038
354 Ga0501042_0381960 3300049578 Bacteria 1020
355 Ga0501043_0014311 3300049579 Bacteria 6208
356 Ga0501043_0345440 3300049579 Unclassified 1131
357 Ga0501046_0001067 3300049580 Bacteria 26860
358 Ga0501048_0152979 3300049582 Bacteria 1632
359 Ga0501048_0167158 3300049582 Bacteria 1558
360 Ga0501048_0587593 3300049582 Unclassified 799
361 Ga0501048_0640270 3300049582 Bacteria 763
362 Ga0501068_0077480 3300049584 Unclassified 2036
363 Ga0501068_0459827 3300049584 Bacteria 824
364 Ga0501069_0021551 3300049585 Bacteria 3499
365 Ga0501071_0027857 3300049587 Bacteria 3978
366 Ga0501071_0054582 3300049587 Bacteria 2883
367 Ga0501071_0100430 3300049587 Unclassified 2132
368 Ga0501072_0039237 3300049588 Unclassified 3718
369 Ga0501072_0063256 3300049588 Bacteria 2919
370 Ga0501072_0261081 3300049588 Bacteria 1378
371 Ga0501073_0048654 3300049589 Bacteria 2976
372 Ga0501074_0002108 3300049590 Bacteria 13735
373 Ga0501074_0048567 3300049590 Bacteria 3066
374 Ga0501074_0251169 3300049590 Bacteria 1258
375 Ga0501075_0025510 3300049591 Unclassified 4342
376 Ga0501075_0033128 3300049591 Bacteria 3842
377 Ga0501075_0154502 3300049591 Bacteria 1750
378 Ga0501076_0003528 3300049592 Bacteria 10987
379 Ga0501076_0072207 3300049592 Bacteria 2762
380 Ga0501076_0084555 3300049592 Bacteria 2549
381 Ga0501077_0017064 3300049593 Bacteria 4579
382 Ga0501077_0041611 3300049593 Bacteria 2924
383 Ga0501077_0458175 3300049593 Bacteria 817
384 Ga0501249_175331 3300049679 Bacteria 552
385 Ga0501079_0004607 3300049741 Bacteria 10216
386 Ga0501080_0009318 3300049742 Bacteria 8951
387 Ga0501080_0256453 3300049742 Bacteria 1594
388 Ga0501081_0056372 3300049743 Unclassified 2716
389 Ga0501081_0954954 3300049743 Unclassified 647
390 Ga0501083_0501840 3300049744 Unclassified 790
391 Ga0501035_0335740 3300049822 Unclassified 1267
392 Ga0501044_0059893 3300049823 Bacteria 3900
393 Ga0501044_0535833 3300049823 Unclassified 1069
394 Ga0501045_0002175 3300049824 Bacteria 13287
395 Ga0501045_0135457 3300049824 Bacteria 1831
396 Ga0501045_0833041 3300049824 Bacteria 679
397 nmdc:mga05p37_22945_c1 3300050507 Bacteria 7569
398 nmdc:mga09592_1278660_c1 3300050508 Bacteria 604
399 nmdc:mga09592_271741_c1 3300050508 Bacteria 1470
400 nmdc:mga09592_313269_c1 3300050508 Bacteria 1360
401 nmdc:mga09592_33670_c1 3300050508 Bacteria 4279
402 nmdc:mga0qj67_149338_c1 3300050509 Bacteria 1896
403 nmdc:mga06r32_1053346_c1 3300050510 Bacteria 764
404 nmdc:mga06r32_3978_c1 3300050510 Bacteria 13244
405 nmdc:mga08y16_262070_c1 3300050511 Bacteria 1785
406 nmdc:mga08y16_411225_c1 3300050511 Bacteria 1383
407 nmdc:mga0n895_12540_c1 3300050512 Bacteria 7605
408 nmdc:mga0n895_786982_c1 3300050512 Bacteria 942
409 nmdc:mga0rr50_375918_c1 3300050513 Bacteria 1197
410 nmdc:mga0rr50_79780_c1 3300050513 Bacteria 2522
411 nmdc:mga08x19_146236_c1 3300050514 Bacteria 1599
412 nmdc:mga0a205_18970_c1 3300050515 Bacteria 6480
413 Ga0495601_0035296 3300053077 Bacteria 3120
414 Ga0495601_0182179 3300053077 Bacteria 1373
415 Ga0495595_0426869 3300053084 Unclassified 673
416 Ga0495619_0002562 3300053085 Bacteria 11892
417 Ga0495619_0151615 3300053085 Bacteria 1599
418 Ga0500616_0004822 3300053153 Bacteria 9430
419 Ga0501084_0001233 3300054114 Bacteria 20150
420 Ga0501084_0516366 3300054114 Bacteria 1010
421 Ga0501084_0732885 3300054114 Bacteria 833
422 Ga0501082_0009973 3300060353 Bacteria 8189
423 Ga0530510_0010635 3300061734 Bacteria 6453
424 Ga0530510_0169815 3300061734 Unclassified 1615
425 Ga0530510_0200283 3300061734 Bacteria 1483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_1300921 Ga0501038_1300921_73_501 140
2 3300049591 Ga0501075_0154502 Ga0501075_0154502_517_945 140
3 3300049593 Ga0501077_0458175 Ga0501077_0458175_176_604 140
4 3300005983 Ga0081540_1058413 Ga0081540_10584132 143
5 3300049590 Ga0501074_0251169 Ga0501074_0251169_732_1187 143
6 3300049592 Ga0501076_0084555 Ga0501076_0084555_788_1243 143
7 3300061734 Ga0530510_0200283 Ga0530510_0200283_466_921 143
8 3300003320 rootH2_10047416 rootH2_100474168 145
9 3300003320 rootH2_10054790 rootH2_100547908 145
10 3300003323 rootH1_10235554 rootH1_102355543 145
11 3300003791 Ga0055530_10015743 Ga0055530_100157431 145
12 3300004803 Ga0058862_10286407 Ga0058862_102864071 145
13 3300005293 Ga0065715_10340480 Ga0065715_103404801 145
14 3300005327 Ga0070658_10243713 Ga0070658_102437132 145
15 3300005330 Ga0070690_100029313 Ga0070690_1000293132 145
16 3300005334 Ga0068869_100570379 Ga0068869_1005703791 145
17 3300005334 Ga0068869_100866816 Ga0068869_1008668161 145
18 3300005335 Ga0070666_10001203 Ga0070666_100012033 145
19 3300005335 Ga0070666_10629712 Ga0070666_106297122 145
20 3300005340 Ga0070689_100008334 Ga0070689_1000083342 145
21 3300005354 Ga0070675_100000004 Ga0070675_100000004301 145
22 3300005354 Ga0070675_100048480 Ga0070675_1000484801 145
23 3300005365 Ga0070688_100041686 Ga0070688_1000416863 145
24 3300005365 Ga0070688_100986044 Ga0070688_1009860442 145
25 3300005365 Ga0070688_101185417 Ga0070688_1011854171 145
26 3300005367 Ga0070667_100046027 Ga0070667_1000460273 145
27 3300005367 Ga0070667_101804918 Ga0070667_1018049181 145
28 3300005436 Ga0070713_100056449 Ga0070713_1000564494 145
29 3300005455 Ga0070663_100099195 Ga0070663_1000991954 145
30 3300005455 Ga0070663_101203320 Ga0070663_1012033201 145
31 3300005457 Ga0070662_100600502 Ga0070662_1006005022 145
32 3300005458 Ga0070681_10377435 Ga0070681_103774351 145
33 3300005466 Ga0070685_10001524 Ga0070685_100015246 145
34 3300005466 Ga0070685_10049981 Ga0070685_100499812 145
35 3300005466 Ga0070685_10208399 Ga0070685_102083992 145
36 3300005467 Ga0070706_100007788 Ga0070706_1000077889 145
37 3300005468 Ga0070707_100015842 Ga0070707_1000158422 145
38 3300005471 Ga0070698_100756800 Ga0070698_1007568001 145
39 3300005518 Ga0070699_100118456 Ga0070699_1001184562 145
40 3300005518 Ga0070699_100148812 Ga0070699_1001488122 145
41 3300005518 Ga0070699_100795980 Ga0070699_1007959802 145
42 3300005530 Ga0070679_100376531 Ga0070679_1003765313 145
43 3300005539 Ga0068853_100113582 Ga0068853_1001135823 145
44 3300005539 Ga0068853_100238902 Ga0068853_1002389021 145
45 3300005539 Ga0068853_100382561 Ga0068853_1003825612 145
46 3300005543 Ga0070672_100043895 Ga0070672_1000438953 145
47 3300005544 Ga0070686_100055744 Ga0070686_1000557443 145
48 3300005547 Ga0070693_101019789 Ga0070693_1010197891 145
49 3300005548 Ga0070665_100000275 Ga0070665_1000002753 145
50 3300005548 Ga0070665_100024577 Ga0070665_1000245775 145
51 3300005548 Ga0070665_100205122 Ga0070665_1002051222 145
52 3300005549 Ga0070704_100857540 Ga0070704_1008575401 145
53 3300005563 Ga0068855_100024603 Ga0068855_1000246034 145
54 3300005563 Ga0068855_100476336 Ga0068855_1004763361 145
55 3300005563 Ga0068855_100635870 Ga0068855_1006358702 145
56 3300005564 Ga0070664_100214481 Ga0070664_1002144812 145
57 3300005577 Ga0068857_100590933 Ga0068857_1005909332 145
58 3300005577 Ga0068857_100743502 Ga0068857_1007435021 145
59 3300005578 Ga0068854_100002782 Ga0068854_1000027824 145
60 3300005614 Ga0068856_102168847 Ga0068856_1021688471 145
61 3300005616 Ga0068852_100092404 Ga0068852_1000924043 145
62 3300005617 Ga0068859_100440311 Ga0068859_1004403112 145
63 3300005617 Ga0068859_101992619 Ga0068859_1019926192 145
64 3300005618 Ga0068864_100785015 Ga0068864_1007850151 145
65 3300005718 Ga0068866_10968919 Ga0068866_109689191 145
66 3300005834 Ga0068851_10000257 Ga0068851_1000025718 145
67 3300005840 Ga0068870_10244637 Ga0068870_102446371 145
68 3300005841 Ga0068863_100980198 Ga0068863_1009801982 145
69 3300005842 Ga0068858_100001454 Ga0068858_10000145418 145
70 3300005843 Ga0068860_100838249 Ga0068860_1008382492 145
71 3300005843 Ga0068860_101715076 Ga0068860_1017150761 145
72 3300005844 Ga0068862_100364211 Ga0068862_1003642112 145
73 3300005844 Ga0068862_100488631 Ga0068862_1004886312 145
74 3300005937 Ga0081455_10073157 Ga0081455_100731573 145
75 3300006237 Ga0097621_100216302 Ga0097621_1002163022 145
76 3300006358 Ga0068871_100477305 Ga0068871_1004773052 145
77 3300006358 Ga0068871_100760441 Ga0068871_1007604412 145
78 3300006844 Ga0075428_100405072 Ga0075428_1004050722 145
79 3300006847 Ga0075431_100013004 Ga0075431_1000130044 145
80 3300006847 Ga0075431_101035693 Ga0075431_1010356932 145
81 3300006852 Ga0075433_10032181 Ga0075433_100321812 145
82 3300006880 Ga0075429_100160476 Ga0075429_1001604762 145
83 3300006880 Ga0075429_100282694 Ga0075429_1002826941 145
84 3300006880 Ga0075429_101846339 Ga0075429_1018463391 145
85 3300006881 Ga0068865_100232835 Ga0068865_1002328352 145
86 3300006931 Ga0097620_100440307 Ga0097620_1004403072 145
87 3300006931 Ga0097620_101992207 Ga0097620_1019922071 145
88 3300007076 Ga0075435_100389361 Ga0075435_1003893612 145
89 3300009093 Ga0105240_10020823 Ga0105240_100208234 145
90 3300009093 Ga0105240_10093565 Ga0105240_100935652 145
91 3300009093 Ga0105240_10253071 Ga0105240_102530712 145
92 3300009093 Ga0105240_10401745 Ga0105240_104017452 145
93 3300009094 Ga0111539_10237562 Ga0111539_102375622 145
94 3300009094 Ga0111539_10378802 Ga0111539_103788022 145
95 3300009094 Ga0111539_11208819 Ga0111539_112088192 145
96 3300009147 Ga0114129_10042708 Ga0114129_100427083 145
97 3300009148 Ga0105243_10014409 Ga0105243_100144095 145
98 3300009148 Ga0105243_10231183 Ga0105243_102311832 145
99 3300009174 Ga0105241_10024890 Ga0105241_100248903 145
100 3300009174 Ga0105241_10072704 Ga0105241_100727042 145
101 3300009174 Ga0105241_10133040 Ga0105241_101330403 145
102 3300009174 Ga0105241_10397423 Ga0105241_103974232 145
103 3300009177 Ga0105248_10244769 Ga0105248_102447692 145
104 3300009545 Ga0105237_10112230 Ga0105237_101122302 145
105 3300009545 Ga0105237_10151092 Ga0105237_101510923 145
106 3300009545 Ga0105237_11115022 Ga0105237_111150222 145
107 3300009551 Ga0105238_10000666 Ga0105238_1000066625 145
108 3300009551 Ga0105238_10073392 Ga0105238_100733925 145
109 3300009553 Ga0105249_10015723 Ga0105249_100157233 145
110 3300009553 Ga0105249_10113380 Ga0105249_101133802 145
111 3300009553 Ga0105249_13065265 Ga0105249_130652651 145
112 3300010375 Ga0105239_10222021 Ga0105239_102220212 145
113 3300010375 Ga0105239_10439641 Ga0105239_104396412 145
114 3300010375 Ga0105239_10599390 Ga0105239_105993901 145
115 3300013100 Ga0157373_10010881 Ga0157373_100108816 145
116 3300013100 Ga0157373_11396441 Ga0157373_113964411 145
117 3300013104 Ga0157370_10147654 Ga0157370_101476542 145
118 3300013104 Ga0157370_10505830 Ga0157370_105058302 145
119 3300013105 Ga0157369_10207122 Ga0157369_102071222 145
120 3300013296 Ga0157374_10210021 Ga0157374_102100213 145
121 3300013296 Ga0157374_10554953 Ga0157374_105549532 145
122 3300013306 Ga0163162_10000007 Ga0163162_10000007246 145
123 3300013306 Ga0163162_10445150 Ga0163162_104451502 145
124 3300013307 Ga0157372_10317080 Ga0157372_103170803 145
125 3300013307 Ga0157372_10369438 Ga0157372_103694382 145
126 3300013307 Ga0157372_10705295 Ga0157372_107052952 145
127 3300014326 Ga0157380_10088554 Ga0157380_100885543 145
128 3300014326 Ga0157380_11538856 Ga0157380_115388562 145
129 3300014968 Ga0157379_10638509 Ga0157379_106385092 145
130 3300014969 Ga0157376_10158950 Ga0157376_101589502 145
131 3300014969 Ga0157376_10768307 Ga0157376_107683072 145
132 3300020077 Ga0206351_10791454 Ga0206351_107914541 145
133 3300021384 Ga0213876_10101241 Ga0213876_101012412 145
134 3300025261 Ga0209233_1005233 Ga0209233_10052333 145
135 3300025298 Ga0209050_1001077 Ga0209050_10010774 145
136 3300025298 Ga0209050_1056560 Ga0209050_10565601 145
137 3300025304 Ga0209257_1059842 Ga0209257_10598422 145
138 3300025315 Ga0207697_10090805 Ga0207697_100908052 145
139 3300025321 Ga0207656_10011847 Ga0207656_100118472 145
140 3300025728 Ga0207655_1004802 Ga0207655_10048024 145
141 3300025728 Ga0207655_1218878 Ga0207655_12188781 145
142 3300025898 Ga0207692_10336808 Ga0207692_103368082 145
143 3300025903 Ga0207680_10003476 Ga0207680_100034768 145
144 3300025904 Ga0207647_10003977 Ga0207647_100039774 145
145 3300025908 Ga0207643_10240910 Ga0207643_102409102 145
146 3300025909 Ga0207705_10534115 Ga0207705_105341152 145
147 3300025910 Ga0207684_10045983 Ga0207684_100459832 145
148 3300025911 Ga0207654_10001500 Ga0207654_100015004 145
149 3300025911 Ga0207654_10438036 Ga0207654_104380361 145
150 3300025913 Ga0207695_10000014 Ga0207695_10000014590 145
151 3300025913 Ga0207695_10012780 Ga0207695_100127808 145
152 3300025913 Ga0207695_10014393 Ga0207695_100143938 145
153 3300025913 Ga0207695_10096867 Ga0207695_100968673 145
154 3300025913 Ga0207695_10408464 Ga0207695_104084642 145
155 3300025914 Ga0207671_10705417 Ga0207671_107054171 145
156 3300025915 Ga0207693_10093543 Ga0207693_100935431 145
157 3300025918 Ga0207662_10177496 Ga0207662_101774962 145
158 3300025920 Ga0207649_10059650 Ga0207649_100596501 145
159 3300025921 Ga0207652_10469033 Ga0207652_104690332 145
160 3300025922 Ga0207646_10015760 Ga0207646_100157606 145
161 3300025924 Ga0207694_10000409 Ga0207694_1000040926 145
162 3300025924 Ga0207694_10001937 Ga0207694_1000193711 145
163 3300025928 Ga0207700_10113203 Ga0207700_101132032 145
164 3300025929 Ga0207664_10008885 Ga0207664_100088855 145
165 3300025932 Ga0207690_11005161 Ga0207690_110051612 145
166 3300025933 Ga0207706_10002455 Ga0207706_100024551 145
167 3300025933 Ga0207706_10810044 Ga0207706_108100441 145
168 3300025934 Ga0207686_11028488 Ga0207686_110284882 145
169 3300025935 Ga0207709_10021704 Ga0207709_100217043 145
170 3300025938 Ga0207704_10250374 Ga0207704_102503742 145
171 3300025940 Ga0207691_10361502 Ga0207691_103615022 145
172 3300025942 Ga0207689_10232494 Ga0207689_102324941 145
173 3300025942 Ga0207689_10397047 Ga0207689_103970472 145
174 3300025944 Ga0207661_10126947 Ga0207661_101269472 145
175 3300025944 Ga0207661_11871203 Ga0207661_118712031 145
176 3300025949 Ga0207667_10013900 Ga0207667_100139004 145
177 3300025949 Ga0207667_10071238 Ga0207667_100712381 145
178 3300025949 Ga0207667_10368117 Ga0207667_103681173 145
179 3300025961 Ga0207712_10000189 Ga0207712_1000018920 145
180 3300025961 Ga0207712_11872687 Ga0207712_118726871 145
181 3300025981 Ga0207640_10000733 Ga0207640_1000073314 145
182 3300025981 Ga0207640_10826576 Ga0207640_108265761 145
183 3300025986 Ga0207658_10021869 Ga0207658_100218693 145
184 3300025986 Ga0207658_10058646 Ga0207658_100586463 145
185 3300026023 Ga0207677_10781944 Ga0207677_107819442 145
186 3300026035 Ga0207703_10000497 Ga0207703_1000049718 145
187 3300026041 Ga0207639_10000226 Ga0207639_1000022621 145
188 3300026041 Ga0207639_10000535 Ga0207639_1000053520 145
189 3300026041 Ga0207639_10217145 Ga0207639_102171452 145
190 3300026041 Ga0207639_10407532 Ga0207639_104075321 145
191 3300026041 Ga0207639_10761997 Ga0207639_107619971 145
192 3300026067 Ga0207678_10027241 Ga0207678_100272413 145
193 3300026067 Ga0207678_10089098 Ga0207678_100890983 145
194 3300026067 Ga0207678_10520780 Ga0207678_105207802 145
195 3300026075 Ga0207708_10092816 Ga0207708_100928163 145
196 3300026075 Ga0207708_10208879 Ga0207708_102088793 145
197 3300026078 Ga0207702_10464924 Ga0207702_104649242 145
198 3300026088 Ga0207641_10490575 Ga0207641_104905752 145
199 3300026088 Ga0207641_11166495 Ga0207641_111664951 145
200 3300026089 Ga0207648_10101412 Ga0207648_101014122 145
201 3300026089 Ga0207648_10358169 Ga0207648_103581692 145
202 3300026116 Ga0207674_10150728 Ga0207674_101507282 145
203 3300026116 Ga0207674_10657291 Ga0207674_106572911 145
204 3300026116 Ga0207674_11070935 Ga0207674_110709351 145
205 3300026142 Ga0207698_10073083 Ga0207698_100730832 145
206 3300026142 Ga0207698_10130653 Ga0207698_101306532 145
207 3300028379 Ga0268266_10000013 Ga0268266_10000013294 145
208 3300028379 Ga0268266_10041390 Ga0268266_100413904 145
209 3300028380 Ga0268265_10598897 Ga0268265_105988972 145
210 3300028381 Ga0268264_10504621 Ga0268264_105046212 145
211 3300028563 Ga0265319_1017934 Ga0265319_10179344 145
212 3300028573 Ga0265334_10015722 Ga0265334_100157223 145
213 3300028573 Ga0265334_10020291 Ga0265334_100202913 145
214 3300028573 Ga0265334_10240199 Ga0265334_102401992 145
215 3300028654 Ga0265322_10025840 Ga0265322_100258401 145
216 3300028654 Ga0265322_10034431 Ga0265322_100344312 145
217 3300028666 Ga0265336_10000800 Ga0265336_1000080012 145
218 3300028666 Ga0265336_10016343 Ga0265336_100163432 145
219 3300028666 Ga0265336_10042359 Ga0265336_100423592 145
220 3300028800 Ga0265338_10000025 Ga0265338_1000002572 145
221 3300028800 Ga0265338_10003996 Ga0265338_100039968 145
222 3300028800 Ga0265338_10123559 Ga0265338_101235593 145
223 3300028800 Ga0265338_10124855 Ga0265338_101248552 145
224 3300028800 Ga0265338_10134413 Ga0265338_101344133 145
225 3300029957 Ga0265324_10001331 Ga0265324_100013315 145
226 3300031247 Ga0265340_10010089 Ga0265340_100100893 145
227 3300031249 Ga0265339_10023694 Ga0265339_100236944 145
228 3300031249 Ga0265339_10138249 Ga0265339_101382492 145
229 3300031249 Ga0265339_10163886 Ga0265339_101638862 145
230 3300031344 Ga0265316_10023234 Ga0265316_100232344 145
231 3300031344 Ga0265316_10023665 Ga0265316_100236657 145
232 3300031344 Ga0265316_10090863 Ga0265316_100908633 145
233 3300031711 Ga0265314_10021939 Ga0265314_100219394 145
234 3300031711 Ga0265314_10365150 Ga0265314_103651502 145
235 3300031731 Ga0307405_10807553 Ga0307405_108075531 145
236 3300031852 Ga0307410_10404024 Ga0307410_104040242 145
237 3300031995 Ga0307409_100216945 Ga0307409_1002169452 145
238 3300032002 Ga0307416_100015643 Ga0307416_1000156432 145
239 3300032002 Ga0307416_100586142 Ga0307416_1005861421 145
240 3300035083 Ga0373926_0006254 Ga0373926_0006254_3087_3527 145
241 3300035083 Ga0373926_0108262 Ga0373926_0108262_51_488 145
242 3300035089 Ga0373944_0108810 Ga0373944_0108810_385_822 145
243 3300035116 Ga0373945_0146665 Ga0373945_0146665_71_511 145
244 3300035117 Ga0373953_0055573 Ga0373953_0055573_1059_1496 145
245 3300035118 Ga0373954_0043715 Ga0373954_0043715_920_1357 145
246 3300035119 Ga0373956_0012494 Ga0373956_0012494_1526_1963 145
247 3300035119 Ga0373956_0261825 Ga0373956_0261825_257_697 145
248 3300035170 Ga0373943_0018108 Ga0373943_0018108_1553_1993 145
249 3300035171 Ga0373946_0011300 Ga0373946_0011300_2755_3195 145
250 3300035172 Ga0373955_0003036 Ga0373955_0003036_4980_5420 145
251 3300035410 Ga0373924_0023251 Ga0373924_0023251_1072_1512 145
252 3300035695 Ga0373927_0004850 Ga0373927_0004850_6335_6775 145
253 3300035725 Ga0373947_0242284 Ga0373947_0242284_210_650 145
254 3300036401 Ga0373937_0172554 Ga0373937_0172554_1498_1938 145
255 3300036401 Ga0373937_0654556 Ga0373937_0654556_46_486 145
256 3300036401 Ga0373937_0663264 Ga0373937_0663264_196_636 145
257 3300037068 Ga0373925_0048295 Ga0373925_0048295_2316_2756 145
258 3300037068 Ga0373925_0124004 Ga0373925_0124004_470_910 145
259 3300039437 Ga0436365_0572805 Ga0436365_0572805_607_1050 145
260 3300041408 Ga0439453_0021269 Ga0439453_0021269_526_969 145
261 3300041452 Ga0451793_1720382 Ga0451793_1720382_256_693 145
262 3300041486 Ga0451807_1211958 Ga0451807_1211958_1699_2136 145
263 3300041491 Ga0451833_0421601 Ga0451833_0421601_83_520 145
264 3300041512 Ga0451853_1767403 Ga0451853_1767403_217_654 145
265 3300041512 Ga0451853_3975526 Ga0451853_3975526_130_567 145
266 3300042125 Ga0450923_029910 Ga0450923_029910_482_925 145
267 3300042437 Ga0439444_0016036 Ga0439444_0016036_356_799 145
268 3300042439 Ga0439464_0231919 Ga0439464_0231919_88_525 145
269 3300042876 Ga0451577_0008776 Ga0451577_0008776_9175_9612 145
270 3300042876 Ga0451577_0154152 Ga0451577_0154152_209_646 145
271 3300044712 Ga0453684_0000054 Ga0453684_0000054_471363_471806 145
272 3300044712 Ga0453684_0014655 Ga0453684_0014655_11206_11643 145
273 3300045051 Ga0451576_0197929 Ga0451576_0197929_517_954 145
274 3300046454 Ga0495592_0009921 Ga0495592_0009921_240_680 145
275 3300046454 Ga0495592_0071874 Ga0495592_0071874_1975_2412 145
276 3300046459 Ga0495629_0295983 Ga0495629_0295983_164_604 145
277 3300046462 Ga0495651_0089078 Ga0495651_0089078_782_1222 145
278 3300046472 Ga0495580_0025366 Ga0495580_0025366_1193_1633 145
279 3300046472 Ga0495580_0506998 Ga0495580_0506998_231_671 145
280 3300046473 Ga0495582_0174909 Ga0495582_0174909_620_1060 145
281 3300046475 Ga0495639_0437347 Ga0495639_0437347_40_483 145
282 3300046476 Ga0495662_0067093 Ga0495662_0067093_233_676 145
283 3300046477 Ga0495664_0212829 Ga0495664_0212829_80_523 145
284 3300046511 Ga0495608_0003346 Ga0495608_0003346_10098_10538 145
285 3300046514 Ga0495618_0334336 Ga0495618_0334336_379_822 145
286 3300046515 Ga0495620_0026501 Ga0495620_0026501_1208_1645 145
287 3300046516 Ga0495628_0082636 Ga0495628_0082636_1544_1981 145
288 3300046516 Ga0495628_0180829 Ga0495628_0180829_94_534 145
289 3300046517 Ga0495630_0000374 Ga0495630_0000374_22933_23376 145
290 3300046517 Ga0495630_0001775 Ga0495630_0001775_6382_6822 145
291 3300046517 Ga0495630_0139641 Ga0495630_0139641_13_450 145
292 3300046525 Ga0495663_0260885 Ga0495663_0260885_76_513 145
293 3300046526 Ga0495666_0090570 Ga0495666_0090570_640_1083 145
294 3300046533 Ga0495640_0446110 Ga0495640_0446110_172_609 145
295 3300046535 Ga0495586_0000496 Ga0495586_0000496_10986_11429 145
296 3300046535 Ga0495586_0461691 Ga0495586_0461691_272_712 145
297 3300046536 Ga0495587_0007021 Ga0495587_0007021_5508_5951 145
298 3300046536 Ga0495587_0047519 Ga0495587_0047519_750_1190 145
299 3300046536 Ga0495587_0675411 Ga0495587_0675411_105_542 145
300 3300046543 Ga0495645_0040989 Ga0495645_0040989_2593_3033 145
301 3300046543 Ga0495645_0304313 Ga0495645_0304313_436_873 145
302 3300046559 Ga0495667_0086173 Ga0495667_0086173_772_1215 145
303 3300046559 Ga0495667_0422078 Ga0495667_0422078_100_543 145
304 3300046559 Ga0495667_0972109 Ga0495667_0972109_47_484 145
305 3300046678 Ga0495599_0275999 Ga0495599_0275999_366_806 145
306 3300046681 Ga0495647_0062088 Ga0495647_0062088_213_656 145
307 3300046683 Ga0495658_0006795 Ga0495658_0006795_3444_3887 145
308 3300046683 Ga0495658_0251817 Ga0495658_0251817_633_1070 145
309 3300046684 Ga0495669_0001154 Ga0495669_0001154_9544_9984 145
310 3300046684 Ga0495669_0270987 Ga0495669_0270987_285_722 145
311 3300046689 Ga0495613_0003345 Ga0495613_0003345_3049_3489 145
312 3300046689 Ga0495613_0367355 Ga0495613_0367355_237_674 145
313 3300046690 Ga0495624_0060391 Ga0495624_0060391_1366_1803 145
314 3300046690 Ga0495624_0164110 Ga0495624_0164110_577_1020 145
315 3300046809 Ga0495600_0049569 Ga0495600_0049569_84_524 145
316 3300046809 Ga0495600_0171513 Ga0495600_0171513_921_1364 145
317 3300046809 Ga0495600_0432322 Ga0495600_0432322_130_573 145
318 3300047315 Ga0495581_0013628 Ga0495581_0013628_2073_2516 145
319 3300047315 Ga0495581_0056317 Ga0495581_0056317_785_1228 145
320 3300047319 Ga0495674_0007288 Ga0495674_0007288_3584_4027 145
321 3300047321 Ga0495676_0019515 Ga0495676_0019515_2663_3106 145
322 3300047444 Ga0495675_0029305 Ga0495675_0029305_2411_2854 145
323 3300047471 Ga0495684_0011054 Ga0495684_0011054_3901_4341 145
324 3300047471 Ga0495684_0180932 Ga0495684_0180932_496_939 145
325 3300047471 Ga0495684_0707966 Ga0495684_0707966_10_453 145
326 3300048903 Ga0496100_0408247 Ga0496100_0408247_119_556 145
327 3300048907 Ga0496104_0003947 Ga0496104_0003947_4128_4565 145
328 3300048908 Ga0496105_0038630 Ga0496105_0038630_3045_3482 145
329 3300048910 Ga0496107_0428047 Ga0496107_0428047_119_556 145
330 3300048912 Ga0496109_0115723 Ga0496109_0115723_1865_2302 145
331 3300048917 Ga0496114_0534539 Ga0496114_0534539_190_630 145
332 3300048917 Ga0496114_1263394 Ga0496114_1263394_54_491 145
333 3300048918 Ga0496115_0015631 Ga0496115_0015631_1885_2322 145
334 3300048920 Ga0496117_0067366 Ga0496117_0067366_466_906 145
335 3300048927 Ga0496124_0126612 Ga0496124_0126612_273_710 145
336 3300049568 Ga0501031_0008845 Ga0501031_0008845_475_912 145
337 3300049568 Ga0501031_0121769 Ga0501031_0121769_11_454 145
338 3300049569 Ga0501032_0009421 Ga0501032_0009421_1015_1452 145
339 3300049569 Ga0501032_0017267 Ga0501032_0017267_3919_4356 145
340 3300049569 Ga0501032_0300831 Ga0501032_0300831_543_986 145
341 3300049570 Ga0501033_0060374 Ga0501033_0060374_1257_1694 145
342 3300049571 Ga0501034_0214661 Ga0501034_0214661_1431_1868 145
343 3300049571 Ga0501034_0549255 Ga0501034_0549255_554_1054 145
344 3300049572 Ga0501036_0002145 Ga0501036_0002145_13333_13776 145
345 3300049572 Ga0501036_0068231 Ga0501036_0068231_1145_1582 145
346 3300049572 Ga0501036_0165386 Ga0501036_0165386_994_1437 145
347 3300049572 Ga0501036_1455976 Ga0501036_1455976_61_504 145
348 3300049573 Ga0501037_0001786 Ga0501037_0001786_233_670 145
349 3300049573 Ga0501037_0064337 Ga0501037_0064337_1411_1848 145
350 3300049573 Ga0501037_0305006 Ga0501037_0305006_207_650 145
351 3300049574 Ga0501038_0127988 Ga0501038_0127988_360_860 145
352 3300049574 Ga0501038_0441786 Ga0501038_0441786_518_955 145
353 3300049575 Ga0501039_0005797 Ga0501039_0005797_7562_8005 145
354 3300049575 Ga0501039_0239641 Ga0501039_0239641_643_1086 145
355 3300049576 Ga0501040_0016974 Ga0501040_0016974_2860_3303 145
356 3300049577 Ga0501041_0098808 Ga0501041_0098808_441_884 145
357 3300049577 Ga0501041_0244016 Ga0501041_0244016_465_908 145
358 3300049578 Ga0501042_0004345 Ga0501042_0004345_2038_2481 145
359 3300049578 Ga0501042_0381960 Ga0501042_0381960_305_748 145
360 3300049579 Ga0501043_0014311 Ga0501043_0014311_284_721 145
361 3300049579 Ga0501043_0345440 Ga0501043_0345440_283_726 145
362 3300049580 Ga0501046_0001067 Ga0501046_0001067_885_1322 145
363 3300049582 Ga0501048_0152979 Ga0501048_0152979_192_629 145
364 3300049582 Ga0501048_0167158 Ga0501048_0167158_641_1084 145
365 3300049582 Ga0501048_0587593 Ga0501048_0587593_141_641 145
366 3300049582 Ga0501048_0640270 Ga0501048_0640270_109_552 145
367 3300049584 Ga0501068_0077480 Ga0501068_0077480_256_699 145
368 3300049584 Ga0501068_0459827 Ga0501068_0459827_106_549 145
369 3300049585 Ga0501069_0021551 Ga0501069_0021551_1700_2200 145
370 3300049587 Ga0501071_0027857 Ga0501071_0027857_1486_1929 145
371 3300049587 Ga0501071_0054582 Ga0501071_0054582_183_626 145
372 3300049587 Ga0501071_0100430 Ga0501071_0100430_1544_2044 145
373 3300049588 Ga0501072_0039237 Ga0501072_0039237_1041_1484 145
374 3300049588 Ga0501072_0063256 Ga0501072_0063256_1198_1641 145
375 3300049588 Ga0501072_0261081 Ga0501072_0261081_59_502 145
376 3300049589 Ga0501073_0048654 Ga0501073_0048654_780_1217 145
377 3300049590 Ga0501074_0002108 Ga0501074_0002108_11973_12473 145
378 3300049590 Ga0501074_0048567 Ga0501074_0048567_1969_2412 145
379 3300049591 Ga0501075_0025510 Ga0501075_0025510_2275_2718 145
380 3300049591 Ga0501075_0033128 Ga0501075_0033128_1887_2330 145
381 3300049592 Ga0501076_0003528 Ga0501076_0003528_7878_8378 145
382 3300049592 Ga0501076_0072207 Ga0501076_0072207_1357_1800 145
383 3300049593 Ga0501077_0017064 Ga0501077_0017064_4059_4502 145
384 3300049593 Ga0501077_0041611 Ga0501077_0041611_661_1104 145
385 3300049679 Ga0501249_175331 Ga0501249_175331_64_504 145
386 3300049741 Ga0501079_0004607 Ga0501079_0004607_8917_9360 145
387 3300049742 Ga0501080_0009318 Ga0501080_0009318_2861_3304 145
388 3300049742 Ga0501080_0256453 Ga0501080_0256453_766_1203 145
389 3300049743 Ga0501081_0056372 Ga0501081_0056372_1303_1746 145
390 3300049743 Ga0501081_0954954 Ga0501081_0954954_138_581 145
391 3300049744 Ga0501083_0501840 Ga0501083_0501840_265_708 145
392 3300049822 Ga0501035_0335740 Ga0501035_0335740_562_1005 145
393 3300049823 Ga0501044_0059893 Ga0501044_0059893_1571_2008 145
394 3300049823 Ga0501044_0535833 Ga0501044_0535833_236_679 145
395 3300049824 Ga0501045_0002175 Ga0501045_0002175_243_686 145
396 3300049824 Ga0501045_0135457 Ga0501045_0135457_786_1229 145
397 3300049824 Ga0501045_0833041 Ga0501045_0833041_128_577 145
398 3300050507 nmdc:mga05p37_22945_c1 nmdc:mga05p37_22945_c1_4078_4578 145
399 3300050508 nmdc:mga09592_1278660_c1 nmdc:mga09592_1278660_c1_26_463 145
400 3300050508 nmdc:mga09592_271741_c1 nmdc:mga09592_271741_c1_912_1394 145
401 3300050508 nmdc:mga09592_313269_c1 nmdc:mga09592_313269_c1_200_640 145
402 3300050508 nmdc:mga09592_33670_c1 nmdc:mga09592_33670_c1_3023_3460 145
403 3300050509 nmdc:mga0qj67_149338_c1 nmdc:mga0qj67_149338_c1_687_1124 145
404 3300050510 nmdc:mga06r32_1053346_c1 nmdc:mga06r32_1053346_c1_25_462 145
405 3300050510 nmdc:mga06r32_3978_c1 nmdc:mga06r32_3978_c1_11821_12303 145
406 3300050511 nmdc:mga08y16_262070_c1 nmdc:mga08y16_262070_c1_725_1225 145
407 3300050511 nmdc:mga08y16_411225_c1 nmdc:mga08y16_411225_c1_539_976 145
408 3300050512 nmdc:mga0n895_12540_c1 nmdc:mga0n895_12540_c1_838_1275 145
409 3300050512 nmdc:mga0n895_786982_c1 nmdc:mga0n895_786982_c1_304_741 145
410 3300050513 nmdc:mga0rr50_375918_c1 nmdc:mga0rr50_375918_c1_612_1052 145
411 3300050513 nmdc:mga0rr50_79780_c1 nmdc:mga0rr50_79780_c1_1489_1926 145
412 3300050514 nmdc:mga08x19_146236_c1 nmdc:mga08x19_146236_c1_180_617 145
413 3300050515 nmdc:mga0a205_18970_c1 nmdc:mga0a205_18970_c1_1597_2097 145
414 3300053077 Ga0495601_0035296 Ga0495601_0035296_1284_1724 145
415 3300053077 Ga0495601_0182179 Ga0495601_0182179_21_461 145
416 3300053084 Ga0495595_0426869 Ga0495595_0426869_205_642 145
417 3300053085 Ga0495619_0002562 Ga0495619_0002562_681_1121 145
418 3300053085 Ga0495619_0151615 Ga0495619_0151615_897_1337 145
419 3300053153 Ga0500616_0004822 Ga0500616_0004822_1132_1569 145
420 3300054114 Ga0501084_0001233 Ga0501084_0001233_8898_9341 145
421 3300054114 Ga0501084_0516366 Ga0501084_0516366_41_484 145
422 3300054114 Ga0501084_0732885 Ga0501084_0732885_152_595 145
423 3300060353 Ga0501082_0009973 Ga0501082_0009973_927_1370 145
424 3300061734 Ga0530510_0010635 Ga0530510_0010635_5930_6373 145
425 3300061734 Ga0530510_0169815 Ga0530510_0169815_242_685 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

4

103

0.94

PF14437

MafB19-deam

MafB19-like deaminase

5

140

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p6o-assembly1.cif.gz_A the crystal structure of yeast cytosine deaminase bound to 4(r)-hydroxyl-3,4-dihydropyrimidine at 1.14 angstroms. 0.9753 5 145
1ysd-assembly1.cif.gz_A yeast cytosine deaminase double mutant 0.9751 5 145
1ysb-assembly1.cif.gz_A yeast cytosine deaminase triple mutant 0.9747 5 145
2o3k-assembly1.cif.gz_B yeast cytosine deaminase d92e triple mutant bound to transition state analogue hpy 0.9745 5 145
1p6o-assembly1.cif.gz_A the crystal structure of yeast cytosine deaminase bound to 4(r)-hydroxyl-3,4-dihydropyrimidine at 1.14 angstroms. 0.9424 5 145
ID Description Score Start End Superfamily
af_P78594_2_150_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9793 4 145 3.40.140.10
af_P78594_2_150_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9528 4 145 3.40.140.10
af_A0A0R4IDF5_228_326_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9326 23 36 2.60.40.10
af_F1QGG7_15_242_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9304 23 36 2.60.40.10
af_Q9VEM0_1_160_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8817 1 133 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7S4I2A5-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 1.003 4 94 GO:0008835
AF-A0A1E3X3B7-F1-model_v4 Cytosine deaminase 1.001 1 87 GO:0008835
AF-A0A1G1M0P6-F1-model_v4 tRNA-specific adenosine deaminase 0.9999 4 120 GO:0008835
AF-A0A7W0YKN8-F1-model_v4 Nucleoside deaminase 0.9984 1 128 GO:0008270
GO:0008835
AF-F0T920-F1-model_v4 Cytosine deaminase (EC 3.5.4.1) 0.9982 4 143 GO:0004131
GO:0008835

Feature Viewer

pLDDT pTM Quality
96.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map