F440993

General Info

Members Datasets Scaffolds Average Seq Length
425 256 850 285

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10000499|Ga0307517_1000049946
Length 314
Sequence MRAGLGAARRSARMRLSQSQLHTSATMTADILLQTLASGVLIGLIYALVAIGLTMIFGVMDIVNFAHGEFLMLGMYSAFWLFALYALDPLLTLPLTVLMLFAFGMLLYKFVIKRIVAAPMLSQIFTTFGLMILMRGVAQFLWKPDFRSIENSWVAGSVKLAGIQLGRPQLVAGLGAVVITAVIHAFLTRTRLGAALEATAADKEAAQLMGIDSHRMFSLAWGIGAACAGAAGVLLATFFPIFPEVGANFILIAFVVVNLGGFGSITGAFWAGILVGVIEVMGGLLLGPQYKTAIVLVLFLAVLMFRPQGLMGKA

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
152 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
221 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
240 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
241 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
242 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
243 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
244 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
245 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
246 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
247 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
248 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
249 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
250 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
251 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
252 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
253 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
254 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
255 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
256 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.35
Metatranscriptomes 1.18
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.41
Nodule 0.47
Rhizoplane 2.12
Rhizosphere 51.29
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10000499 3300028786 Bacteria 67326
2 JGI25155J39150_1000071 3300002704 Bacteria 64384
3 JGI25155J39150_1001038 3300002704 Bacteria 2962
4 JGI25155J39150_1001040 3300002704 Bacteria 2949
5 JGI25156J39149_1000071 3300002705 Bacteria 80446
6 JGI25156J39149_1000097 3300002705 Bacteria 64372
7 JGI25156J39149_1000158 3300002705 Bacteria 49923
8 JGI25156J39149_1000164 3300002705 Bacteria 48491
9 JGI25154J39366_1000074 3300002738 Bacteria 92481
10 JGI25154J39366_1000093 3300002738 Bacteria 80476
11 JGI25154J39366_1000114 3300002738 Bacteria 68169
12 JGI25154J39366_1000175 3300002738 Bacteria 49923
13 JGI25157J39369_1000088 3300002741 Bacteria 80446
14 JGI25157J39369_1000335 3300002741 Bacteria 33363
15 JGI25152J39213_1002477 3300002773 Bacteria 6992
16 JGI25150J39212_1001573 3300002774 Bacteria 6238
17 JGI25150J39212_1005268 3300002774 Bacteria 2780
18 JGI25151J46595_10028342 3300003187 Bacteria 2231
19 JGI25406J46586_10018750 3300003203 Bacteria 2838
20 JGI25153J46596_10002270 3300003215 Bacteria 11209
21 JGI25153J46596_10003693 3300003215 Bacteria 8459
22 rootH1_10034432 3300003316 Bacteria 2455
23 rootL2_10064870 3300003322 Unclassified 12348
24 rootH1_10187990 3300003323 Bacteria 1412
25 JGI25161J50226_1000008 3300003374 Bacteria 239245
26 Ga0055532_1000080 3300003758 Bacteria 120879
27 Ga0055535_1000056 3300003761 Bacteria 128204
28 Ga0055529_1000165 3300003763 Bacteria 91442
29 Ga0055526_1002150 3300003771 Bacteria 13519
30 Ga0055537_1000396 3300003773 Bacteria 29249
31 Ga0055537_1001718 3300003773 Bacteria 8086
32 Ga0055537_1003139 3300003773 Bacteria 5179
33 Ga0055524_1000027 3300003775 Bacteria 213655
34 Ga0055524_1000057 3300003775 Bacteria 139566
35 Ga0055524_1000126 3300003775 Bacteria 89985
36 Ga0055534_1003430 3300003784 Bacteria 4981
37 Ga0055528_1001958 3300003790 Bacteria 11629
38 Ga0055530_10001122 3300003791 Bacteria 20929
39 Ga0055540_1000021 3300003792 Bacteria 208733
40 Ga0055540_1000158 3300003792 Bacteria 67050
41 Ga0055531_10011209 3300003794 Bacteria 4355
42 Ga0055543_1001180 3300004625 Bacteria 11030
43 Ga0065165_1000832 3300005262 Bacteria 40569
44 Ga0070676_10038324 3300005328 Bacteria 2768
45 Ga0068869_100072074 3300005334 Bacteria 2559
46 Ga0068869_100130708 3300005334 Bacteria 1930
47 Ga0068869_100277156 3300005334 Bacteria 1348
48 Ga0068868_100008596 3300005338 Bacteria 7314
49 Ga0070660_100357674 3300005339 Bacteria 1203
50 Ga0070661_100000893 3300005344 Bacteria 21405
51 Ga0070675_100009253 3300005354 Bacteria 7654
52 Ga0070673_100090362 3300005364 Bacteria 2501
53 Ga0070659_100004831 3300005366 Bacteria 9631
54 Ga0070667_100018165 3300005367 Bacteria 5831
55 Ga0070708_100292493 3300005445 Bacteria 1534
56 Ga0070663_100179920 3300005455 Bacteria 1639
57 Ga0070662_100000931 3300005457 Bacteria 17917
58 Ga0068867_100000018 3300005459 Bacteria 102056
59 Ga0068867_100039164 3300005459 Bacteria 3454
60 Ga0070706_100200318 3300005467 Bacteria 1865
61 Ga0070707_100028426 3300005468 Bacteria 5322
62 Ga0070698_100167531 3300005471 Bacteria 2139
63 Ga0070699_100026610 3300005518 Bacteria 4988
64 Ga0068853_100124098 3300005539 Bacteria 2306
65 Ga0068853_100446629 3300005539 Bacteria 1216
66 Ga0070672_100009637 3300005543 Bacteria 6666
67 Ga0070664_100002509 3300005564 Bacteria 14796
68 Ga0068854_100064150 3300005578 Bacteria 2668
69 Ga0068852_100415650 3300005616 Bacteria 1326
70 Ga0068859_100220432 3300005617 Bacteria 1984
71 Ga0068859_100286021 3300005617 Bacteria 1742
72 Ga0068863_100136469 3300005841 Bacteria 2344
73 Ga0075365_10047747 3300006038 Bacteria 2815
74 Ga0075432_10007418 3300006058 Bacteria 3735
75 Ga0075362_10060455 3300006177 Bacteria 1713
76 Ga0075367_10031974 3300006178 Bacteria 3025
77 Ga0075369_10015642 3300006186 Bacteria 3049
78 Ga0075366_10010676 3300006195 Bacteria 5162
79 Ga0075366_10030936 3300006195 Bacteria 3148
80 Ga0075366_10100189 3300006195 Bacteria 1738
81 Ga0075366_10120157 3300006195 Bacteria 1583
82 Ga0075370_10001985 3300006353 Bacteria 9273
83 Ga0075370_10032940 3300006353 Bacteria 2899
84 Ga0075370_10058515 3300006353 Bacteria 2192
85 Ga0068865_100076057 3300006881 Bacteria 2395
86 Ga0097620_100220433 3300006931 Bacteria 1984
87 Ga0097620_100286009 3300006931 Bacteria 1742
88 Ga0079104_1004958 3300006946 Bacteria 5482
89 Ga0099794_10000585 3300007265 Bacteria 12212
90 Ga0105240_10000809 3300009093 Bacteria 56801
91 Ga0105240_10010334 3300009093 Bacteria 13132
92 Ga0105240_10466162 3300009093 Bacteria 1410
93 Ga0114129_10030937 3300009147 Bacteria 7570
94 Ga0105237_10019131 3300009545 Bacteria 7076
95 Ga0105237_10092376 3300009545 Bacteria 3016
96 Ga0105239_10085774 3300010375 Bacteria 3471
97 Ga0157370_10219142 3300013104 Bacteria 1763
98 Ga0157374_10428917 3300013296 Bacteria 1322
99 Ga0157375_10982477 3300013308 Bacteria 985
100 Ga0157377_10000051 3300014745 Bacteria 90204
101 Ga0157376_10035575 3300014969 Bacteria 4029
102 Ga0213876_10084199 3300021384 Bacteria 1683
103 Ga0209435_100014 3300025206 Bacteria 322129
104 Ga0209435_100018 3300025206 Bacteria 274625
105 Ga0209435_100138 3300025206 Bacteria 24452
106 Ga0209147_100051 3300025229 Bacteria 274605
107 Ga0209437_100145 3300025233 Bacteria 163138
108 Ga0209258_100071 3300025242 Bacteria 278319
109 Ga0209258_100244 3300025242 Bacteria 100255
110 Ga0207425_1000565 3300025245 Bacteria 21780
111 Ga0207425_1000985 3300025245 Bacteria 13396
112 Ga0207425_1013362 3300025245 Bacteria 1900
113 Ga0209646_1000001 3300025246 Bacteria 3092932
114 Ga0209646_1000081 3300025246 Bacteria 201708
115 Ga0209646_1000090 3300025246 Bacteria 189912
116 Ga0209026_1000042 3300025250 Bacteria 273111
117 Ga0209026_1000073 3300025250 Bacteria 205399
118 Ga0209759_1000013 3300025256 Bacteria 399300
119 Ga0209759_1000098 3300025256 Bacteria 157516
120 Ga0209759_1000109 3300025256 Bacteria 145042
121 Ga0209759_1000936 3300025256 Bacteria 21031
122 Ga0209129_1000075 3300025258 Bacteria 201273
123 Ga0209565_1000028 3300025263 Bacteria 348536
124 Ga0209565_1000573 3300025263 Bacteria 24963
125 Ga0209565_1003942 3300025263 Bacteria 4647
126 Ga0209455_1000030 3300025272 Bacteria 533479
127 Ga0209673_1000035 3300025273 Bacteria 328411
128 Ga0209673_1011820 3300025273 Bacteria 3568
129 Ga0209130_1000052 3300025284 Bacteria 216971
130 Ga0209130_1000112 3300025284 Bacteria 131607
131 Ga0209675_1001106 3300025291 Bacteria 16496
132 Ga0209675_1002301 3300025291 Bacteria 9912
133 Ga0209676_1000069 3300025292 Bacteria 312462
134 Ga0209025_1003111 3300025294 Bacteria 16264
135 Ga0209025_1004613 3300025294 Bacteria 11788
136 Ga0209564_1000046 3300025295 Bacteria 373787
137 Ga0209564_1001926 3300025295 Bacteria 18526
138 Ga0209564_1006337 3300025295 Bacteria 6418
139 Ga0209564_1016344 3300025295 Bacteria 2960
140 Ga0209758_1000045 3300025297 Bacteria 369174
141 Ga0209758_1000052 3300025297 Bacteria 338962
142 Ga0209758_1027330 3300025297 Bacteria 2441
143 Ga0209050_1000023 3300025298 Bacteria 537172
144 Ga0209050_1000257 3300025298 Bacteria 114186
145 Ga0209256_1000003 3300025299 Bacteria 1661127
146 Ga0209256_1000013 3300025299 Bacteria 689442
147 Ga0209256_1041354 3300025299 Bacteria 1172
148 Ga0207426_1000153 3300025302 Bacteria 182839
149 Ga0207426_1001955 3300025302 Bacteria 14690
150 Ga0209051_1000017 3300025303 Bacteria 537172
151 Ga0209051_1003673 3300025303 Bacteria 9927
152 Ga0209051_1014608 3300025303 Bacteria 3653
153 Ga0209257_1000041 3300025304 Bacteria 537172
154 Ga0209257_1037589 3300025304 Bacteria 1475
155 Ga0207645_10001304 3300025907 Bacteria 20534
156 Ga0207643_10049532 3300025908 Bacteria 2381
157 Ga0207684_10053387 3300025910 Bacteria 3431
158 Ga0207684_10117336 3300025910 Bacteria 2280
159 Ga0207695_10001196 3300025913 Bacteria 44626
160 Ga0207695_10008186 3300025913 Bacteria 13134
161 Ga0207671_10075206 3300025914 Bacteria 2525
162 Ga0207671_10102742 3300025914 Bacteria 2167
163 Ga0207649_10010603 3300025920 Bacteria 5067
164 Ga0207646_10004092 3300025922 Bacteria 16064
165 Ga0207690_10371180 3300025932 Bacteria 1135
166 Ga0207706_10001218 3300025933 Bacteria 26011
167 Ga0207706_10131411 3300025933 Bacteria 2202
168 Ga0207704_10055589 3300025938 Bacteria 2420
169 Ga0207691_10006518 3300025940 Bacteria 11267
170 Ga0207689_10044923 3300025942 Bacteria 3654
171 Ga0207679_10000056 3300025945 Bacteria 108254
172 Ga0207667_10007680 3300025949 Bacteria 12908
173 Ga0207667_10171707 3300025949 Bacteria 2228
174 Ga0207651_10126443 3300025960 Bacteria 1948
175 Ga0207640_10014346 3300025981 Bacteria 4559
176 Ga0207658_10067121 3300025986 Bacteria 2700
177 Ga0207677_10031669 3300026023 Bacteria 3389
178 Ga0207677_10201383 3300026023 Bacteria 1583
179 Ga0207678_10097682 3300026067 Bacteria 2510
180 Ga0207648_10000060 3300026089 Bacteria 102225
181 Ga0207648_10002312 3300026089 Bacteria 20575
182 Ga0207676_10343766 3300026095 Bacteria 1378
183 Ga0207683_10146143 3300026121 Bacteria 2132
184 Ga0207698_10031989 3300026142 Bacteria 3806
185 Ga0207698_10112760 3300026142 Bacteria 2283
186 Ga0209588_1000022 3300027671 Bacteria 92210
187 Ga0268266_10078165 3300028379 Bacteria 2879
188 Ga0307517_10098886 3300028786 Bacteria 2318
189 Ga0307517_10198214 3300028786 Bacteria 1260
190 Ga0307515_10000103 3300028794 Bacteria 198308
191 Ga0307515_10001653 3300028794 Bacteria 49625
192 Ga0307515_10001755 3300028794 Bacteria 48316
193 Ga0307512_10037517 3300030522 Bacteria 4091
194 Ga0265325_10050302 3300031241 Bacteria 2147
195 Ga0307513_10000915 3300031456 Bacteria 42641
196 Ga0307513_10018139 3300031456 Bacteria 8421
197 Ga0307513_10051731 3300031456 Bacteria 4429
198 Ga0307513_10307700 3300031456 Bacteria 1348
199 Ga0307509_10002631 3300031507 Bacteria 28728
200 Ga0307509_10006190 3300031507 Bacteria 16213
201 Ga0307509_10008010 3300031507 Bacteria 13596
202 Ga0307509_10035192 3300031507 Bacteria 5498
203 Ga0307509_10142018 3300031507 Bacteria 2334
204 Ga0307509_10192323 3300031507 Bacteria 1889
205 Ga0307509_10216897 3300031507 Bacteria 1731
206 Ga0307408_100008267 3300031548 Bacteria 6868
207 Ga0307508_10000194 3300031616 Bacteria 73425
208 Ga0307508_10001847 3300031616 Bacteria 23394
209 Ga0307508_10006981 3300031616 Bacteria 10530
210 Ga0307508_10092080 3300031616 Bacteria 2620
211 Ga0307514_10061327 3300031649 Bacteria 2865
212 Ga0307514_10145951 3300031649 Bacteria 1599
213 Ga0307516_10002103 3300031730 Bacteria 27039
214 Ga0307516_10002796 3300031730 Bacteria 23020
215 Ga0307516_10019944 3300031730 Bacteria 6931
216 Ga0307516_10055371 3300031730 Bacteria 3871
217 Ga0307516_10434850 3300031730 Bacteria 969
218 Ga0307406_10056815 3300031901 Bacteria 2508
219 Ga0307507_10054137 3300033179 Bacteria 3823
220 Ga0307510_10002130 3300033180 Bacteria 22354
221 Ga0307510_10083753 3300033180 Bacteria 3076
222 Ga0307510_10121927 3300033180 Bacteria 2308
223 Ga0373959_0013812 3300034820 Bacteria 1462
224 Ga0373939_0035298 3300035114 Bacteria 1472
225 Ga0373931_0050085 3300035691 Bacteria 2221
226 Ga0395899_0002403 3300037312 Bacteria 15207
227 Ga0395899_0024427 3300037312 Bacteria 4569
228 Ga0395899_0150538 3300037312 Bacteria 1649
229 Ga0395899_0167249 3300037312 Bacteria 1550
230 Ga0395899_0232211 3300037312 Bacteria 1273
231 Ga0395899_0249783 3300037312 Bacteria 1218
232 Ga0395900_0022594 3300037418 Bacteria 6436
233 Ga0395900_0029616 3300037418 Bacteria 5617
234 Ga0395900_0257914 3300037418 Bacteria 1742
235 Ga0395900_0622290 3300037418 Bacteria 1018
236 Ga0395898_0018701 3300037466 Bacteria 7064
237 Ga0395905_0000531 3300037471 Bacteria 52244
238 Ga0395905_0052191 3300037471 Bacteria 3828
239 Ga0395905_0054638 3300037471 Bacteria 3737
240 Ga0395905_0195710 3300037471 Bacteria 1895
241 Ga0395905_0257021 3300037471 Bacteria 1631
242 Ga0395905_0268963 3300037471 Bacteria 1590
243 Ga0395901_0015495 3300038443 Bacteria 7761
244 Ga0395901_0054940 3300038443 Bacteria 4140
245 Ga0395901_0179443 3300038443 Bacteria 2221
246 Ga0395901_0376380 3300038443 Bacteria 1462
247 Ga0436365_0051035 3300039437 Bacteria 2251
248 Ga0436365_1853727 3300039437 Bacteria 1806
249 Ga0436360_0092124 3300039438 Bacteria 1186
250 Ga0436363_1311072 3300039450 Bacteria 964
251 Ga0451789_0285036 3300041443 Bacteria 2156
252 Ga0451793_0796618 3300041452 Bacteria 1916
253 Ga0451795_1373219 3300041456 Bacteria 2715
254 Ga0451800_0288069 3300041459 Bacteria 1574
255 Ga0451839_0699177 3300041496 Bacteria 1047
256 Ga0451843_0261668 3300041509 Bacteria 1033
257 Ga0451853_0745750 3300041512 Bacteria 2804
258 Ga0439437_005848 3300042000 Bacteria 1358
259 Ga0450892_002225 3300042130 Bacteria 1683
260 Ga0439464_0012490 3300042439 Bacteria 2263
261 Ga0450918_000456 3300042531 Bacteria 8730
262 Ga0451577_0093218 3300042876 Bacteria 2689
263 Ga0451577_0130157 3300042876 Bacteria 2257
264 Ga0451577_0199435 3300042876 Bacteria 1806
265 Ga0451577_0290104 3300042876 Bacteria 1482
266 Ga0466969_0011355 3300044656 Bacteria 4716
267 Ga0466969_0039064 3300044656 Bacteria 2385
268 Ga0466969_0056973 3300044656 Bacteria 1906
269 Ga0466972_0000353 3300044658 Bacteria 24981
270 Ga0466972_0042363 3300044658 Bacteria 2214
271 Ga0453683_0005265 3300044673 Bacteria 9052
272 Ga0453683_0062132 3300044673 Bacteria 2335
273 Ga0466965_0003147 3300044683 Bacteria 7198
274 Ga0466965_0012510 3300044683 Bacteria 3992
275 Ga0466965_0045525 3300044683 Bacteria 2170
276 Ga0466965_0053385 3300044683 Bacteria 2009
277 Ga0466965_0063003 3300044683 Bacteria 1855
278 Ga0466965_0098924 3300044683 Bacteria 1490
279 Ga0466966_0003743 3300044684 Bacteria 10029
280 Ga0466966_0003937 3300044684 Bacteria 9805
281 Ga0466966_0053132 3300044684 Bacteria 2571
282 Ga0466966_0066329 3300044684 Bacteria 2268
283 Ga0466961_0004698 3300044693 Bacteria 8587
284 Ga0466961_0009341 3300044693 Bacteria 6246
285 Ga0466961_0087272 3300044693 Bacteria 1971
286 Ga0466963_0007488 3300044694 Bacteria 6513
287 Ga0466964_0001004 3300044706 Bacteria 9373
288 Ga0466964_0006734 3300044706 Bacteria 4284
289 Ga0466964_0031317 3300044706 Bacteria 2109
290 Ga0453684_0001576 3300044712 Bacteria 63117
291 Ga0453684_0018873 3300044712 Bacteria 10550
292 Ga0453684_0023623 3300044712 Bacteria 9036
293 Ga0453684_0028538 3300044712 Bacteria 7957
294 Ga0453684_0052876 3300044712 Bacteria 5306
295 Ga0453684_0212808 3300044712 Bacteria 2245
296 Ga0466971_0004238 3300044719 Bacteria 6182
297 Ga0466971_0011735 3300044719 Bacteria 3837
298 Ga0466971_0033530 3300044719 Bacteria 2301
299 Ga0466971_0107588 3300044719 Bacteria 1285
300 Ga0466970_0007847 3300044765 Bacteria 5358
301 Ga0466970_0024634 3300044765 Bacteria 3148
302 Ga0466957_0008105 3300044842 Bacteria 5961
303 Ga0466957_0016635 3300044842 Bacteria 4302
304 Ga0466957_0045708 3300044842 Bacteria 2656
305 Ga0466960_0012994 3300044901 Bacteria 3527
306 Ga0466959_0000519 3300045049 Bacteria 22368
307 Ga0466959_0026056 3300045049 Bacteria 4336
308 Ga0466959_0033580 3300045049 Bacteria 3794
309 Ga0466959_0056391 3300045049 Bacteria 2866
310 Ga0451576_0201870 3300045051 Bacteria 2076
311 Ga0451576_0380487 3300045051 Bacteria 1479
312 Ga0466958_0049796 3300045836 Bacteria 2535
313 Ga0466958_0058593 3300045836 Bacteria 2341
314 Ga0466958_0317472 3300045836 Bacteria 1001
315 Ga0466967_0062389 3300045976 Bacteria 3308
316 Ga0466967_0083369 3300045976 Bacteria 2890
317 Ga0495592_0000237 3300046454 Bacteria 47510
318 Ga0495605_0057126 3300046474 Bacteria 1880
319 Ga0495585_0015150 3300046492 Bacteria 4481
320 Ga0495606_0011712 3300046507 Bacteria 7117
321 Ga0495632_0007246 3300046519 Bacteria 7000
322 Ga0495632_0087827 3300046519 Bacteria 1477
323 Ga0495643_0010850 3300046522 Bacteria 5584
324 Ga0495643_0032688 3300046522 Bacteria 2885
325 Ga0495666_0089267 3300046526 Bacteria 1455
326 Ga0495597_0007276 3300046542 Bacteria 5640
327 Ga0495656_0030877 3300046615 Bacteria 2168
328 Ga0495668_0017470 3300046616 Bacteria 4159
329 Ga0495625_0000673 3300046660 Bacteria 48716
330 Ga0495625_0018508 3300046660 Bacteria 5436
331 Ga0495625_0055523 3300046660 Bacteria 2824
332 Ga0495625_0074735 3300046660 Bacteria 2373
333 Ga0495661_0012220 3300046665 Bacteria 5799
334 Ga0495658_0037097 3300046683 Bacteria 2693
335 Ga0495624_0015429 3300046690 Bacteria 5159
336 Ga0495649_0004239 3300046694 Bacteria 9401
337 Ga0495660_0018201 3300046810 Bacteria 4039
338 Ga0495660_0018397 3300046810 Bacteria 4018
339 Ga0495672_0000036 3300047320 Bacteria 279648
340 Ga0495676_0037039 3300047321 Bacteria 4066
341 Ga0495687_003725 3300047443 Bacteria 10815
342 Ga0495687_005772 3300047443 Bacteria 7771
343 Ga0495687_005773 3300047443 Bacteria 7771
344 Ga0495687_023426 3300047443 Unclassified 2949
345 Ga0495686_0102865 3300047472 Bacteria 1721
346 Ga0495593_0015938 3300047673 Bacteria 4245
347 Ga0496102_0025835 3300048905 Bacteria 5231
348 Ga0496103_0027418 3300048906 Bacteria 3452
349 Ga0496108_0027534 3300048911 Bacteria 4695
350 Ga0496110_0028078 3300048913 Bacteria 4829
351 Ga0496114_0323977 3300048917 Bacteria 1362
352 Ga0496116_0004558 3300048919 Bacteria 13143
353 Ga0496116_0050744 3300048919 Bacteria 2762
354 Ga0496121_0075926 3300048924 Bacteria 2682
355 Ga0496121_0111446 3300048924 Bacteria 2086
356 Ga0496122_0000801 3300048925 Bacteria 60312
357 Ga0496123_0000528 3300048926 Bacteria 65747
358 Ga0496124_0233262 3300048927 Bacteria 1374
359 Ga0496125_0004529 3300048928 Bacteria 15964
360 Ga0501033_0033904 3300049570 Bacteria 3832
361 Ga0501043_0000243 3300049579 Bacteria 49191
362 Ga0501046_0000137 3300049580 Bacteria 78496
363 Ga0501047_0000050 3300049581 Bacteria 155628
364 Ga0501048_0017987 3300049582 Bacteria 5200
365 Ga0501045_0006004 3300049824 Bacteria 8405
366 nmdc:mga03683_75244_c1 3300050489 Bacteria 1449
367 nmdc:mga03683_88066_c1 3300050489 Bacteria 1350
368 nmdc:mga0k408_1828_c2 3300050493 Bacteria 8233
369 nmdc:mga0k408_2521_c1 3300050493 Bacteria 9425
370 nmdc:mga0k408_39817_c1 3300050493 Bacteria 2703
371 nmdc:mga0k408_50680_c1 3300050493 Bacteria 2403
372 nmdc:mga0k408_99790_c1 3300050493 Bacteria 1711
373 nmdc:mga07m45_1471_c1 3300050496 Bacteria 10818
374 nmdc:mga07m45_194717_c1 3300050496 Bacteria 1179
375 nmdc:mga07m45_8963_c1 3300050496 Bacteria 5167
376 Ga0500578_0000437 3300053086 Bacteria 51031
377 Ga0500644_0015695 3300053088 Bacteria 2166
378 Ga0500583_0169770 3300053092 Bacteria 1086
379 Ga0500651_0027776 3300053093 Bacteria 3558
380 Ga0500569_011152 3300053109 Bacteria 2139
381 Ga0500607_051036 3300053121 Bacteria 2201
382 Ga0500618_000922 3300053125 Bacteria 15179
383 Ga0500618_002393 3300053125 Bacteria 7148
384 Ga0500628_014702 3300053129 Bacteria 1483
385 Ga0500642_0004416 3300053130 Bacteria 4398
386 Ga0500652_000312 3300053131 Bacteria 17547
387 Ga0500655_006336 3300053133 Bacteria 2130
388 Ga0500658_0115805 3300053134 Bacteria 1184
389 Ga0500559_0000602 3300053136 Bacteria 24517
390 Ga0500568_0074562 3300053139 Bacteria 1294
391 Ga0500568_0088543 3300053139 Bacteria 1169
392 Ga0500604_0036314 3300053151 Bacteria 1470
393 Ga0500616_0146534 3300053153 Bacteria 1098
394 Ga0500619_000040 3300053154 Bacteria 40525
395 Ga0500622_0000164 3300053156 Bacteria 70630
396 Ga0500622_0010012 3300053156 Bacteria 5225
397 Ga0500645_049183 3300053730 Bacteria 1234
398 Ga0587083_0001111 3300059505 Bacteria 2864
399 Ga0587090_009168 3300059510 Bacteria 1345
400 Ga0587076_001657 3300059645 Bacteria 2323
401 Ga0587079_005910 3300059647 Bacteria 1757
402 Ga0587111_0025534 3300060346 Bacteria 1171
403 Ga0466962_0024181 3300061719 Bacteria 2918
404 Ga0466962_0034129 3300061719 Bacteria 2434
405 Ga0466962_0049069 3300061719 Bacteria 2017
406 Ga0466962_0090963 3300061719 Bacteria 1462
407 2511245174 2511231002 Bacteria 5042903
408 2511247847 2511231003 Bacteria 5606035
409 2587729988 2585428057 Bacteria 6737412
410 2587734864 2585428058 Bacteria 6853932
411 2587754457 2585428062 Bacteria 6842168
412 2588293185 2588253510 Bacteria 6901809
413 2643968415 2643221592 Bacteria 6608788
414 2644141793 2643221625 Bacteria 6512927
415 2644248839 2643221644 Bacteria 6865017
416 2644272537 2643221648 Bacteria 6521465
417 2819594745 2818991445 Bacteria 4955017
418 2884815380 2884811622 Bacteria 5552861
419 2884815397 2884811622 Bacteria 5552861
420 2884841239 2884836552 Bacteria 5219991
421 2884856113 2884852848 Bacteria 5221161
422 2896156961 2896154374 Bacteria 5221518
423 2897805105 2897803580 Bacteria 7000062
424 2919049352 2919046199 Bacteria 5567169
425 8054009172 8054002106 Bacteria 7987183
426 Ga0307517_10000499
427 JGI25155J39150_1000071
428 JGI25155J39150_1001038
429 JGI25155J39150_1001040
430 JGI25156J39149_1000071
431 JGI25156J39149_1000097
432 JGI25156J39149_1000158
433 JGI25156J39149_1000164
434 JGI25154J39366_1000074
435 JGI25154J39366_1000093
436 JGI25154J39366_1000114
437 JGI25154J39366_1000175
438 JGI25157J39369_1000088
439 JGI25157J39369_1000335
440 JGI25152J39213_1002477
441 JGI25150J39212_1001573
442 JGI25150J39212_1005268
443 JGI25151J46595_10028342
444 JGI25406J46586_10018750
445 JGI25153J46596_10002270
446 JGI25153J46596_10003693
447 rootH1_10034432
448 rootL2_10064870
449 rootH1_10187990
450 JGI25161J50226_1000008
451 Ga0055532_1000080
452 Ga0055535_1000056
453 Ga0055529_1000165
454 Ga0055526_1002150
455 Ga0055537_1000396
456 Ga0055537_1001718
457 Ga0055537_1003139
458 Ga0055524_1000027
459 Ga0055524_1000057
460 Ga0055524_1000126
461 Ga0055534_1003430
462 Ga0055528_1001958
463 Ga0055530_10001122
464 Ga0055540_1000021
465 Ga0055540_1000158
466 Ga0055531_10011209
467 Ga0055543_1001180
468 Ga0065165_1000832
469 Ga0070676_10038324
470 Ga0068869_100072074
471 Ga0068869_100130708
472 Ga0068869_100277156
473 Ga0068868_100008596
474 Ga0070660_100357674
475 Ga0070661_100000893
476 Ga0070675_100009253
477 Ga0070673_100090362
478 Ga0070659_100004831
479 Ga0070667_100018165
480 Ga0070708_100292493
481 Ga0070663_100179920
482 Ga0070662_100000931
483 Ga0068867_100000018
484 Ga0068867_100039164
485 Ga0070706_100200318
486 Ga0070707_100028426
487 Ga0070698_100167531
488 Ga0070699_100026610
489 Ga0068853_100124098
490 Ga0068853_100446629
491 Ga0070672_100009637
492 Ga0070664_100002509
493 Ga0068854_100064150
494 Ga0068852_100415650
495 Ga0068859_100220432
496 Ga0068859_100286021
497 Ga0068863_100136469
498 Ga0075365_10047747
499 Ga0075432_10007418
500 Ga0075362_10060455
501 Ga0075367_10031974
502 Ga0075369_10015642
503 Ga0075366_10010676
504 Ga0075366_10030936
505 Ga0075366_10100189
506 Ga0075366_10120157
507 Ga0075370_10001985
508 Ga0075370_10032940
509 Ga0075370_10058515
510 Ga0068865_100076057
511 Ga0097620_100220433
512 Ga0097620_100286009
513 Ga0079104_1004958
514 Ga0099794_10000585
515 Ga0105240_10000809
516 Ga0105240_10010334
517 Ga0105240_10466162
518 Ga0114129_10030937
519 Ga0105237_10019131
520 Ga0105237_10092376
521 Ga0105239_10085774
522 Ga0157370_10219142
523 Ga0157374_10428917
524 Ga0157375_10982477
525 Ga0157377_10000051
526 Ga0157376_10035575
527 Ga0213876_10084199
528 Ga0209435_100014
529 Ga0209435_100018
530 Ga0209435_100138
531 Ga0209147_100051
532 Ga0209437_100145
533 Ga0209258_100071
534 Ga0209258_100244
535 Ga0207425_1000565
536 Ga0207425_1000985
537 Ga0207425_1013362
538 Ga0209646_1000001
539 Ga0209646_1000081
540 Ga0209646_1000090
541 Ga0209026_1000042
542 Ga0209026_1000073
543 Ga0209759_1000013
544 Ga0209759_1000098
545 Ga0209759_1000109
546 Ga0209759_1000936
547 Ga0209129_1000075
548 Ga0209565_1000028
549 Ga0209565_1000573
550 Ga0209565_1003942
551 Ga0209455_1000030
552 Ga0209673_1000035
553 Ga0209673_1011820
554 Ga0209130_1000052
555 Ga0209130_1000112
556 Ga0209675_1001106
557 Ga0209675_1002301
558 Ga0209676_1000069
559 Ga0209025_1003111
560 Ga0209025_1004613
561 Ga0209564_1000046
562 Ga0209564_1001926
563 Ga0209564_1006337
564 Ga0209564_1016344
565 Ga0209758_1000045
566 Ga0209758_1000052
567 Ga0209758_1027330
568 Ga0209050_1000023
569 Ga0209050_1000257
570 Ga0209256_1000003
571 Ga0209256_1000013
572 Ga0209256_1041354
573 Ga0207426_1000153
574 Ga0207426_1001955
575 Ga0209051_1000017
576 Ga0209051_1003673
577 Ga0209051_1014608
578 Ga0209257_1000041
579 Ga0209257_1037589
580 Ga0207645_10001304
581 Ga0207643_10049532
582 Ga0207684_10053387
583 Ga0207684_10117336
584 Ga0207695_10001196
585 Ga0207695_10008186
586 Ga0207671_10075206
587 Ga0207671_10102742
588 Ga0207649_10010603
589 Ga0207646_10004092
590 Ga0207690_10371180
591 Ga0207706_10001218
592 Ga0207706_10131411
593 Ga0207704_10055589
594 Ga0207691_10006518
595 Ga0207689_10044923
596 Ga0207679_10000056
597 Ga0207667_10007680
598 Ga0207667_10171707
599 Ga0207651_10126443
600 Ga0207640_10014346
601 Ga0207658_10067121
602 Ga0207677_10031669
603 Ga0207677_10201383
604 Ga0207678_10097682
605 Ga0207648_10000060
606 Ga0207648_10002312
607 Ga0207676_10343766
608 Ga0207683_10146143
609 Ga0207698_10031989
610 Ga0207698_10112760
611 Ga0209588_1000022
612 Ga0268266_10078165
613 Ga0307517_10098886
614 Ga0307517_10198214
615 Ga0307515_10000103
616 Ga0307515_10001653
617 Ga0307515_10001755
618 Ga0307512_10037517
619 Ga0265325_10050302
620 Ga0307513_10000915
621 Ga0307513_10018139
622 Ga0307513_10051731
623 Ga0307513_10307700
624 Ga0307509_10002631
625 Ga0307509_10006190
626 Ga0307509_10008010
627 Ga0307509_10035192
628 Ga0307509_10142018
629 Ga0307509_10192323
630 Ga0307509_10216897
631 Ga0307408_100008267
632 Ga0307508_10000194
633 Ga0307508_10001847
634 Ga0307508_10006981
635 Ga0307508_10092080
636 Ga0307514_10061327
637 Ga0307514_10145951
638 Ga0307516_10002103
639 Ga0307516_10002796
640 Ga0307516_10019944
641 Ga0307516_10055371
642 Ga0307516_10434850
643 Ga0307406_10056815
644 Ga0307507_10054137
645 Ga0307510_10002130
646 Ga0307510_10083753
647 Ga0307510_10121927
648 Ga0373959_0013812
649 Ga0373939_0035298
650 Ga0373931_0050085
651 Ga0395899_0002403
652 Ga0395899_0024427
653 Ga0395899_0150538
654 Ga0395899_0167249
655 Ga0395899_0232211
656 Ga0395899_0249783
657 Ga0395900_0022594
658 Ga0395900_0029616
659 Ga0395900_0257914
660 Ga0395900_0622290
661 Ga0395898_0018701
662 Ga0395905_0000531
663 Ga0395905_0052191
664 Ga0395905_0054638
665 Ga0395905_0195710
666 Ga0395905_0257021
667 Ga0395905_0268963
668 Ga0395901_0015495
669 Ga0395901_0054940
670 Ga0395901_0179443
671 Ga0395901_0376380
672 Ga0436365_0051035
673 Ga0436365_1853727
674 Ga0436360_0092124
675 Ga0436363_1311072
676 Ga0451789_0285036
677 Ga0451793_0796618
678 Ga0451795_1373219
679 Ga0451800_0288069
680 Ga0451839_0699177
681 Ga0451843_0261668
682 Ga0451853_0745750
683 Ga0439437_005848
684 Ga0450892_002225
685 Ga0439464_0012490
686 Ga0450918_000456
687 Ga0451577_0093218
688 Ga0451577_0130157
689 Ga0451577_0199435
690 Ga0451577_0290104
691 Ga0466969_0011355
692 Ga0466969_0039064
693 Ga0466969_0056973
694 Ga0466972_0000353
695 Ga0466972_0042363
696 Ga0453683_0005265
697 Ga0453683_0062132
698 Ga0466965_0003147
699 Ga0466965_0012510
700 Ga0466965_0045525
701 Ga0466965_0053385
702 Ga0466965_0063003
703 Ga0466965_0098924
704 Ga0466966_0003743
705 Ga0466966_0003937
706 Ga0466966_0053132
707 Ga0466966_0066329
708 Ga0466961_0004698
709 Ga0466961_0009341
710 Ga0466961_0087272
711 Ga0466963_0007488
712 Ga0466964_0001004
713 Ga0466964_0006734
714 Ga0466964_0031317
715 Ga0453684_0001576
716 Ga0453684_0018873
717 Ga0453684_0023623
718 Ga0453684_0028538
719 Ga0453684_0052876
720 Ga0453684_0212808
721 Ga0466971_0004238
722 Ga0466971_0011735
723 Ga0466971_0033530
724 Ga0466971_0107588
725 Ga0466970_0007847
726 Ga0466970_0024634
727 Ga0466957_0008105
728 Ga0466957_0016635
729 Ga0466957_0045708
730 Ga0466960_0012994
731 Ga0466959_0000519
732 Ga0466959_0026056
733 Ga0466959_0033580
734 Ga0466959_0056391
735 Ga0451576_0201870
736 Ga0451576_0380487
737 Ga0466958_0049796
738 Ga0466958_0058593
739 Ga0466958_0317472
740 Ga0466967_0062389
741 Ga0466967_0083369
742 Ga0495592_0000237
743 Ga0495605_0057126
744 Ga0495585_0015150
745 Ga0495606_0011712
746 Ga0495632_0007246
747 Ga0495632_0087827
748 Ga0495643_0010850
749 Ga0495643_0032688
750 Ga0495666_0089267
751 Ga0495597_0007276
752 Ga0495656_0030877
753 Ga0495668_0017470
754 Ga0495625_0000673
755 Ga0495625_0018508
756 Ga0495625_0055523
757 Ga0495625_0074735
758 Ga0495661_0012220
759 Ga0495658_0037097
760 Ga0495624_0015429
761 Ga0495649_0004239
762 Ga0495660_0018201
763 Ga0495660_0018397
764 Ga0495672_0000036
765 Ga0495676_0037039
766 Ga0495687_003725
767 Ga0495687_005772
768 Ga0495687_005773
769 Ga0495687_023426
770 Ga0495686_0102865
771 Ga0495593_0015938
772 Ga0496102_0025835
773 Ga0496103_0027418
774 Ga0496108_0027534
775 Ga0496110_0028078
776 Ga0496114_0323977
777 Ga0496116_0004558
778 Ga0496116_0050744
779 Ga0496121_0075926
780 Ga0496121_0111446
781 Ga0496122_0000801
782 Ga0496123_0000528
783 Ga0496124_0233262
784 Ga0496125_0004529
785 Ga0501033_0033904
786 Ga0501043_0000243
787 Ga0501046_0000137
788 Ga0501047_0000050
789 Ga0501048_0017987
790 Ga0501045_0006004
791 nmdc:mga03683_75244_c1
792 nmdc:mga03683_88066_c1
793 nmdc:mga0k408_1828_c2
794 nmdc:mga0k408_2521_c1
795 nmdc:mga0k408_39817_c1
796 nmdc:mga0k408_50680_c1
797 nmdc:mga0k408_99790_c1
798 nmdc:mga07m45_1471_c1
799 nmdc:mga07m45_194717_c1
800 nmdc:mga07m45_8963_c1
801 Ga0500578_0000437
802 Ga0500644_0015695
803 Ga0500583_0169770
804 Ga0500651_0027776
805 Ga0500569_011152
806 Ga0500607_051036
807 Ga0500618_000922
808 Ga0500618_002393
809 Ga0500628_014702
810 Ga0500642_0004416
811 Ga0500652_000312
812 Ga0500655_006336
813 Ga0500658_0115805
814 Ga0500559_0000602
815 Ga0500568_0074562
816 Ga0500568_0088543
817 Ga0500604_0036314
818 Ga0500616_0146534
819 Ga0500619_000040
820 Ga0500622_0000164
821 Ga0500622_0010012
822 Ga0500645_049183
823 Ga0587083_0001111
824 Ga0587090_009168
825 Ga0587076_001657
826 Ga0587079_005910
827 Ga0587111_0025534
828 Ga0466962_0024181
829 Ga0466962_0034129
830 Ga0466962_0049069
831 Ga0466962_0090963
832 2511245174
833 2511247847
834 2587729988
835 2587734864
836 2587754457
837 2588293185
838 2643968415
839 2644141793
840 2644248839
841 2644272537
842 2819594745
843 2884815380
844 2884815397
845 2884841239
846 2884856113
847 2896156961
848 2897805105
849 2919049352
850 8054009172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

35

303

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5933 2 281
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5719 7 277
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5619 2 281
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5477 6 280
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5395 6 280
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8819 10 275 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8517 10 278 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8321 10 275 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8126 10 278 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7831 11 273 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A7V4CWF9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9598 1 287 GO:0005886
GO:0006865
GO:0022857
AF-A0A7V4CWF9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9566 1 287 GO:0005886
GO:0006865
GO:0022857
AF-A0A1F2W107-F1-model_v4 Amino acid ABC transporter permease 0.9546 1 275 GO:0005886
GO:0006865
GO:0022857
AF-A0A7J9ZEZ6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9535 1 286 GO:0005886
GO:0006865
GO:0022857
AF-A0A1V6A6X4-F1-model_v4 High-affinity branched-chain amino acid transport system permease protein LivH 0.9532 6 287 GO:0005886
GO:0006865
GO:0022857

Map