F441052

General Info

Members Datasets Scaffolds Average Seq Length
425 348 252 249

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0052689|Ga0496104_0052689_366_1214
Length 282
Sequence MSSTPRSRLRRAVSRSSRSSAQDLRASTSDTGTAASGFENGVIQFAHASAPLPPYARVKQFLKDSLEAGRWAPGQQMPSEADLVAQFGVSRMTVHRALRELQDAGLIERVQGVGTFAAQLNRVSSTLTINDIHDEIESRGHRHDARVHLKRAEAAPPALAARLGLAPGDTVFHTLIVHHEHGVALQCEDRYVNPACAPNYLDVDFTTTTPTHYLLEVAPLWEAQVAIEAALPTAQEAKLLGIERSEPCLVVVRRTVSRGLPVTLARLVHPGSRYTLDGQFRP

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
16 2643221599 Rhizobium sp. Root708 Isolate Unclassified
17 2643221607 Rhizobium sp. Root73 Isolate Unclassified
18 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
19 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
20 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
21 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
22 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
23 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
24 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
25 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
26 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
27 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
28 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
29 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
30 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
31 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
32 2854911287 Brucella lupini LUP21 Isolate Unclassified
33 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
34 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
35 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
36 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
37 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
38 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
39 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
40 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
41 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
42 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
43 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
44 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
45 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
46 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
47 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
48 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
49 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
50 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
51 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
52 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
53 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
54 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
55 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
56 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
57 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
58 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
59 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
60 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
61 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
62 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
63 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
64 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
65 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
66 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
67 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
68 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
69 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
70 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
71 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
72 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
73 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
74 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
75 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
76 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
77 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
78 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
79 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
80 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
81 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
82 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
83 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
84 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
85 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
86 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
87 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
88 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
89 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
90 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
91 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
92 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
93 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
94 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
95 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
96 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
97 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
98 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
99 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
100 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
101 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
102 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
103 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
104 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
105 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
106 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
107 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
108 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
109 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
110 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
111 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
112 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
113 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
114 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
115 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
116 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
117 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
118 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
119 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
120 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
121 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
122 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
123 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
124 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
125 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
126 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
127 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
128 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
129 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
130 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
131 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
132 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
133 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
134 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
135 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
136 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
137 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
138 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
139 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
140 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
141 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
142 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
143 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
144 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
145 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
146 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
147 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
148 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
149 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
150 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
151 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
152 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
153 3004167301 Mesorhizobium loti 582 Isolate Unclassified
154 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
155 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
156 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
157 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
158 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
159 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
160 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
161 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
162 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
163 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
164 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
165 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
166 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
167 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
168 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
169 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
170 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
171 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
172 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
173 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
174 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
175 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
176 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
177 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
178 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
179 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
180 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
181 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
182 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
183 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
184 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
185 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
186 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
187 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
188 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
189 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
190 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
191 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
192 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
193 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
194 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
195 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
196 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
197 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
198 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
199 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
200 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
201 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
202 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
203 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
204 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
205 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
206 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
207 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
208 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
209 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
210 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
211 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
212 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
213 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
214 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
215 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
216 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
217 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
218 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
219 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
220 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
221 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
222 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
223 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
224 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
227 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
229 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
230 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
233 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
234 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
236 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
237 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
238 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
239 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
273 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
274 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
275 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
276 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
277 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
278 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
279 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
280 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
283 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
287 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
288 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
289 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
292 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
295 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
309 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
314 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
315 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
316 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
317 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
334 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
338 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
340 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
341 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
342 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
343 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
344 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
345 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
346 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
347 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
348 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.29
Metatranscriptomes 0
Isolates 40.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.29
Nodule 32.47
Rhizoplane 2.35
Rhizosphere 40.71
Stem 0
Stem Tuber 0
Unclassified 13.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10033080 3300001989 Bacteria 1773
2 JGI25156J39149_1000411 3300002705 Bacteria 26753
3 JGI25156J39149_1000473 3300002705 Bacteria 24243
4 JGI25154J39366_1000848 3300002738 Bacteria 13263
5 JGI25157J39369_1000052 3300002741 Bacteria 110463
6 JGI25164J39214_1007894 3300002772 Bacteria 1071
7 JGI25151J46595_10000149 3300003187 Bacteria 91894
8 rootH2_10010540 3300003320 Bacteria 2074
9 rootH2_10055848 3300003320 Bacteria 2026
10 rootL2_10110999 3300003322 Bacteria 1718
11 rootL2_10111000 3300003322 Bacteria 1981
12 rootH1_10057961 3300003323 Bacteria 2348
13 rootH1_10167436 3300003323 Bacteria 1891
14 Ga0055539_1000234 3300003752 Bacteria 38255
15 Ga0055539_1002955 3300003752 Bacteria 2458
16 Ga0055533_1000053 3300003756 Bacteria 199478
17 Ga0055535_1000146 3300003761 Bacteria 74586
18 Ga0055535_1004731 3300003761 Bacteria 3204
19 Ga0055542_1000068 3300003762 Bacteria 152353
20 Ga0055542_1000585 3300003762 Bacteria 31607
21 Ga0055529_1000219 3300003763 Bacteria 74582
22 Ga0055540_1008395 3300003792 Bacteria 3726
23 Ga0070658_10099588 3300005327 Bacteria 2402
24 Ga0070676_10296136 3300005328 Bacteria 1095
25 Ga0070683_100293699 3300005329 Bacteria 1546
26 Ga0070677_10078863 3300005333 Bacteria 1404
27 Ga0068869_100303713 3300005334 Unclassified 1289
28 Ga0070660_100035902 3300005339 Bacteria 3752
29 Ga0070660_100066559 3300005339 Bacteria 2805
30 Ga0070669_100017766 3300005353 Bacteria 5075
31 Ga0070675_100045677 3300005354 Bacteria 3584
32 Ga0070675_100138097 3300005354 Bacteria 2081
33 Ga0070675_100317680 3300005354 Bacteria 1375
34 Ga0070674_100397085 3300005356 Bacteria 1126
35 Ga0070673_100115239 3300005364 Bacteria 2234
36 Ga0070667_100231988 3300005367 Bacteria 1646
37 Ga0070678_100246383 3300005456 Bacteria 1496
38 Ga0070679_100274526 3300005530 Bacteria 1639
39 Ga0070684_100274790 3300005535 Bacteria 1543
40 Ga0068853_100055820 3300005539 Bacteria 3405
41 Ga0068853_100263337 3300005539 Bacteria 1586
42 Ga0068853_100539176 3300005539 Bacteria 1104
43 Ga0068855_100011228 3300005563 Bacteria 10818
44 Ga0068855_100067765 3300005563 Bacteria 4156
45 Ga0068855_100105875 3300005563 Bacteria 3233
46 Ga0068855_100306523 3300005563 Bacteria 1758
47 Ga0068855_100629946 3300005563 Bacteria 1154
48 Ga0068857_100001102 3300005577 Bacteria 20972
49 Ga0068857_100850470 3300005577 Bacteria 873
50 Ga0068856_100001785 3300005614 Bacteria 22477
51 Ga0068856_100429218 3300005614 Bacteria 1342
52 Ga0068852_100128961 3300005616 Bacteria 2327
53 Ga0068852_100165540 3300005616 Bacteria 2069
54 Ga0068861_100037619 3300005719 Bacteria 3598
55 Ga0068861_100177031 3300005719 Bacteria 1772
56 Ga0068851_10157939 3300005834 Bacteria 1244
57 Ga0068863_100028960 3300005841 Bacteria 5290
58 Ga0068860_100096343 3300005843 Bacteria 2820
59 Ga0075365_10267882 3300006038 Bacteria 1201
60 Ga0075363_100022662 3300006048 Bacteria 3177
61 Ga0075364_10109280 3300006051 Bacteria 1844
62 Ga0075367_10111718 3300006178 Bacteria 1678
63 Ga0075369_10051221 3300006186 Bacteria 1787
64 Ga0075370_10138091 3300006353 Bacteria 1424
65 Ga0068871_100172235 3300006358 Bacteria 1856
66 Ga0105240_10009318 3300009093 Bacteria 13917
67 Ga0105240_10072414 3300009093 Bacteria 4259
68 Ga0105240_10100601 3300009093 Bacteria 3517
69 Ga0105240_10199107 3300009093 Bacteria 2349
70 Ga0105240_10446453 3300009093 Bacteria 1448
71 Ga0105243_10037447 3300009148 Bacteria 3771
72 Ga0105243_10889482 3300009148 Bacteria 885
73 Ga0105242_10111628 3300009176 Bacteria 2331
74 Ga0105248_10003379 3300009177 Bacteria 17738
75 Ga0105237_10000739 3300009545 Bacteria 45075
76 Ga0105237_10074371 3300009545 Bacteria 3390
77 Ga0105237_10625409 3300009545 Bacteria 1084
78 Ga0105238_10005732 3300009551 Bacteria 12281
79 Ga0105238_10345852 3300009551 Bacteria 1476
80 Ga0105033_100756 3300009986 Bacteria 2523
81 Ga0105239_10000344 3300010375 Bacteria 67887
82 Ga0105239_10045636 3300010375 Bacteria 4803
83 Ga0105239_10143127 3300010375 Bacteria 2665
84 Ga0105239_10333917 3300010375 Bacteria 1710
85 Ga0157374_10103101 3300013296 Bacteria 2737
86 Ga0157378_10231629 3300013297 Bacteria 1760
87 Ga0157372_10446130 3300013307 Bacteria 1508
88 Ga0157375_10267848 3300013308 Bacteria 1870
89 Ga0157380_10028639 3300014326 Bacteria 4249
90 Ga0157379_10336502 3300014968 Bacteria 1380
91 Ga0213872_10035836 3300021361 Unclassified 2268
92 Ga0209674_100039 3300025226 Bacteria 402292
93 Ga0209563_100080 3300025230 Bacteria 199504
94 Ga0207427_100466 3300025231 Bacteria 22197
95 Ga0209258_100072 3300025242 Bacteria 274355
96 Ga0209258_100222 3300025242 Bacteria 107982
97 Ga0209646_1000076 3300025246 Bacteria 212891
98 Ga0209026_1000011 3300025250 Bacteria 507291
99 Ga0209677_100086 3300025253 Bacteria 112759
100 Ga0209677_100399 3300025253 Bacteria 26179
101 Ga0209677_101600 3300025253 Bacteria 9557
102 Ga0209148_1000078 3300025254 Bacteria 296101
103 Ga0209759_1000034 3300025256 Bacteria 271209
104 Ga0209759_1000814 3300025256 Bacteria 24829
105 Ga0209759_1010855 3300025256 Bacteria 2633
106 Ga0209233_1012751 3300025261 Bacteria 2424
107 Ga0209455_1000053 3300025272 Bacteria 365949
108 Ga0209455_1000131 3300025272 Bacteria 160715
109 Ga0209130_1000313 3300025284 Bacteria 57104
110 Ga0209025_1000099 3300025294 Bacteria 231353
111 Ga0209758_1002213 3300025297 Bacteria 20268
112 Ga0209758_1009792 3300025297 Bacteria 5872
113 Ga0207426_1000065 3300025302 Bacteria 353625
114 Ga0209051_1001170 3300025303 Bacteria 23852
115 Ga0209051_1014638 3300025303 Bacteria 3648
116 Ga0209051_1045142 3300025303 Bacteria 1528
117 Ga0207682_10030060 3300025893 Bacteria 2174
118 Ga0207642_10175884 3300025899 Bacteria 1162
119 Ga0207647_10015189 3300025904 Bacteria 5289
120 Ga0207647_10053874 3300025904 Bacteria 2477
121 Ga0207645_10053298 3300025907 Bacteria 2585
122 Ga0207705_10040729 3300025909 Bacteria 3333
123 Ga0207705_10125798 3300025909 Bacteria 1905
124 Ga0207705_10168391 3300025909 Bacteria 1649
125 Ga0207695_10017975 3300025913 Bacteria 8187
126 Ga0207695_10073403 3300025913 Bacteria 3486
127 Ga0207695_10777339 3300025913 Bacteria 838
128 Ga0207671_10001929 3300025914 Bacteria 22998
129 Ga0207671_10043926 3300025914 Bacteria 3304
130 Ga0207657_10019777 3300025919 Bacteria 6382
131 Ga0207657_10045919 3300025919 Bacteria 3829
132 Ga0207649_10111884 3300025920 Bacteria 1826
133 Ga0207694_10020998 3300025924 Bacteria 4943
134 Ga0207659_10104851 3300025926 Bacteria 2138
135 Ga0207690_10038416 3300025932 Bacteria 3116
136 Ga0207706_10021234 3300025933 Bacteria 5833
137 Ga0207706_10302467 3300025933 Bacteria 1393
138 Ga0207709_10036361 3300025935 Bacteria 2918
139 Ga0207704_10207706 3300025938 Bacteria 1439
140 Ga0207691_10033521 3300025940 Bacteria 4781
141 Ga0207691_10306334 3300025940 Bacteria 1364
142 Ga0207711_10040793 3300025941 Bacteria 3950
143 Ga0207689_10004890 3300025942 Bacteria 12082
144 Ga0207689_10317542 3300025942 Unclassified 1292
145 Ga0207679_10148188 3300025945 Bacteria 1906
146 Ga0207667_10004373 3300025949 Bacteria 17299
147 Ga0207667_10062306 3300025949 Bacteria 3900
148 Ga0207667_10081378 3300025949 Bacteria 3355
149 Ga0207667_10149384 3300025949 Bacteria 2405
150 Ga0207651_10006671 3300025960 Bacteria 6074
151 Ga0207651_10032046 3300025960 Bacteria 3370
152 Ga0207668_10066835 3300025972 Bacteria 2550
153 Ga0207658_10035351 3300025986 Bacteria 3578
154 Ga0207639_10342817 3300026041 Bacteria 1332
155 Ga0207678_10151239 3300026067 Bacteria 1982
156 Ga0207702_10000392 3300026078 Bacteria 49946
157 Ga0207702_10383994 3300026078 Bacteria 1351
158 Ga0207641_10029792 3300026088 Bacteria 4514
159 Ga0207674_10007715 3300026116 Bacteria 12523
160 Ga0207674_10508789 3300026116 Bacteria 1163
161 Ga0207675_100023901 3300026118 Bacteria 5684
162 Ga0207683_10162722 3300026121 Bacteria 2018
163 Ga0207683_10256043 3300026121 Bacteria 1598
164 Ga0207683_10506535 3300026121 Bacteria 1115
165 Ga0207698_10082223 3300026142 Bacteria 2603
166 Ga0207698_10437767 3300026142 Bacteria 1259
167 Ga0268264_10092518 3300028381 Bacteria 2610
168 Ga0265336_10000014 3300028666 Bacteria 241247
169 Ga0265324_10000660 3300029957 Bacteria 23270
170 Ga0307509_10053043 3300031507 Bacteria 4327
171 Ga0307508_10019330 3300031616 Bacteria 6192
172 Ga0307514_10000762 3300031649 Bacteria 53648
173 Ga0316576_10202180 3300031727 Unclassified 1496
174 Ga0307516_10000703 3300031730 Bacteria 45501
175 Ga0307412_10098717 3300031911 Bacteria 2060
176 Ga0307412_10409932 3300031911 Bacteria 1106
177 Ga0373931_0002334 3300035691 Bacteria 8380
178 Ga0373931_0367128 3300035691 Bacteria 904
179 Ga0373947_0128023 3300035725 Bacteria 1619
180 Ga0316582_0620120 3300036647 Bacteria 744
181 Ga0316584_0482668 3300036712 Bacteria 873
182 Ga0395898_0246247 3300037466 Bacteria 1705
183 Ga0395905_0307965 3300037471 Bacteria 1472
184 Ga0395901_0156658 3300038443 Bacteria 2392
185 Ga0400489_83698 3300039093 Bacteria 37676
186 Ga0436361_0461509 3300039447 Bacteria 10650
187 Ga0436361_0802214 3300039447 Unclassified 3811
188 Ga0436361_1125410 3300039447 Bacteria 7248
189 Ga0451802_1139503 3300041460 Bacteria 922
190 Ga0451577_0814559 3300042876 Bacteria 843
191 Ga0466969_0000093 3300044656 Bacteria 46242
192 Ga0466969_0006126 3300044656 Bacteria 6403
193 Ga0466972_0037373 3300044658 Bacteria 2374
194 Ga0466965_0007754 3300044683 Bacteria 4940
195 Ga0466965_0016928 3300044683 Bacteria 3477
196 Ga0466963_0148028 3300044694 Bacteria 1630
197 Ga0466964_0015017 3300044706 Bacteria 2950
198 Ga0466971_0007565 3300044719 Bacteria 4736
199 Ga0466970_0047259 3300044765 Bacteria 2293
200 Ga0466970_0057087 3300044765 Bacteria 2087
201 Ga0466957_0004905 3300044842 Bacteria 7488
202 Ga0466960_0037992 3300044901 Bacteria 2261
203 Ga0466960_0094259 3300044901 Bacteria 1531
204 Ga0466960_0096435 3300044901 Bacteria 1516
205 Ga0466959_0036027 3300045049 Bacteria 3656
206 Ga0451576_0169267 3300045051 Bacteria 2280
207 Ga0466958_0148217 3300045836 Bacteria 1479
208 Ga0495607_0209912 3300046501 Unclassified 959
209 Ga0495583_0000258 3300046506 Bacteria 87863
210 Ga0495583_0002421 3300046506 Bacteria 16011
211 Ga0495606_0002471 3300046507 Bacteria 21403
212 Ga0495610_0001443 3300046512 Bacteria 20999
213 Ga0495610_0025070 3300046512 Bacteria 3208
214 Ga0495652_0161537 3300046529 Bacteria 1739
215 Ga0495598_0036283 3300046537 Bacteria 1416
216 Ga0495621_0011386 3300046539 Bacteria 2749
217 Ga0495621_0023015 3300046539 Bacteria 2070
218 Ga0495633_0133065 3300046558 Bacteria 1151
219 Ga0495668_0032773 3300046616 Bacteria 2921
220 Ga0495668_0144100 3300046616 Bacteria 1304
221 Ga0495625_0042104 3300046660 Bacteria 3321
222 Ga0495671_0079162 3300046692 Bacteria 1611
223 Ga0495649_0001667 3300046694 Bacteria 16502
224 Ga0495649_0186167 3300046694 Bacteria 1082
225 Ga0495589_0034169 3300046794 Bacteria 2553
226 Ga0495672_0191371 3300047320 Bacteria 1028
227 Ga0495615_0038014 3300048090 Unclassified 1188
228 Ga0496101_0125112 3300048904 Bacteria 1948
229 Ga0496102_0005507 3300048905 Bacteria 10750
230 Ga0496102_0338930 3300048905 Bacteria 1416
231 Ga0496104_0052689 3300048907 Bacteria 3844
232 Ga0496104_0112348 3300048907 Bacteria 2613
233 Ga0496108_0166320 3300048911 Bacteria 1907
234 Ga0496109_0665428 3300048912 Bacteria 978
235 Ga0496112_0457471 3300048915 Bacteria 1214
236 Ga0496117_0184851 3300048920 Unclassified 1194
237 Ga0496118_0041825 3300048921 Bacteria 3623
238 Ga0496118_0157369 3300048921 Bacteria 1411
239 Ga0496119_0021206 3300048922 Bacteria 4705
240 Ga0496124_0103597 3300048927 Bacteria 2302
241 nmdc:mga03n38_21221_c1 3300050490 Bacteria 2610
242 nmdc:mga00v17_69671_c1 3300050491 Bacteria 2177
243 nmdc:mga0yw44_147090_c1 3300050492 Bacteria 1535
244 nmdc:mga0k408_229646_c1 3300050493 Bacteria 1108
245 nmdc:mga0sz30_126886_c1 3300050516 Bacteria 1123
246 Ga0500635_0000224 3300053080 Bacteria 25894
247 Ga0500635_0066715 3300053080 Bacteria 1268
248 Ga0500618_000019 3300053125 Bacteria 161916
249 Ga0500559_0058180 3300053136 Bacteria 1718
250 Ga0500568_0000010 3300053139 Bacteria 249043
251 Ga0500636_0073762 3300053177 Bacteria 1976
252 Ga0590071_003264 3300059421 Bacteria 3999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0620120 Ga0316582_0620120_47_649 195
2 3300028666 Ga0265336_10000014 Ga0265336_10000014114 205
3 3300029957 Ga0265324_10000660 Ga0265324_1000066020 205
4 3300003752 Ga0055539_1000234 Ga0055539_100023437 214
5 3300003756 Ga0055533_1000053 Ga0055533_1000053101 214
6 3300025226 Ga0209674_100039 Ga0209674_10003992 214
7 3300025230 Ga0209563_100080 Ga0209563_10008092 214
8 3300025253 Ga0209677_100086 Ga0209677_10008692 214
9 3300046794 Ga0495589_0034169 Ga0495589_0034169_803_1627 215
10 3300025932 Ga0207690_10038416 Ga0207690_100384162 217
11 iso_pu_bacteria 2977957713 2977957752 223
12 iso_pu_bacteria 2878788777 2878796483 229
13 iso_pu_bacteria 2965119406 2965124450 229
14 iso_pu_bacteria 2987673487 2987678737 229
15 3300003322 rootL2_10110999 rootL2_101109993 231
16 3300005577 Ga0068857_100850470 Ga0068857_1008504701 231
17 3300045051 Ga0451576_0169267 Ga0451576_0169267_1075_1770 231
18 3300005354 Ga0070675_100138097 Ga0070675_1001380972 232
19 3300005354 Ga0070675_100317680 Ga0070675_1003176802 232
20 3300005356 Ga0070674_100397085 Ga0070674_1003970852 232
21 3300005456 Ga0070678_100246383 Ga0070678_1002463832 232
22 3300005834 Ga0068851_10157939 Ga0068851_101579392 232
23 3300006358 Ga0068871_100172235 Ga0068871_1001722352 232
24 3300013308 Ga0157375_10267848 Ga0157375_102678482 232
25 3300014326 Ga0157380_10028639 Ga0157380_100286393 232
26 3300025893 Ga0207682_10030060 Ga0207682_100300602 232
27 3300025907 Ga0207645_10053298 Ga0207645_100532982 232
28 3300025920 Ga0207649_10111884 Ga0207649_101118843 232
29 3300025933 Ga0207706_10021234 Ga0207706_100212344 232
30 3300025933 Ga0207706_10302467 Ga0207706_103024672 232
31 3300025940 Ga0207691_10306334 Ga0207691_103063341 232
32 3300025945 Ga0207679_10148188 Ga0207679_101481882 232
33 3300026121 Ga0207683_10256043 Ga0207683_102560432 232
34 3300026121 Ga0207683_10506535 Ga0207683_105065351 232
35 3300035725 Ga0373947_0128023 Ga0373947_0128023_669_1394 232
36 3300046537 Ga0495598_0036283 Ga0495598_0036283_428_1150 232
37 3300048904 Ga0496101_0125112 Ga0496101_0125112_1106_1831 232
38 3300048907 Ga0496104_0112348 Ga0496104_0112348_1173_1898 232
39 iso_pu_bacteria 641228493 641336427 232
40 iso_pu_bacteria 643348555 643390250 232
41 3300031649 Ga0307514_10000762 Ga0307514_1000076240 233
42 3300036712 Ga0316584_0482668 Ga0316584_0482668_84_800 233
43 3300048905 Ga0496102_0005507 Ga0496102_0005507_4750_5460 233
44 3300059421 Ga0590071_003264 Ga0590071_003264_2163_2921 233
45 3300044683 Ga0466965_0007754 Ga0466965_0007754_933_1718 234
46 3300044765 Ga0466970_0057087 Ga0466970_0057087_48_833 234
47 3300044901 Ga0466960_0037992 Ga0466960_0037992_531_1316 234
48 3300047320 Ga0495672_0191371 Ga0495672_0191371_143_856 234
49 3300048905 Ga0496102_0338930 Ga0496102_0338930_401_1114 234
50 3300050493 nmdc:mga0k408_229646_c1 nmdc:mga0k408_229646_c1_52_768 234
51 3300005334 Ga0068869_100303713 Ga0068869_1003037133 235
52 3300005719 Ga0068861_100177031 Ga0068861_1001770312 235
53 3300005841 Ga0068863_100028960 Ga0068863_1000289602 235
54 3300005843 Ga0068860_100096343 Ga0068860_1000963431 235
55 3300009177 Ga0105248_10003379 Ga0105248_100033795 235
56 3300025899 Ga0207642_10175884 Ga0207642_101758842 235
57 3300025941 Ga0207711_10040793 Ga0207711_100407933 235
58 3300025942 Ga0207689_10317542 Ga0207689_103175421 235
59 3300026088 Ga0207641_10029792 Ga0207641_100297922 235
60 3300028381 Ga0268264_10092518 Ga0268264_100925182 235
61 3300048911 Ga0496108_0166320 Ga0496108_0166320_466_1203 235
62 3300003761 Ga0055535_1000146 Ga0055535_100014625 236
63 3300003763 Ga0055529_1000219 Ga0055529_100021941 236
64 3300005333 Ga0070677_10078863 Ga0070677_100788632 236
65 3300025242 Ga0209258_100072 Ga0209258_10007273 236
66 3300025272 Ga0209455_1000053 Ga0209455_1000053153 236
67 3300042876 Ga0451577_0814559 Ga0451577_0814559_84_803 236
68 3300046529 Ga0495652_0161537 Ga0495652_0161537_889_1647 236
69 3300002705 JGI25156J39149_1000411 JGI25156J39149_10004118 237
70 3300002705 JGI25156J39149_1000473 JGI25156J39149_100047318 237
71 3300002738 JGI25154J39366_1000848 JGI25154J39366_10008488 237
72 3300002741 JGI25157J39369_1000052 JGI25157J39369_100005272 237
73 3300002772 JGI25164J39214_1007894 JGI25164J39214_10078941 237
74 3300003320 rootH2_10010540 rootH2_100105402 237
75 3300003320 rootH2_10055848 rootH2_100558482 237
76 3300003322 rootL2_10111000 rootL2_101110002 237
77 3300003323 rootH1_10057961 rootH1_100579612 237
78 3300003752 Ga0055539_1002955 Ga0055539_10029552 237
79 3300003761 Ga0055535_1004731 Ga0055535_10047312 237
80 3300005328 Ga0070676_10296136 Ga0070676_102961361 237
81 3300005329 Ga0070683_100293699 Ga0070683_1002936992 237
82 3300005339 Ga0070660_100035902 Ga0070660_1000359024 237
83 3300005353 Ga0070669_100017766 Ga0070669_1000177664 237
84 3300005354 Ga0070675_100045677 Ga0070675_1000456772 237
85 3300005364 Ga0070673_100115239 Ga0070673_1001152392 237
86 3300005367 Ga0070667_100231988 Ga0070667_1002319881 237
87 3300005530 Ga0070679_100274526 Ga0070679_1002745261 237
88 3300005535 Ga0070684_100274790 Ga0070684_1002747902 237
89 3300005539 Ga0068853_100055820 Ga0068853_1000558204 237
90 3300005563 Ga0068855_100011228 Ga0068855_1000112288 237
91 3300005563 Ga0068855_100067765 Ga0068855_1000677654 237
92 3300005577 Ga0068857_100001102 Ga0068857_1000011026 237
93 3300005614 Ga0068856_100001785 Ga0068856_1000017853 237
94 3300005616 Ga0068852_100128961 Ga0068852_1001289613 237
95 3300005616 Ga0068852_100165540 Ga0068852_1001655401 237
96 3300005719 Ga0068861_100037619 Ga0068861_1000376192 237
97 3300009093 Ga0105240_10009318 Ga0105240_100093183 237
98 3300009093 Ga0105240_10072414 Ga0105240_100724142 237
99 3300009093 Ga0105240_10100601 Ga0105240_101006014 237
100 3300009148 Ga0105243_10889482 Ga0105243_108894821 237
101 3300009545 Ga0105237_10000739 Ga0105237_100007394 237
102 3300009545 Ga0105237_10625409 Ga0105237_106254092 237
103 3300009551 Ga0105238_10005732 Ga0105238_1000573211 237
104 3300009551 Ga0105238_10345852 Ga0105238_103458521 237
105 3300010375 Ga0105239_10000344 Ga0105239_100003449 237
106 3300013297 Ga0157378_10231629 Ga0157378_102316293 237
107 3300025231 Ga0207427_100466 Ga0207427_10046613 237
108 3300025242 Ga0209258_100222 Ga0209258_10022259 237
109 3300025246 Ga0209646_1000076 Ga0209646_100007672 237
110 3300025250 Ga0209026_1000011 Ga0209026_1000011256 237
111 3300025253 Ga0209677_100399 Ga0209677_10039922 237
112 3300025256 Ga0209759_1000034 Ga0209759_1000034220 237
113 3300025256 Ga0209759_1010855 Ga0209759_10108553 237
114 3300025303 Ga0209051_1045142 Ga0209051_10451422 237
115 3300025913 Ga0207695_10017975 Ga0207695_100179753 237
116 3300025913 Ga0207695_10073403 Ga0207695_100734032 237
117 3300025914 Ga0207671_10001929 Ga0207671_100019292 237
118 3300025914 Ga0207671_10043926 Ga0207671_100439263 237
119 3300025924 Ga0207694_10020998 Ga0207694_100209985 237
120 3300025926 Ga0207659_10104851 Ga0207659_101048512 237
121 3300025940 Ga0207691_10033521 Ga0207691_100335212 237
122 3300025942 Ga0207689_10004890 Ga0207689_100048903 237
123 3300025949 Ga0207667_10004373 Ga0207667_1000437314 237
124 3300025949 Ga0207667_10149384 Ga0207667_101493842 237
125 3300025960 Ga0207651_10032046 Ga0207651_100320463 237
126 3300025972 Ga0207668_10066835 Ga0207668_100668353 237
127 3300025986 Ga0207658_10035351 Ga0207658_100353512 237
128 3300026041 Ga0207639_10342817 Ga0207639_103428172 237
129 3300026078 Ga0207702_10000392 Ga0207702_1000039218 237
130 3300026116 Ga0207674_10007715 Ga0207674_1000771510 237
131 3300026118 Ga0207675_100023901 Ga0207675_1000239014 237
132 3300026121 Ga0207683_10162722 Ga0207683_101627223 237
133 3300026142 Ga0207698_10082223 Ga0207698_100822232 237
134 3300031616 Ga0307508_10019330 Ga0307508_100193303 237
135 3300044656 Ga0466969_0000093 Ga0466969_0000093_18074_18826 237
136 3300044694 Ga0466963_0148028 Ga0466963_0148028_599_1408 237
137 3300046506 Ga0495583_0000258 Ga0495583_0000258_44117_44941 237
138 3300046507 Ga0495606_0002471 Ga0495606_0002471_19200_20024 237
139 3300046539 Ga0495621_0011386 Ga0495621_0011386_1916_2650 237
140 3300046539 Ga0495621_0023015 Ga0495621_0023015_50_784 237
141 3300046660 Ga0495625_0042104 Ga0495625_0042104_1807_2631 237
142 3300046692 Ga0495671_0079162 Ga0495671_0079162_345_1169 237
143 3300046694 Ga0495649_0001667 Ga0495649_0001667_12434_13258 237
144 3300048912 Ga0496109_0665428 Ga0496109_0665428_16_798 237
145 3300048921 Ga0496118_0041825 Ga0496118_0041825_1134_1865 237
146 3300053080 Ga0500635_0066715 Ga0500635_0066715_26_850 237
147 3300053125 Ga0500618_000019 Ga0500618_000019_86215_86940 237
148 3300053177 Ga0500636_0073762 Ga0500636_0073762_466_1290 237
149 iso_pu_bacteria 2909399089 2909402934 237
150 3300005327 Ga0070658_10099588 Ga0070658_100995883 238
151 3300005339 Ga0070660_100066559 Ga0070660_1000665592 238
152 3300005539 Ga0068853_100263337 Ga0068853_1002633372 238
153 3300005563 Ga0068855_100105875 Ga0068855_1001058752 238
154 3300005563 Ga0068855_100629946 Ga0068855_1006299461 238
155 3300009093 Ga0105240_10446453 Ga0105240_104464531 238
156 3300025253 Ga0209677_101600 Ga0209677_1016007 238
157 3300025256 Ga0209759_1000814 Ga0209759_100081416 238
158 3300025909 Ga0207705_10040729 Ga0207705_100407293 238
159 3300025909 Ga0207705_10125798 Ga0207705_101257983 238
160 3300025909 Ga0207705_10168391 Ga0207705_101683911 238
161 3300025919 Ga0207657_10045919 Ga0207657_100459192 238
162 3300025949 Ga0207667_10062306 Ga0207667_100623065 238
163 3300025949 Ga0207667_10081378 Ga0207667_100813784 238
164 3300025960 Ga0207651_10006671 Ga0207651_100066713 238
165 3300031730 Ga0307516_10000703 Ga0307516_100007035 238
166 3300037471 Ga0395905_0307965 Ga0395905_0307965_595_1326 238
167 3300038443 Ga0395901_0156658 Ga0395901_0156658_1643_2374 238
168 3300044656 Ga0466969_0006126 Ga0466969_0006126_4077_4889 238
169 3300044683 Ga0466965_0016928 Ga0466965_0016928_1380_2192 238
170 3300044706 Ga0466964_0015017 Ga0466964_0015017_1372_2184 238
171 3300044719 Ga0466971_0007565 Ga0466971_0007565_1374_2186 238
172 3300044765 Ga0466970_0047259 Ga0466970_0047259_573_1385 238
173 3300044842 Ga0466957_0004905 Ga0466957_0004905_2285_3097 238
174 3300045049 Ga0466959_0036027 Ga0466959_0036027_2395_3207 238
175 3300045836 Ga0466958_0148217 Ga0466958_0148217_75_887 238
176 3300053080 Ga0500635_0000224 Ga0500635_0000224_23111_23947 238
177 3300053136 Ga0500559_0058180 Ga0500559_0058180_217_1053 238
178 iso_pu_bacteria 2508501127 2509142017 238
179 iso_pu_bacteria 2509276033 2509444850 238
180 iso_pu_bacteria 2643221599 2644004929 238
181 iso_pu_bacteria 2871435913 2871443591 238
182 3300003323 rootH1_10167436 rootH1_101674361 239
183 3300003792 Ga0055540_1008395 Ga0055540_10083952 239
184 3300009148 Ga0105243_10037447 Ga0105243_100374473 239
185 3300009176 Ga0105242_10111628 Ga0105242_101116283 239
186 3300025303 Ga0209051_1001170 Ga0209051_100117010 239
187 3300025303 Ga0209051_1014638 Ga0209051_10146383 239
188 3300025935 Ga0207709_10036361 Ga0207709_100363612 239
189 3300026142 Ga0207698_10437767 Ga0207698_104377671 239
190 3300031507 Ga0307509_10053043 Ga0307509_100530433 239
191 3300031911 Ga0307412_10098717 Ga0307412_100987172 239
192 3300035691 Ga0373931_0002334 Ga0373931_0002334_590_1438 239
193 3300035691 Ga0373931_0367128 Ga0373931_0367128_27_875 239
194 3300039447 Ga0436361_0461509 Ga0436361_0461509_8022_8855 239
195 3300039447 Ga0436361_1125410 Ga0436361_1125410_3072_3905 239
196 3300044901 Ga0466960_0096435 Ga0466960_0096435_574_1356 239
197 3300046616 Ga0495668_0144100 Ga0495668_0144100_53_901 239
198 3300048907 Ga0496104_0052689 Ga0496104_0052689_366_1214 239
199 iso_pu_bacteria 2503198000 2503204009 239
200 iso_pu_bacteria 2508501123 2509117295 239
201 iso_pu_bacteria 2509276018 2509371342 239
202 iso_pu_bacteria 2509276022 2509398341 239
203 iso_pu_bacteria 2510065059 2510315945 239
204 iso_pu_bacteria 2512875016 2512929206 239
205 iso_pu_bacteria 2512875024 2512963994 239
206 iso_pu_bacteria 2513237164 2514035905 239
207 iso_pu_bacteria 2522572158 2523107704 239
208 iso_pu_bacteria 2588253730 2588514746 239
209 iso_pu_bacteria 2599185301 2599937357 239
210 iso_pu_bacteria 2643221595 2643987781 239
211 iso_pu_bacteria 2643221627 2644156606 239
212 iso_pu_bacteria 2687453392 2688597999 239
213 iso_pu_bacteria 2756170246 2756672062 239
214 iso_pu_bacteria 2775506902 2776272964 239
215 iso_pu_bacteria 2775506904 2776282192 239
216 iso_pu_bacteria 2821443989 2821445327 239
217 iso_pu_bacteria 2839993093 2839996032 239
218 iso_pu_bacteria 2841734538 2841734885 239
219 iso_pu_bacteria 2844002411 2844007990 239
220 iso_pu_bacteria 2844009547 2844013216 239
221 iso_pu_bacteria 2847670302 2847672748 239
222 iso_pu_bacteria 2856314179 2856314699 239
223 iso_pu_bacteria 2856320880 2856326272 239
224 iso_pu_bacteria 2856328259 2856333708 239
225 iso_pu_bacteria 2856334872 2856338098 239
226 iso_pu_bacteria 2857349434 2857355263 239
227 iso_pu_bacteria 2869169390 2869171749 239
228 iso_pu_bacteria 2869234852 2869241715 239
229 iso_pu_bacteria 2869242130 2869249069 239
230 iso_pu_bacteria 2869249662 2869255902 239
231 iso_pu_bacteria 2869256925 2869261258 239
232 iso_pu_bacteria 2869264136 2869268374 239
233 iso_pu_bacteria 2869271264 2869275078 239
234 iso_pu_bacteria 2869278585 2869284105 239
235 iso_pu_bacteria 2871466892 2871473234 239
236 iso_pu_bacteria 2871474448 2871477288 239
237 iso_pu_bacteria 2871481445 2871483079 239
238 iso_pu_bacteria 2874116593 2874122168 239
239 iso_pu_bacteria 2874131515 2874138991 239
240 iso_pu_bacteria 2874139085 2874144724 239
241 iso_pu_bacteria 2874162495 2874165090 239
242 iso_pu_bacteria 2876363079 2876367238 239
243 iso_pu_bacteria 2876386047 2876391541 239
244 iso_pu_bacteria 2876399893 2876404969 239
245 iso_pu_bacteria 2876406927 2876409227 239
246 iso_pu_bacteria 2876420981 2876423046 239
247 iso_pu_bacteria 2878035449 2878036220 239
248 iso_pu_bacteria 2878738818 2878743901 239
249 iso_pu_bacteria 2878774303 2878776641 239
250 iso_pu_bacteria 2881147464 2881150186 239
251 iso_pu_bacteria 2888337043 2888342149 239
252 iso_pu_bacteria 2888350351 2888357301 239
253 iso_pu_bacteria 2889010040 2889012255 239
254 iso_pu_bacteria 2889016732 2889022853 239
255 iso_pu_bacteria 2903448605 2903453293 239
256 iso_pu_bacteria 2903513507 2903515194 239
257 iso_pu_bacteria 2903521522 2903526729 239
258 iso_pu_bacteria 2903528002 2903530652 239
259 iso_pu_bacteria 2906354277 2906360226 239
260 iso_pu_bacteria 2906363423 2906367921 239
261 iso_pu_bacteria 2906370794 2906376121 239
262 iso_pu_bacteria 2906393657 2906400078 239
263 iso_pu_bacteria 2906401398 2906404004 239
264 iso_pu_bacteria 2906408224 2906413645 239
265 iso_pu_bacteria 2906414383 2906414888 239
266 iso_pu_bacteria 2906427513 2906429218 239
267 iso_pu_bacteria 2920760137 2920766739 239
268 iso_pu_bacteria 2922130491 2922135748 239
269 iso_pu_bacteria 2922172374 2922175115 239
270 iso_pu_bacteria 2922178524 2922184267 239
271 iso_pu_bacteria 2922185730 2922188316 239
272 iso_pu_bacteria 2924710171 2924716081 239
273 iso_pu_bacteria 2924718760 2924722981 239
274 iso_pu_bacteria 2924733363 2924734895 239
275 iso_pu_bacteria 2924741084 2924742023 239
276 iso_pu_bacteria 2924748358 2924750035 239
277 iso_pu_bacteria 2924776078 2924781818 239
278 iso_pu_bacteria 2937836603 2937838464 239
279 iso_pu_bacteria 2937848649 2937850235 239
280 iso_pu_bacteria 2937861824 2937868910 239
281 iso_pu_bacteria 2937868953 2937873297 239
282 iso_pu_bacteria 2937877337 2937884853 239
283 iso_pu_bacteria 2937972304 2937978126 239
284 iso_pu_bacteria 2958034702 2958040494 239
285 iso_pu_bacteria 2958041894 2958055342 239
286 iso_pu_bacteria 2958064165 2958068322 239
287 iso_pu_bacteria 2958071322 2958074680 239
288 iso_pu_bacteria 2958084443 2958092162 239
289 iso_pu_bacteria 2958092219 2958094221 239
290 iso_pu_bacteria 2958100919 2958105693 239
291 iso_pu_bacteria 2958108152 2958113829 239
292 iso_pu_bacteria 2958122699 2958130050 239
293 iso_pu_bacteria 2958144490 2958149235 239
294 iso_pu_bacteria 2958158011 2958159187 239
295 iso_pu_bacteria 2958172287 2958178816 239
296 iso_pu_bacteria 2961136820 2961139842 239
297 iso_pu_bacteria 2961183825 2961185544 239
298 iso_pu_bacteria 2963644680 2963650031 239
299 iso_pu_bacteria 2965025482 2965026001 239
300 iso_pu_bacteria 2965032056 2965036399 239
301 iso_pu_bacteria 2965040258 2965043493 239
302 iso_pu_bacteria 2965047637 2965054383 239
303 iso_pu_bacteria 2965102966 2965109240 239
304 iso_pu_bacteria 2968016561 2968021880 239
305 iso_pu_bacteria 2968083720 2968086658 239
306 iso_pu_bacteria 2968117919 2968123615 239
307 iso_pu_bacteria 2970469710 2970474470 239
308 iso_pu_bacteria 2970489779 2970493323 239
309 iso_pu_bacteria 2970510686 2970517638 239
310 iso_pu_bacteria 2970532167 2970538073 239
311 iso_pu_bacteria 2970547951 2970551695 239
312 iso_pu_bacteria 2970593180 2970598717 239
313 iso_pu_bacteria 2970619444 2970623234 239
314 iso_pu_bacteria 2977851361 2977854860 239
315 iso_pu_bacteria 2977864932 2977867966 239
316 iso_pu_bacteria 2977872689 2977874913 239
317 iso_pu_bacteria 2977915119 2977918304 239
318 iso_pu_bacteria 2977922695 2977923168 239
319 iso_pu_bacteria 2977935797 2977936585 239
320 iso_pu_bacteria 2977942078 2977948808 239
321 iso_pu_bacteria 2977950692 2977950772 239
322 iso_pu_bacteria 2977971508 2977977906 239
323 iso_pu_bacteria 2977986579 2977988909 239
324 iso_pu_bacteria 2979710463 2979711022 239
325 iso_pu_bacteria 2979742915 2979743781 239
326 iso_pu_bacteria 2979764755 2979771899 239
327 iso_pu_bacteria 2979772303 2979776653 239
328 iso_pu_bacteria 2987636660 2987640396 239
329 iso_pu_bacteria 2987645492 2987650390 239
330 iso_pu_bacteria 2987652177 2987656231 239
331 iso_pu_bacteria 2996348954 2996353879 239
332 iso_pu_bacteria 2996386984 2996388873 239
333 iso_pu_bacteria 3004167301 3004168273 239
334 iso_pu_bacteria 3004195979 3004199725 239
335 iso_pu_bacteria 3004203850 3004208594 239
336 iso_pu_bacteria 3004211236 3004213539 239
337 iso_pu_bacteria 3004218560 3004223130 239
338 iso_pu_bacteria 3004232784 3004239381 239
339 iso_pu_bacteria 3004239961 3004243295 239
340 iso_pu_bacteria 3004268573 3004268770 239
341 iso_pu_bacteria 3004275668 3004280547 239
342 iso_pu_bacteria 3004289098 3004289386 239
343 iso_pu_bacteria 3004334049 3004338690 239
344 iso_pu_bacteria 637000159 637078963 239
345 iso_pu_bacteria 649633066 649872531 239
346 iso_pu_bacteria 8004300914 8004302915 239
347 iso_pu_bacteria 8004312739 8004319009 239
348 iso_pu_bacteria 8004361976 8004368179 239
349 iso_pu_bacteria 8004633249 8004640161 239
350 iso_pu_bacteria 8004640170 8004642823 239
351 iso_pu_bacteria 8054558443 8054560451 239
352 iso_pu_bacteria 2597489875 2597815969 240
353 iso_pu_bacteria 2856342000 2856346381 240
354 3300031727 Ga0316576_10202180 Ga0316576_102021802 241
355 3300048920 Ga0496117_0184851 Ga0496117_0184851_275_1000 241
356 3300041460 Ga0451802_1139503 Ga0451802_1139503_131_886 242
357 3300001989 JGI24739J22299_10033080 JGI24739J22299_100330802 243
358 3300003187 JGI25151J46595_10000149 JGI25151J46595_1000014957 243
359 3300003762 Ga0055542_1000068 Ga0055542_1000068130 243
360 3300003762 Ga0055542_1000585 Ga0055542_10005858 243
361 3300005539 Ga0068853_100539176 Ga0068853_1005391761 243
362 3300005563 Ga0068855_100306523 Ga0068855_1003065232 243
363 3300005614 Ga0068856_100429218 Ga0068856_1004292182 243
364 3300006038 Ga0075365_10267882 Ga0075365_102678822 243
365 3300006048 Ga0075363_100022662 Ga0075363_1000226622 243
366 3300006051 Ga0075364_10109280 Ga0075364_101092802 243
367 3300006178 Ga0075367_10111718 Ga0075367_101117182 243
368 3300006186 Ga0075369_10051221 Ga0075369_100512212 243
369 3300006353 Ga0075370_10138091 Ga0075370_101380912 243
370 3300009093 Ga0105240_10199107 Ga0105240_101991072 243
371 3300009545 Ga0105237_10074371 Ga0105237_100743712 243
372 3300009986 Ga0105033_100756 Ga0105033_1007562 243
373 3300010375 Ga0105239_10045636 Ga0105239_100456364 243
374 3300010375 Ga0105239_10143127 Ga0105239_101431273 243
375 3300010375 Ga0105239_10333917 Ga0105239_103339172 243
376 3300013296 Ga0157374_10103101 Ga0157374_101031012 243
377 3300013307 Ga0157372_10446130 Ga0157372_104461302 243
378 3300014968 Ga0157379_10336502 Ga0157379_103365021 243
379 3300021361 Ga0213872_10035836 Ga0213872_100358362 243
380 3300025254 Ga0209148_1000078 Ga0209148_100007830 243
381 3300025261 Ga0209233_1012751 Ga0209233_10127512 243
382 3300025272 Ga0209455_1000131 Ga0209455_100013174 243
383 3300025284 Ga0209130_1000313 Ga0209130_100031320 243
384 3300025294 Ga0209025_1000099 Ga0209025_1000099168 243
385 3300025297 Ga0209758_1002213 Ga0209758_10022138 243
386 3300025297 Ga0209758_1009792 Ga0209758_10097926 243
387 3300025302 Ga0207426_1000065 Ga0207426_1000065291 243
388 3300025904 Ga0207647_10015189 Ga0207647_100151892 243
389 3300025904 Ga0207647_10053874 Ga0207647_100538742 243
390 3300025913 Ga0207695_10777339 Ga0207695_107773391 243
391 3300025919 Ga0207657_10019777 Ga0207657_100197775 243
392 3300025938 Ga0207704_10207706 Ga0207704_102077062 243
393 3300026067 Ga0207678_10151239 Ga0207678_101512392 243
394 3300026078 Ga0207702_10383994 Ga0207702_103839942 243
395 3300026116 Ga0207674_10508789 Ga0207674_105087891 243
396 3300031911 Ga0307412_10409932 Ga0307412_104099322 243
397 3300037466 Ga0395898_0246247 Ga0395898_0246247_705_1436 243
398 3300039093 Ga0400489_83698 Ga0400489_83698_24362_25138 243
399 3300039447 Ga0436361_0802214 Ga0436361_0802214_916_1671 243
400 3300044658 Ga0466972_0037373 Ga0466972_0037373_205_936 243
401 3300044901 Ga0466960_0094259 Ga0466960_0094259_664_1395 243
402 3300046501 Ga0495607_0209912 Ga0495607_0209912_11_742 243
403 3300046506 Ga0495583_0002421 Ga0495583_0002421_5403_6158 243
404 3300046512 Ga0495610_0001443 Ga0495610_0001443_9594_10349 243
405 3300046512 Ga0495610_0025070 Ga0495610_0025070_1281_2030 243
406 3300046558 Ga0495633_0133065 Ga0495633_0133065_266_997 243
407 3300046616 Ga0495668_0032773 Ga0495668_0032773_1617_2384 243
408 3300046694 Ga0495649_0186167 Ga0495649_0186167_12_761 243
409 3300048090 Ga0495615_0038014 Ga0495615_0038014_438_1169 243
410 3300048915 Ga0496112_0457471 Ga0496112_0457471_231_962 243
411 3300048921 Ga0496118_0157369 Ga0496118_0157369_111_878 243
412 3300048922 Ga0496119_0021206 Ga0496119_0021206_980_1711 243
413 3300048927 Ga0496124_0103597 Ga0496124_0103597_321_1076 243
414 3300050490 nmdc:mga03n38_21221_c1 nmdc:mga03n38_21221_c1_836_1567 243
415 3300050491 nmdc:mga00v17_69671_c1 nmdc:mga00v17_69671_c1_1394_2125 243
416 3300050492 nmdc:mga0yw44_147090_c1 nmdc:mga0yw44_147090_c1_687_1418 243
417 3300050516 nmdc:mga0sz30_126886_c1 nmdc:mga0sz30_126886_c1_12_743 243
418 3300053139 Ga0500568_0000010 Ga0500568_0000010_213458_214228 243
419 iso_pu_bacteria 2643221607 2644048748 243
420 iso_pu_bacteria 2643221636 2644201929 243
421 iso_pu_bacteria 2643221686 2644481550 243
422 iso_pu_bacteria 2844533157 2844540180 243
423 iso_pu_bacteria 2854911287 2854916626 243
424 iso_pu_bacteria 2915650412 2915652502 243
425 iso_pu_bacteria 2937843397 2937845474 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07702

UTRA

UTRA domain

138

275

0.99

PF00392

GntR

Bacterial regulatory proteins, gntR family

54

117

0.98

PF08220

HTH_DeoR

DeoR-like helix-turn-helix domain

76

119

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pkh-assembly1.cif.gz_B structural genomics, the crystal structure of the c-terminal domain of histidine utilization repressor from pseudomonas syringae pv. tomato str. dc3000 0.9565 99 238
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9497 6 75
2pkh-assembly1.cif.gz_B structural genomics, the crystal structure of the c-terminal domain of histidine utilization repressor from pseudomonas syringae pv. tomato str. dc3000 0.937 99 238
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9369 6 75
4p9u-assembly1.cif.gz_F fadr, fatty acid responsive transcription factor from vibrio cholerae, in complex with dna 0.9154 9 77
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9834 32 74 1.10.10.10
af_Q2FZ17_2_72_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9812 11 75 1.10.10.10
af_P45544_5_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9747 11 78 1.10.10.10
af_P13669_2_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9643 8 78 1.10.10.10
2wv0G01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9585 9 78 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A379VVD0-F1-model_v4 Histidine utilization repressor 0.9719 134 237 GO:0003677
GO:0006355
AF-A0A528AYJ6-F1-model_v4 UTRA domain-containing protein 0.9606 125 216 GO:0003677
GO:0006355
AF-A0A528AYJ6-F1-model_v4 UTRA domain-containing protein 0.9506 125 216 GO:0003677
GO:0006355
AF-A0A7X6IKB2-F1-model_v4 deleted 0.9407 141 243
AF-A0A379VVD0-F1-model_v4 Histidine utilization repressor 0.9367 134 237 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
86.57 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map