F440983

General Info

Members Datasets Scaffolds Average Seq Length
425 185 850 326

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10025362|Ga0207645_100253623
Length 399
Sequence VTRISGIDLALARKVLQTEAEAILALVDRLDERFEDAIRILLDCRGRVIVTGMGKSGIIARKIAATLSSTGTAAFFLHPAEAIHGDLGVLQSDDVILALSNSGETEELLRLLETIKRLGARMIAITGDCKSTLAQAADVALDCQVSEEACPMNLVPTASTTAALALGDAVAMTLFVAKGFRQDDFANIHPGGKIGKRLMRVEQLMHDGDQRPMVSPATPMPDVMTEMSRKRFGMTCVVEGDRLVGIITDGDLRRHMIAAQQSGGRSILEQTAAEVMTRTPVTVTSSISSPPAVEVADAETTVCAAADWLYKANAIAVPIKVDRLMFIKTPIPCCFVCGPIGGQYSTNRIQKTSLLHTNFAIFDFSRPSCGEEEADWYCIGYIQMARLTPNSRGRTTWFH

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.06
Rhizosphere 96.71
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10025362 3300025907 Bacteria 3836
2 JGI25406J46586_10010296 3300003203 Bacteria 4153
3 Ga0065704_10003416 3300005289 Bacteria 6501
4 Ga0065712_10001522 3300005290 Bacteria 12101
5 Ga0065715_10003476 3300005293 Bacteria 4367
6 Ga0065715_10131868 3300005293 Bacteria 2000
7 Ga0065715_10147632 3300005293 Bacteria 1768
8 Ga0065707_10000810 3300005295 Bacteria 12706
9 Ga0070676_10001088 3300005328 Bacteria 13562
10 Ga0070683_100050587 3300005329 Bacteria 3847
11 Ga0070683_100111835 3300005329 Bacteria 2577
12 Ga0070690_100004603 3300005330 Bacteria 7670
13 Ga0070690_100018622 3300005330 Bacteria 4197
14 Ga0070690_100061878 3300005330 Bacteria 2413
15 Ga0070690_100094219 3300005330 Bacteria 1976
16 Ga0070670_100330501 3300005331 Bacteria 1337
17 Ga0070677_10015410 3300005333 Bacteria 2708
18 Ga0070677_10035830 3300005333 Bacteria 1926
19 Ga0070677_10062474 3300005333 Bacteria 1541
20 Ga0070677_10112231 3300005333 Bacteria 1219
21 Ga0068869_100326600 3300005334 Bacteria 1245
22 Ga0068869_100440033 3300005334 Bacteria 1079
23 Ga0070666_10039400 3300005335 Bacteria 3149
24 Ga0068868_100012608 3300005338 Bacteria 6181
25 Ga0070689_100002492 3300005340 Bacteria 12033
26 Ga0070689_100014832 3300005340 Bacteria 5669
27 Ga0070689_100085746 3300005340 Bacteria 2477
28 Ga0070689_100107258 3300005340 Bacteria 2217
29 Ga0070689_100113710 3300005340 Bacteria 2155
30 Ga0070689_100138204 3300005340 Bacteria 1958
31 Ga0070687_100019364 3300005343 Bacteria 3164
32 Ga0070687_100020793 3300005343 Bacteria 3075
33 Ga0070692_10020626 3300005345 Bacteria 3197
34 Ga0070668_100027641 3300005347 Bacteria 4306
35 Ga0070668_100055202 3300005347 Bacteria 3066
36 Ga0070668_100104523 3300005347 Bacteria 2248
37 Ga0070668_100192792 3300005347 Bacteria 1670
38 Ga0070669_100007389 3300005353 Bacteria 7877
39 Ga0070669_100023929 3300005353 Bacteria 4375
40 Ga0070669_100121697 3300005353 Bacteria 1992
41 Ga0070675_100009060 3300005354 Bacteria 7733
42 Ga0070675_100009861 3300005354 Bacteria 7444
43 Ga0070675_100014890 3300005354 Bacteria 6140
44 Ga0070675_100026337 3300005354 Bacteria 4667
45 Ga0070671_100001902 3300005355 Bacteria 15966
46 Ga0070671_100186874 3300005355 Bacteria 1756
47 Ga0070671_100261134 3300005355 Bacteria 1472
48 Ga0070674_100000771 3300005356 Bacteria 16435
49 Ga0070674_100082773 3300005356 Bacteria 2296
50 Ga0070674_100118890 3300005356 Bacteria 1954
51 Ga0070673_100013487 3300005364 Bacteria 5656
52 Ga0070673_100029765 3300005364 Bacteria 4076
53 Ga0070673_100053406 3300005364 Bacteria 3173
54 Ga0070673_100084952 3300005364 Bacteria 2575
55 Ga0070673_100119179 3300005364 Bacteria 2199
56 Ga0070673_100246703 3300005364 Bacteria 1555
57 Ga0070688_100002744 3300005365 Bacteria 8942
58 Ga0070688_100006100 3300005365 Bacteria 6405
59 Ga0070688_100015731 3300005365 Bacteria 4311
60 Ga0070688_100038141 3300005365 Bacteria 2932
61 Ga0070688_100071481 3300005365 Bacteria 2221
62 Ga0070667_100017319 3300005367 Bacteria 5971
63 Ga0070701_10002500 3300005438 Bacteria 7101
64 Ga0070701_10016611 3300005438 Bacteria 3426
65 Ga0070701_10031114 3300005438 Bacteria 2646
66 Ga0070705_100044402 3300005440 Bacteria 2552
67 Ga0070700_100041862 3300005441 Bacteria 2810
68 Ga0070700_100140676 3300005441 Bacteria 1640
69 Ga0070694_100002083 3300005444 Bacteria 11872
70 Ga0070678_100047207 3300005456 Bacteria 3093
71 Ga0070678_100098527 3300005456 Bacteria 2260
72 Ga0070662_100054962 3300005457 Bacteria 2887
73 Ga0070662_100071149 3300005457 Bacteria 2564
74 Ga0070662_100146751 3300005457 Bacteria 1833
75 Ga0070681_10002917 3300005458 Bacteria 15836
76 Ga0068867_100004469 3300005459 Bacteria 9832
77 Ga0068867_100013841 3300005459 Bacteria 5710
78 Ga0068867_100061226 3300005459 Bacteria 2794
79 Ga0068867_100115332 3300005459 Bacteria 2069
80 Ga0070685_10016731 3300005466 Bacteria 3912
81 Ga0070685_10021434 3300005466 Bacteria 3513
82 Ga0070685_10047893 3300005466 Bacteria 2460
83 Ga0070698_100020136 3300005471 Bacteria 6995
84 Ga0070698_100400347 3300005471 Bacteria 1306
85 Ga0070699_100030797 3300005518 Bacteria 4632
86 Ga0070679_100047056 3300005530 Bacteria 4301
87 Ga0070684_100011769 3300005535 Bacteria 6980
88 Ga0068853_100454346 3300005539 Bacteria 1205
89 Ga0070672_100009020 3300005543 Bacteria 6857
90 Ga0070672_100044380 3300005543 Bacteria 3433
91 Ga0070672_100069120 3300005543 Bacteria 2803
92 Ga0070672_100130480 3300005543 Bacteria 2065
93 Ga0070672_100198757 3300005543 Bacteria 1676
94 Ga0070672_100254150 3300005543 Bacteria 1481
95 Ga0070686_100007622 3300005544 Bacteria 6046
96 Ga0070665_100053725 3300005548 Bacteria 4040
97 Ga0070665_100068887 3300005548 Bacteria 3547
98 Ga0070665_100337053 3300005548 Bacteria 1513
99 Ga0070704_100006714 3300005549 Bacteria 6808
100 Ga0070704_100115153 3300005549 Bacteria 2054
101 Ga0070704_100204163 3300005549 Bacteria 1597
102 Ga0070664_100006911 3300005564 Bacteria 9143
103 Ga0070664_100017629 3300005564 Bacteria 5864
104 Ga0070664_100046942 3300005564 Bacteria 3649
105 Ga0070664_100053292 3300005564 Bacteria 3428
106 Ga0070664_100172904 3300005564 Bacteria 1917
107 Ga0068857_100086522 3300005577 Bacteria 2803
108 Ga0068857_100234488 3300005577 Bacteria 1679
109 Ga0070702_100029784 3300005615 Bacteria 2972
110 Ga0070702_100049913 3300005615 Bacteria 2388
111 Ga0070702_100087604 3300005615 Bacteria 1881
112 Ga0068852_100144608 3300005616 Bacteria 2204
113 Ga0068859_100003566 3300005617 Bacteria 15857
114 Ga0068859_100042138 3300005617 Bacteria 4585
115 Ga0068859_100055500 3300005617 Bacteria 3986
116 Ga0068859_100223478 3300005617 Bacteria 1971
117 Ga0068859_100229092 3300005617 Bacteria 1946
118 Ga0068859_100323485 3300005617 Bacteria 1636
119 Ga0068864_100000951 3300005618 Bacteria 24240
120 Ga0068864_100105848 3300005618 Bacteria 2500
121 Ga0068864_100154466 3300005618 Bacteria 2082
122 Ga0068864_100480394 3300005618 Bacteria 1192
123 Ga0068861_100000556 3300005719 Bacteria 22085
124 Ga0068861_100045887 3300005719 Bacteria 3293
125 Ga0068861_100083685 3300005719 Bacteria 2503
126 Ga0068861_100289021 3300005719 Bacteria 1415
127 Ga0068861_100397612 3300005719 Bacteria 1222
128 Ga0068870_10002416 3300005840 Bacteria 7767
129 Ga0068870_10103027 3300005840 Bacteria 1617
130 Ga0068870_10107596 3300005840 Bacteria 1586
131 Ga0068863_100011205 3300005841 Bacteria 8688
132 Ga0068863_100120835 3300005841 Bacteria 2497
133 Ga0068863_100156484 3300005841 Bacteria 2182
134 Ga0068858_100004685 3300005842 Bacteria 13406
135 Ga0068858_100008269 3300005842 Bacteria 10001
136 Ga0068858_100034881 3300005842 Bacteria 4666
137 Ga0068860_100008056 3300005843 Bacteria 10502
138 Ga0068860_100020981 3300005843 Bacteria 6330
139 Ga0068860_100054582 3300005843 Bacteria 3798
140 Ga0068862_100001501 3300005844 Bacteria 21406
141 Ga0068862_100018629 3300005844 Bacteria 5783
142 Ga0068862_100245527 3300005844 Bacteria 1629
143 Ga0081538_10052235 3300005981 Bacteria 2444
144 Ga0081539_10000090 3300005985 Bacteria 212006
145 Ga0081539_10000558 3300005985 Bacteria 77001
146 Ga0081539_10011671 3300005985 Bacteria 6908
147 Ga0070712_100073399 3300006175 Bacteria 2454
148 Ga0097621_100077062 3300006237 Bacteria 2767
149 Ga0097621_100092499 3300006237 Bacteria 2533
150 Ga0097621_100297338 3300006237 Bacteria 1425
151 Ga0068871_100171119 3300006358 Bacteria 1862
152 Ga0075428_100015108 3300006844 Bacteria 8575
153 Ga0075428_100389637 3300006844 Bacteria 1494
154 Ga0075430_100000569 3300006846 Bacteria 28027
155 Ga0075430_100005413 3300006846 Bacteria 10783
156 Ga0075430_100116488 3300006846 Bacteria 2227
157 Ga0075431_100005810 3300006847 Bacteria 12209
158 Ga0075431_100069946 3300006847 Bacteria 3621
159 Ga0075433_10001268 3300006852 Bacteria 18437
160 Ga0075433_10045469 3300006852 Bacteria 3817
161 Ga0075433_10048520 3300006852 Bacteria 3692
162 Ga0075434_100000096 3300006871 Bacteria 48926
163 Ga0075434_100070298 3300006871 Bacteria 3491
164 Ga0075429_100003023 3300006880 Bacteria 14256
165 Ga0068865_100005705 3300006881 Bacteria 7564
166 Ga0068865_100039156 3300006881 Bacteria 3214
167 Ga0068865_100058685 3300006881 Bacteria 2689
168 Ga0097620_100003565 3300006931 Bacteria 15857
169 Ga0097620_100042139 3300006931 Bacteria 4585
170 Ga0097620_100055500 3300006931 Bacteria 3986
171 Ga0097620_100223483 3300006931 Bacteria 1971
172 Ga0097620_100229093 3300006931 Bacteria 1946
173 Ga0097620_100323463 3300006931 Bacteria 1636
174 Ga0075435_100011879 3300007076 Bacteria 6430
175 Ga0075435_100186971 3300007076 Bacteria 1752
176 Ga0111539_10007592 3300009094 Bacteria 13859
177 Ga0111539_10048202 3300009094 Bacteria 5088
178 Ga0111539_10098333 3300009094 Bacteria 3437
179 Ga0111539_10118896 3300009094 Bacteria 3097
180 Ga0111539_10177303 3300009094 Bacteria 2490
181 Ga0111539_10238151 3300009094 Bacteria 2118
182 Ga0111539_10515609 3300009094 Bacteria 1393
183 Ga0114129_10000453 3300009147 Bacteria 48900
184 Ga0114129_10001895 3300009147 Bacteria 28518
185 Ga0114129_10030588 3300009147 Bacteria 7617
186 Ga0114129_10096302 3300009147 Bacteria 4098
187 Ga0114129_10120063 3300009147 Bacteria 3620
188 Ga0114129_10369676 3300009147 Bacteria 1896
189 Ga0114129_10566345 3300009147 Bacteria 1476
190 Ga0105243_10025849 3300009148 Bacteria 4490
191 Ga0105243_10083322 3300009148 Bacteria 2616
192 Ga0105243_10413452 3300009148 Bacteria 1256
193 Ga0105241_10130357 3300009174 Bacteria 2035
194 Ga0105242_10005825 3300009176 Bacteria 9492
195 Ga0105242_10063040 3300009176 Bacteria 3052
196 Ga0105242_10103084 3300009176 Bacteria 2420
197 Ga0105248_10046809 3300009177 Bacteria 4850
198 Ga0105248_10147253 3300009177 Bacteria 2657
199 Ga0105248_10187045 3300009177 Bacteria 2334
200 Ga0105248_10276257 3300009177 Bacteria 1891
201 Ga0105248_10398322 3300009177 Bacteria 1550
202 Ga0105249_10062024 3300009553 Bacteria 3432
203 Ga0105239_10381611 3300010375 Bacteria 1593
204 Ga0105246_10064318 3300011119 Bacteria 2562
205 Ga0157371_10057749 3300013102 Bacteria 2752
206 Ga0157374_10339269 3300013296 Bacteria 1492
207 Ga0163162_10004475 3300013306 Bacteria 13464
208 Ga0163162_10051664 3300013306 Bacteria 4124
209 Ga0157375_10038113 3300013308 Bacteria 4612
210 Ga0157375_10318650 3300013308 Bacteria 1719
211 Ga0157375_10403425 3300013308 Bacteria 1534
212 Ga0163163_10018033 3300014325 Bacteria 6593
213 Ga0163163_10046922 3300014325 Bacteria 4244
214 Ga0163163_10097641 3300014325 Bacteria 2958
215 Ga0157380_10005615 3300014326 Bacteria 8766
216 Ga0157380_10008188 3300014326 Bacteria 7448
217 Ga0157380_10016722 3300014326 Bacteria 5417
218 Ga0157380_10017045 3300014326 Bacteria 5369
219 Ga0157380_10036218 3300014326 Bacteria 3817
220 Ga0157380_10114842 3300014326 Bacteria 2269
221 Ga0157380_10447275 3300014326 Bacteria 1240
222 Ga0157377_10001665 3300014745 Bacteria 9683
223 Ga0157377_10012032 3300014745 Bacteria 4339
224 Ga0157377_10074342 3300014745 Bacteria 1971
225 Ga0157377_10134439 3300014745 Bacteria 1514
226 Ga0157379_10001398 3300014968 Bacteria 19775
227 Ga0157376_10064727 3300014969 Bacteria 3084
228 Ga0157376_10075328 3300014969 Bacteria 2880
229 Ga0163161_10036110 3300017792 Bacteria 3539
230 Ga0207697_10000476 3300025315 Bacteria 22654
231 Ga0207697_10038774 3300025315 Bacteria 1954
232 Ga0207653_10026331 3300025885 Bacteria 1864
233 Ga0207682_10001071 3300025893 Bacteria 12626
234 Ga0207682_10003273 3300025893 Bacteria 7084
235 Ga0207682_10016737 3300025893 Bacteria 2861
236 Ga0207682_10024095 3300025893 Bacteria 2408
237 Ga0207682_10024443 3300025893 Bacteria 2392
238 Ga0207682_10064816 3300025893 Bacteria 1536
239 Ga0207642_10157227 3300025899 Bacteria 1217
240 Ga0207688_10006488 3300025901 Bacteria 6368
241 Ga0207688_10016291 3300025901 Bacteria 4031
242 Ga0207680_10061060 3300025903 Bacteria 2297
243 Ga0207680_10148991 3300025903 Bacteria 1558
244 Ga0207645_10027726 3300025907 Bacteria 3657
245 Ga0207645_10030853 3300025907 Bacteria 3454
246 Ga0207643_10001996 3300025908 Bacteria 11253
247 Ga0207643_10003967 3300025908 Bacteria 7965
248 Ga0207643_10033448 3300025908 Bacteria 2877
249 Ga0207643_10092708 3300025908 Bacteria 1763
250 Ga0207643_10137536 3300025908 Bacteria 1457
251 Ga0207707_10114960 3300025912 Bacteria 2352
252 Ga0207693_10066031 3300025915 Bacteria 2833
253 Ga0207662_10009840 3300025918 Bacteria 5275
254 Ga0207662_10077567 3300025918 Bacteria 2021
255 Ga0207649_10012389 3300025920 Bacteria 4730
256 Ga0207649_10293270 3300025920 Bacteria 1187
257 Ga0207646_10134550 3300025922 Bacteria 2226
258 Ga0207681_10012825 3300025923 Bacteria 5181
259 Ga0207681_10017034 3300025923 Bacteria 4558
260 Ga0207681_10033941 3300025923 Bacteria 3351
261 Ga0207650_10003089 3300025925 Bacteria 11465
262 Ga0207650_10019994 3300025925 Bacteria 4715
263 Ga0207650_10179887 3300025925 Bacteria 1685
264 Ga0207659_10000227 3300025926 Bacteria 34213
265 Ga0207659_10015037 3300025926 Bacteria 5005
266 Ga0207659_10035639 3300025926 Bacteria 3441
267 Ga0207659_10036204 3300025926 Bacteria 3417
268 Ga0207659_10111622 3300025926 Bacteria 2079
269 Ga0207659_10119983 3300025926 Bacteria 2014
270 Ga0207644_10036409 3300025931 Bacteria 3454
271 Ga0207644_10277100 3300025931 Bacteria 1346
272 Ga0207706_10030684 3300025933 Bacteria 4794
273 Ga0207706_10049220 3300025933 Bacteria 3725
274 Ga0207706_10063826 3300025933 Bacteria 3242
275 Ga0207686_10031788 3300025934 Bacteria 3136
276 Ga0207686_10059541 3300025934 Bacteria 2413
277 Ga0207709_10010233 3300025935 Bacteria 5166
278 Ga0207670_10006739 3300025936 Bacteria 6384
279 Ga0207670_10047134 3300025936 Bacteria 2868
280 Ga0207670_10140832 3300025936 Bacteria 1779
281 Ga0207670_10260275 3300025936 Bacteria 1344
282 Ga0207669_10000417 3300025937 Bacteria 18599
283 Ga0207704_10010918 3300025938 Bacteria 4453
284 Ga0207704_10047274 3300025938 Bacteria 2571
285 Ga0207704_10299251 3300025938 Bacteria 1231
286 Ga0207704_10351134 3300025938 Bacteria 1148
287 Ga0207691_10006359 3300025940 Bacteria 11411
288 Ga0207691_10034030 3300025940 Bacteria 4742
289 Ga0207691_10049683 3300025940 Bacteria 3843
290 Ga0207691_10090058 3300025940 Bacteria 2750
291 Ga0207691_10092973 3300025940 Bacteria 2701
292 Ga0207691_10151622 3300025940 Bacteria 2038
293 Ga0207711_10014107 3300025941 Bacteria 6638
294 Ga0207711_10198701 3300025941 Bacteria 1829
295 Ga0207711_10253398 3300025941 Bacteria 1617
296 Ga0207711_10409794 3300025941 Bacteria 1260
297 Ga0207689_10006131 3300025942 Bacteria 10638
298 Ga0207689_10006606 3300025942 Bacteria 10230
299 Ga0207689_10366980 3300025942 Bacteria 1198
300 Ga0207661_10106363 3300025944 Bacteria 2365
301 Ga0207679_10164259 3300025945 Bacteria 1821
302 Ga0207679_10334320 3300025945 Bacteria 1316
303 Ga0207651_10004913 3300025960 Bacteria 6819
304 Ga0207651_10030718 3300025960 Bacteria 3425
305 Ga0207651_10039836 3300025960 Bacteria 3102
306 Ga0207651_10043675 3300025960 Bacteria 2994
307 Ga0207651_10144207 3300025960 Bacteria 1844
308 Ga0207651_10202588 3300025960 Bacteria 1591
309 Ga0207651_10266256 3300025960 Bacteria 1409
310 Ga0207712_10049694 3300025961 Bacteria 2924
311 Ga0207658_10116762 3300025986 Bacteria 2120
312 Ga0207658_10354257 3300025986 Bacteria 1279
313 Ga0207677_10027873 3300026023 Bacteria 3565
314 Ga0207703_10018355 3300026035 Bacteria 5462
315 Ga0207678_10439394 3300026067 Bacteria 1133
316 Ga0207708_10049726 3300026075 Bacteria 3193
317 Ga0207708_10071786 3300026075 Bacteria 2652
318 Ga0207648_10000077 3300026089 Bacteria 93009
319 Ga0207648_10002088 3300026089 Bacteria 21755
320 Ga0207648_10013687 3300026089 Bacteria 7532
321 Ga0207648_10065680 3300026089 Bacteria 3163
322 Ga0207648_10081320 3300026089 Bacteria 2826
323 Ga0207676_10041450 3300026095 Bacteria 3534
324 Ga0207676_10058118 3300026095 Bacteria 3049
325 Ga0207676_10092023 3300026095 Bacteria 2493
326 Ga0207676_10154339 3300026095 Bacteria 1981
327 Ga0207676_10189567 3300026095 Bacteria 1808
328 Ga0207674_10043376 3300026116 Bacteria 4638
329 Ga0207674_10099904 3300026116 Bacteria 2884
330 Ga0207675_100010643 3300026118 Bacteria 8618
331 Ga0207675_100034517 3300026118 Bacteria 4717
332 Ga0207675_100067986 3300026118 Bacteria 3330
333 Ga0207675_100180515 3300026118 Bacteria 2021
334 Ga0207675_100248370 3300026118 Bacteria 1721
335 Ga0207675_100255724 3300026118 Bacteria 1696
336 Ga0207683_10034760 3300026121 Bacteria 4382
337 Ga0207683_10101522 3300026121 Bacteria 2568
338 Ga0207683_10255404 3300026121 Bacteria 1600
339 Ga0207698_10203887 3300026142 Bacteria 1773
340 Ga0207428_10003687 3300027907 Bacteria 14726
341 Ga0207428_10006470 3300027907 Bacteria 10813
342 Ga0268266_10123581 3300028379 Bacteria 2306
343 Ga0268266_10476155 3300028379 Bacteria 1190
344 Ga0268265_10019159 3300028380 Bacteria 4750
345 Ga0268265_10069542 3300028380 Bacteria 2734
346 Ga0268265_10115664 3300028380 Bacteria 2199
347 Ga0268264_10249993 3300028381 Bacteria 1647
348 Ga0268264_10253784 3300028381 Bacteria 1635
349 Ga0307408_100075309 3300031548 Unclassified 2507
350 Ga0307405_10007602 3300031731 Bacteria 5435
351 Ga0307413_10010898 3300031824 Bacteria 4438
352 Ga0307413_10014380 3300031824 Bacteria 4017
353 Ga0307410_10038531 3300031852 Bacteria 3132
354 Ga0307407_10008645 3300031903 Bacteria 4689
355 Ga0307407_10036323 3300031903 Bacteria 2714
356 Ga0307412_10008525 3300031911 Bacteria 5857
357 Ga0307409_100074892 3300031995 Bacteria 2707
358 Ga0307416_100000683 3300032002 Bacteria 17650
359 Ga0307414_10106571 3300032004 Bacteria 2122
360 Ga0307411_10085892 3300032005 Bacteria 2181
361 Ga0373946_0164735 3300035171 Bacteria 1043
362 Ga0373931_0064277 3300035691 Bacteria 1986
363 Ga0373935_0115777 3300035692 Bacteria 1785
364 Ga0439448_0069451 3300042005 Bacteria 1172
365 Ga0451577_0305433 3300042876 Bacteria 1442
366 Ga0466963_0071218 3300044694 Bacteria 2340
367 Ga0451576_0023641 3300045051 Bacteria 6652
368 Ga0451576_0225978 3300045051 Bacteria 1954
369 Ga0451576_0749666 3300045051 Bacteria 1026
370 Ga0495584_0016404 3300046491 Bacteria 3776
371 Ga0495628_0088293 3300046516 Bacteria 2403
372 Ga0495586_0119632 3300046535 Bacteria 1471
373 Ga0495609_0054753 3300046538 Bacteria 1771
374 Ga0495621_0003029 3300046539 Bacteria 4583
375 Ga0495621_0031828 3300046539 Bacteria 1812
376 Ga0495656_0100401 3300046615 Bacteria 1338
377 Ga0495659_0004517 3300046664 Bacteria 4381
378 Ga0495659_0017740 3300046664 Bacteria 2363
379 Ga0495659_0020279 3300046664 Bacteria 2231
380 Ga0495659_0047014 3300046664 Bacteria 1559
381 Ga0495659_0056719 3300046664 Bacteria 1438
382 Ga0495636_0024558 3300047318 Bacteria 2445
383 Ga0495636_0040995 3300047318 Bacteria 1921
384 Ga0496101_0057568 3300048904 Bacteria 2812
385 Ga0496103_0081490 3300048906 Bacteria 2036
386 Ga0496104_0009865 3300048907 Bacteria 8522
387 Ga0496109_0031275 3300048912 Bacteria 4775
388 Ga0496109_0092843 3300048912 Bacteria 2792
389 Ga0496109_0182949 3300048912 Bacteria 1969
390 Ga0496110_0034497 3300048913 Bacteria 4383
391 Ga0496112_0000481 3300048915 Bacteria 26754
392 Ga0496113_0026390 3300048916 Bacteria 4153
393 Ga0496113_0145976 3300048916 Bacteria 1864
394 Ga0496114_0003372 3300048917 Bacteria 12271
395 Ga0496114_0019316 3300048917 Bacteria 5521
396 Ga0496115_0064793 3300048918 Bacteria 2951
397 Ga0501034_0007471 3300049571 Bacteria 11631
398 Ga0501042_0266257 3300049578 Bacteria 1237
399 Ga0501047_0018426 3300049581 Bacteria 6693
400 Ga0501073_0196725 3300049589 Bacteria 1394
401 Ga0501044_0003861 3300049823 Bacteria 16787
402 nmdc:mga00v17_45670_c1 3300050491 Bacteria 2647
403 nmdc:mga05p37_119914_c1 3300050507 Bacteria 3231
404 nmdc:mga05p37_163192_c1 3300050507 Bacteria 2720
405 nmdc:mga05p37_73218_c2 3300050507 Bacteria 2867
406 nmdc:mga09592_5947_c1 3300050508 Bacteria 9947
407 nmdc:mga0qj67_139410_c1 3300050509 Bacteria 1966
408 nmdc:mga0qj67_536_c1 3300050509 Bacteria 25813
409 nmdc:mga06r32_1394_c1 3300050510 Bacteria 21834
410 nmdc:mga06r32_27669_c1 3300050510 Bacteria 5299
411 nmdc:mga08y16_11338_c1 3300050511 Bacteria 9364
412 nmdc:mga08y16_211444_c1 3300050511 Bacteria 2009
413 nmdc:mga08y16_330991_c1 3300050511 Bacteria 1567
414 nmdc:mga0n895_139985_c1 3300050512 Bacteria 2448
415 nmdc:mga0n895_47743_c1 3300050512 Bacteria 4187
416 nmdc:mga0rr50_167243_c1 3300050513 Bacteria 1789
417 nmdc:mga0a205_1362_c1 3300050515 Bacteria 20618
418 nmdc:mga0a205_155794_c1 3300050515 Bacteria 2183
419 nmdc:mga0a205_35884_c1 3300050515 Bacteria 4763
420 Ga0501084_0237144 3300054114 Bacteria 1540
421 Ga0590071_000041 3300059421 Bacteria 32697
422 Ga0590074_000052 3300059423 Bacteria 11718
423 Ga0590075_001378 3300059424 Bacteria 6097
424 Ga0590075_003591 3300059424 Bacteria 3682
425 Ga0590077_000066 3300059426 Bacteria 26485
426 Ga0207645_10025362
427 JGI25406J46586_10010296
428 Ga0065704_10003416
429 Ga0065712_10001522
430 Ga0065715_10003476
431 Ga0065715_10131868
432 Ga0065715_10147632
433 Ga0065707_10000810
434 Ga0070676_10001088
435 Ga0070683_100050587
436 Ga0070683_100111835
437 Ga0070690_100004603
438 Ga0070690_100018622
439 Ga0070690_100061878
440 Ga0070690_100094219
441 Ga0070670_100330501
442 Ga0070677_10015410
443 Ga0070677_10035830
444 Ga0070677_10062474
445 Ga0070677_10112231
446 Ga0068869_100326600
447 Ga0068869_100440033
448 Ga0070666_10039400
449 Ga0068868_100012608
450 Ga0070689_100002492
451 Ga0070689_100014832
452 Ga0070689_100085746
453 Ga0070689_100107258
454 Ga0070689_100113710
455 Ga0070689_100138204
456 Ga0070687_100019364
457 Ga0070687_100020793
458 Ga0070692_10020626
459 Ga0070668_100027641
460 Ga0070668_100055202
461 Ga0070668_100104523
462 Ga0070668_100192792
463 Ga0070669_100007389
464 Ga0070669_100023929
465 Ga0070669_100121697
466 Ga0070675_100009060
467 Ga0070675_100009861
468 Ga0070675_100014890
469 Ga0070675_100026337
470 Ga0070671_100001902
471 Ga0070671_100186874
472 Ga0070671_100261134
473 Ga0070674_100000771
474 Ga0070674_100082773
475 Ga0070674_100118890
476 Ga0070673_100013487
477 Ga0070673_100029765
478 Ga0070673_100053406
479 Ga0070673_100084952
480 Ga0070673_100119179
481 Ga0070673_100246703
482 Ga0070688_100002744
483 Ga0070688_100006100
484 Ga0070688_100015731
485 Ga0070688_100038141
486 Ga0070688_100071481
487 Ga0070667_100017319
488 Ga0070701_10002500
489 Ga0070701_10016611
490 Ga0070701_10031114
491 Ga0070705_100044402
492 Ga0070700_100041862
493 Ga0070700_100140676
494 Ga0070694_100002083
495 Ga0070678_100047207
496 Ga0070678_100098527
497 Ga0070662_100054962
498 Ga0070662_100071149
499 Ga0070662_100146751
500 Ga0070681_10002917
501 Ga0068867_100004469
502 Ga0068867_100013841
503 Ga0068867_100061226
504 Ga0068867_100115332
505 Ga0070685_10016731
506 Ga0070685_10021434
507 Ga0070685_10047893
508 Ga0070698_100020136
509 Ga0070698_100400347
510 Ga0070699_100030797
511 Ga0070679_100047056
512 Ga0070684_100011769
513 Ga0068853_100454346
514 Ga0070672_100009020
515 Ga0070672_100044380
516 Ga0070672_100069120
517 Ga0070672_100130480
518 Ga0070672_100198757
519 Ga0070672_100254150
520 Ga0070686_100007622
521 Ga0070665_100053725
522 Ga0070665_100068887
523 Ga0070665_100337053
524 Ga0070704_100006714
525 Ga0070704_100115153
526 Ga0070704_100204163
527 Ga0070664_100006911
528 Ga0070664_100017629
529 Ga0070664_100046942
530 Ga0070664_100053292
531 Ga0070664_100172904
532 Ga0068857_100086522
533 Ga0068857_100234488
534 Ga0070702_100029784
535 Ga0070702_100049913
536 Ga0070702_100087604
537 Ga0068852_100144608
538 Ga0068859_100003566
539 Ga0068859_100042138
540 Ga0068859_100055500
541 Ga0068859_100223478
542 Ga0068859_100229092
543 Ga0068859_100323485
544 Ga0068864_100000951
545 Ga0068864_100105848
546 Ga0068864_100154466
547 Ga0068864_100480394
548 Ga0068861_100000556
549 Ga0068861_100045887
550 Ga0068861_100083685
551 Ga0068861_100289021
552 Ga0068861_100397612
553 Ga0068870_10002416
554 Ga0068870_10103027
555 Ga0068870_10107596
556 Ga0068863_100011205
557 Ga0068863_100120835
558 Ga0068863_100156484
559 Ga0068858_100004685
560 Ga0068858_100008269
561 Ga0068858_100034881
562 Ga0068860_100008056
563 Ga0068860_100020981
564 Ga0068860_100054582
565 Ga0068862_100001501
566 Ga0068862_100018629
567 Ga0068862_100245527
568 Ga0081538_10052235
569 Ga0081539_10000090
570 Ga0081539_10000558
571 Ga0081539_10011671
572 Ga0070712_100073399
573 Ga0097621_100077062
574 Ga0097621_100092499
575 Ga0097621_100297338
576 Ga0068871_100171119
577 Ga0075428_100015108
578 Ga0075428_100389637
579 Ga0075430_100000569
580 Ga0075430_100005413
581 Ga0075430_100116488
582 Ga0075431_100005810
583 Ga0075431_100069946
584 Ga0075433_10001268
585 Ga0075433_10045469
586 Ga0075433_10048520
587 Ga0075434_100000096
588 Ga0075434_100070298
589 Ga0075429_100003023
590 Ga0068865_100005705
591 Ga0068865_100039156
592 Ga0068865_100058685
593 Ga0097620_100003565
594 Ga0097620_100042139
595 Ga0097620_100055500
596 Ga0097620_100223483
597 Ga0097620_100229093
598 Ga0097620_100323463
599 Ga0075435_100011879
600 Ga0075435_100186971
601 Ga0111539_10007592
602 Ga0111539_10048202
603 Ga0111539_10098333
604 Ga0111539_10118896
605 Ga0111539_10177303
606 Ga0111539_10238151
607 Ga0111539_10515609
608 Ga0114129_10000453
609 Ga0114129_10001895
610 Ga0114129_10030588
611 Ga0114129_10096302
612 Ga0114129_10120063
613 Ga0114129_10369676
614 Ga0114129_10566345
615 Ga0105243_10025849
616 Ga0105243_10083322
617 Ga0105243_10413452
618 Ga0105241_10130357
619 Ga0105242_10005825
620 Ga0105242_10063040
621 Ga0105242_10103084
622 Ga0105248_10046809
623 Ga0105248_10147253
624 Ga0105248_10187045
625 Ga0105248_10276257
626 Ga0105248_10398322
627 Ga0105249_10062024
628 Ga0105239_10381611
629 Ga0105246_10064318
630 Ga0157371_10057749
631 Ga0157374_10339269
632 Ga0163162_10004475
633 Ga0163162_10051664
634 Ga0157375_10038113
635 Ga0157375_10318650
636 Ga0157375_10403425
637 Ga0163163_10018033
638 Ga0163163_10046922
639 Ga0163163_10097641
640 Ga0157380_10005615
641 Ga0157380_10008188
642 Ga0157380_10016722
643 Ga0157380_10017045
644 Ga0157380_10036218
645 Ga0157380_10114842
646 Ga0157380_10447275
647 Ga0157377_10001665
648 Ga0157377_10012032
649 Ga0157377_10074342
650 Ga0157377_10134439
651 Ga0157379_10001398
652 Ga0157376_10064727
653 Ga0157376_10075328
654 Ga0163161_10036110
655 Ga0207697_10000476
656 Ga0207697_10038774
657 Ga0207653_10026331
658 Ga0207682_10001071
659 Ga0207682_10003273
660 Ga0207682_10016737
661 Ga0207682_10024095
662 Ga0207682_10024443
663 Ga0207682_10064816
664 Ga0207642_10157227
665 Ga0207688_10006488
666 Ga0207688_10016291
667 Ga0207680_10061060
668 Ga0207680_10148991
669 Ga0207645_10027726
670 Ga0207645_10030853
671 Ga0207643_10001996
672 Ga0207643_10003967
673 Ga0207643_10033448
674 Ga0207643_10092708
675 Ga0207643_10137536
676 Ga0207707_10114960
677 Ga0207693_10066031
678 Ga0207662_10009840
679 Ga0207662_10077567
680 Ga0207649_10012389
681 Ga0207649_10293270
682 Ga0207646_10134550
683 Ga0207681_10012825
684 Ga0207681_10017034
685 Ga0207681_10033941
686 Ga0207650_10003089
687 Ga0207650_10019994
688 Ga0207650_10179887
689 Ga0207659_10000227
690 Ga0207659_10015037
691 Ga0207659_10035639
692 Ga0207659_10036204
693 Ga0207659_10111622
694 Ga0207659_10119983
695 Ga0207644_10036409
696 Ga0207644_10277100
697 Ga0207706_10030684
698 Ga0207706_10049220
699 Ga0207706_10063826
700 Ga0207686_10031788
701 Ga0207686_10059541
702 Ga0207709_10010233
703 Ga0207670_10006739
704 Ga0207670_10047134
705 Ga0207670_10140832
706 Ga0207670_10260275
707 Ga0207669_10000417
708 Ga0207704_10010918
709 Ga0207704_10047274
710 Ga0207704_10299251
711 Ga0207704_10351134
712 Ga0207691_10006359
713 Ga0207691_10034030
714 Ga0207691_10049683
715 Ga0207691_10090058
716 Ga0207691_10092973
717 Ga0207691_10151622
718 Ga0207711_10014107
719 Ga0207711_10198701
720 Ga0207711_10253398
721 Ga0207711_10409794
722 Ga0207689_10006131
723 Ga0207689_10006606
724 Ga0207689_10366980
725 Ga0207661_10106363
726 Ga0207679_10164259
727 Ga0207679_10334320
728 Ga0207651_10004913
729 Ga0207651_10030718
730 Ga0207651_10039836
731 Ga0207651_10043675
732 Ga0207651_10144207
733 Ga0207651_10202588
734 Ga0207651_10266256
735 Ga0207712_10049694
736 Ga0207658_10116762
737 Ga0207658_10354257
738 Ga0207677_10027873
739 Ga0207703_10018355
740 Ga0207678_10439394
741 Ga0207708_10049726
742 Ga0207708_10071786
743 Ga0207648_10000077
744 Ga0207648_10002088
745 Ga0207648_10013687
746 Ga0207648_10065680
747 Ga0207648_10081320
748 Ga0207676_10041450
749 Ga0207676_10058118
750 Ga0207676_10092023
751 Ga0207676_10154339
752 Ga0207676_10189567
753 Ga0207674_10043376
754 Ga0207674_10099904
755 Ga0207675_100010643
756 Ga0207675_100034517
757 Ga0207675_100067986
758 Ga0207675_100180515
759 Ga0207675_100248370
760 Ga0207675_100255724
761 Ga0207683_10034760
762 Ga0207683_10101522
763 Ga0207683_10255404
764 Ga0207698_10203887
765 Ga0207428_10003687
766 Ga0207428_10006470
767 Ga0268266_10123581
768 Ga0268266_10476155
769 Ga0268265_10019159
770 Ga0268265_10069542
771 Ga0268265_10115664
772 Ga0268264_10249993
773 Ga0268264_10253784
774 Ga0307408_100075309
775 Ga0307405_10007602
776 Ga0307413_10010898
777 Ga0307413_10014380
778 Ga0307410_10038531
779 Ga0307407_10008645
780 Ga0307407_10036323
781 Ga0307412_10008525
782 Ga0307409_100074892
783 Ga0307416_100000683
784 Ga0307414_10106571
785 Ga0307411_10085892
786 Ga0373946_0164735
787 Ga0373931_0064277
788 Ga0373935_0115777
789 Ga0439448_0069451
790 Ga0451577_0305433
791 Ga0466963_0071218
792 Ga0451576_0023641
793 Ga0451576_0225978
794 Ga0451576_0749666
795 Ga0495584_0016404
796 Ga0495628_0088293
797 Ga0495586_0119632
798 Ga0495609_0054753
799 Ga0495621_0003029
800 Ga0495621_0031828
801 Ga0495656_0100401
802 Ga0495659_0004517
803 Ga0495659_0017740
804 Ga0495659_0020279
805 Ga0495659_0047014
806 Ga0495659_0056719
807 Ga0495636_0024558
808 Ga0495636_0040995
809 Ga0496101_0057568
810 Ga0496103_0081490
811 Ga0496104_0009865
812 Ga0496109_0031275
813 Ga0496109_0092843
814 Ga0496109_0182949
815 Ga0496110_0034497
816 Ga0496112_0000481
817 Ga0496113_0026390
818 Ga0496113_0145976
819 Ga0496114_0003372
820 Ga0496114_0019316
821 Ga0496115_0064793
822 Ga0501034_0007471
823 Ga0501042_0266257
824 Ga0501047_0018426
825 Ga0501073_0196725
826 Ga0501044_0003861
827 nmdc:mga00v17_45670_c1
828 nmdc:mga05p37_119914_c1
829 nmdc:mga05p37_163192_c1
830 nmdc:mga05p37_73218_c2
831 nmdc:mga09592_5947_c1
832 nmdc:mga0qj67_139410_c1
833 nmdc:mga0qj67_536_c1
834 nmdc:mga06r32_1394_c1
835 nmdc:mga06r32_27669_c1
836 nmdc:mga08y16_11338_c1
837 nmdc:mga08y16_211444_c1
838 nmdc:mga08y16_330991_c1
839 nmdc:mga0n895_139985_c1
840 nmdc:mga0n895_47743_c1
841 nmdc:mga0rr50_167243_c1
842 nmdc:mga0a205_1362_c1
843 nmdc:mga0a205_155794_c1
844 nmdc:mga0a205_35884_c1
845 Ga0501084_0237144
846 Ga0590071_000041
847 Ga0590074_000052
848 Ga0590075_001378
849 Ga0590075_003591
850 Ga0590077_000066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

40

173

0.96

PF00571

CBS

CBS domain

201

258

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.954 15 182
3fna-assembly3.cif.gz_A crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.946 198 320
3k2v-assembly1.cif.gz_B structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. 0.9454 196 320
4o9k-assembly1.cif.gz_B crystal structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from methylococcus capsulatus in complex with cmp-kdo 0.9444 201 326
3fna-assembly3.cif.gz_B-2 crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.9404 198 320
ID Description Score Start End Superfamily
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9676 201 321 3.10.580.10
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.959 201 321 3.10.580.10
af_Q9M1T1_220_348_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9576 201 321 3.10.580.10
3fnaA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9426 198 320 3.10.580.10
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9372 201 321 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A259R762-F1-model_v4 deleted 0.9792 12 142
AF-A0A382IFM7-F1-model_v4 SIS domain-containing protein 0.9764 12 129 GO:0097367
GO:1901135
AF-A0A656SJ60-F1-model_v4 deleted 0.973 44 125
AF-A0A832J690-F1-model_v4 CBS domain-containing protein 0.9708 227 326
AF-A0A4Q3TU13-F1-model_v4 deleted 0.9546 215 321

Map