F440982

General Info

Members Datasets Scaffolds Average Seq Length
425 271 406 285

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10060041|Ga0213876_100600412
Length 302
Sequence MTNKEEAQDQMASLKALKIRISSVKSTQKITKAMKMVAAAKLRRAQTAAEAARPYAERMENVVQSIVAKVTIGPESPKLLAGTGSDQCHMLIVCTSDRGLAGGFNSNIVRAARRKAEALIAEGKTVYFYLVGRKGRAVIGRLYPKQILHQHDTSAIKQVSFADAQEIAKDVIDRYLTDGIDVVHLFYARFRSALVQEPVDQQIIPVPRAEAEAAQTSLAAVEYEPDQDEILADLLPRNVAVQIFRALLENAASEQGSRMTAMDNATRNAGDMINRLTIEYNRTRQAAITKELIEIISGAEAL

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
6 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
7 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
8 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
9 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
10 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
11 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
12 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
13 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
14 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
15 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
16 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
258 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
259 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
260 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
263 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
264 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
267 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
270 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
271 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 0.24
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.94
Nodule 0
Rhizoplane 2.12
Rhizosphere 80.24
Stem 0
Stem Tuber 0
Unclassified 8.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10047538 3300001989 Bacteria 1399
2 Ga0055534_1015648 3300003784 Bacteria 1384
3 Ga0055530_10000005 3300003791 Bacteria 206625
4 Ga0070658_10000001 3300005327 Bacteria 856789
5 Ga0070658_10007416 3300005327 Bacteria 8857
6 Ga0070677_10007729 3300005333 Bacteria 3600
7 Ga0070680_100000084 3300005336 Bacteria 51930
8 Ga0068868_100000752 3300005338 Bacteria 21953
9 Ga0070660_100000322 3300005339 Bacteria 31658
10 Ga0070660_100000862 3300005339 Bacteria 20203
11 Ga0070660_100165155 3300005339 Bacteria 1786
12 Ga0070689_100216221 3300005340 Bacteria 1570
13 Ga0070661_100061799 3300005344 Bacteria 2749
14 Ga0070669_100184829 3300005353 Bacteria 1633
15 Ga0070675_100010738 3300005354 Bacteria 7163
16 Ga0070671_100002907 3300005355 Bacteria 13329
17 Ga0070673_100178456 3300005364 Bacteria 1817
18 Ga0070688_100090440 3300005365 Bacteria 1999
19 Ga0070659_100000032 3300005366 Bacteria 120241
20 Ga0070659_100180661 3300005366 Bacteria 1731
21 Ga0070710_10057420 3300005437 Bacteria 2206
22 Ga0070681_10000001 3300005458 Bacteria 946857
23 Ga0070681_10203875 3300005458 Bacteria 1895
24 Ga0070679_100000577 3300005530 Bacteria 31104
25 Ga0070679_100006819 3300005530 Bacteria 10652
26 Ga0070684_100495247 3300005535 Bacteria 1132
27 Ga0068853_100000183 3300005539 Bacteria 44130
28 Ga0068853_100054057 3300005539 Bacteria 3460
29 Ga0070686_100000490 3300005544 Bacteria 23906
30 Ga0070665_100000443 3300005548 Bacteria 60385
31 Ga0070665_100000477 3300005548 Bacteria 57691
32 Ga0070665_100009398 3300005548 Bacteria 9894
33 Ga0070665_100144123 3300005548 Bacteria 2386
34 Ga0070665_100206787 3300005548 Bacteria 1964
35 Ga0070665_100273581 3300005548 Bacteria 1691
36 Ga0070665_100340933 3300005548 Bacteria 1503
37 Ga0068855_100081458 3300005563 Bacteria 3751
38 Ga0068854_100023901 3300005578 Bacteria 4178
39 Ga0068854_100063083 3300005578 Bacteria 2689
40 Ga0068856_100192641 3300005614 Bacteria 2052
41 Ga0068852_100363198 3300005616 Bacteria 1416
42 Ga0068863_100080147 3300005841 Bacteria 3092
43 Ga0068858_100263500 3300005842 Bacteria 1639
44 Ga0081540_1008698 3300005983 Bacteria 7065
45 Ga0081540_1016698 3300005983 Bacteria 4578
46 Ga0075365_10011698 3300006038 Bacteria 5172
47 Ga0075362_10093977 3300006177 Bacteria 1395
48 Ga0075367_10113182 3300006178 Bacteria 1667
49 Ga0075434_100151229 3300006871 Bacteria 2341
50 Ga0075435_100286947 3300007076 Bacteria 1406
51 Ga0105240_10272413 3300009093 Bacteria 1948
52 Ga0105240_10319941 3300009093 Bacteria 1769
53 Ga0105245_10356504 3300009098 Bacteria 1451
54 Ga0114129_10203220 3300009147 Bacteria 2682
55 Ga0114129_10615663 3300009147 Bacteria 1405
56 Ga0105243_10378491 3300009148 Bacteria 1308
57 Ga0105241_10201929 3300009174 Bacteria 1661
58 Ga0105248_10000005 3300009177 Bacteria 673111
59 Ga0105237_10029201 3300009545 Bacteria 5609
60 Ga0105239_10190992 3300010375 Bacteria 2292
61 Ga0105239_10336174 3300010375 Bacteria 1704
62 Ga0157369_10023927 3300013105 Bacteria 6799
63 Ga0157369_10105249 3300013105 Bacteria 3004
64 Ga0157369_10370857 3300013105 Bacteria 1486
65 Ga0157369_10535423 3300013105 Bacteria 1211
66 Ga0157380_10103744 3300014326 Bacteria 2373
67 Ga0206356_11086493 3300020070 Bacteria 1713
68 Ga0213872_10119343 3300021361 Bacteria 1166
69 Ga0213874_10053750 3300021377 Bacteria 1243
70 Ga0213876_10000332 3300021384 Bacteria 41214
71 Ga0213876_10049954 3300021384 Bacteria 2210
72 Ga0213876_10060041 3300021384 Bacteria 2006
73 Ga0209148_1002869 3300025254 Bacteria 5287
74 Ga0209455_1016297 3300025272 Bacteria 1600
75 Ga0209675_1000245 3300025291 Bacteria 53738
76 Ga0209676_1003576 3300025292 Bacteria 9387
77 Ga0209676_1007169 3300025292 Bacteria 5316
78 Ga0209676_1042269 3300025292 Bacteria 1267
79 Ga0209025_1034619 3300025294 Bacteria 2301
80 Ga0209758_1000013 3300025297 Bacteria 873003
81 Ga0209758_1055121 3300025297 Bacteria 1353
82 Ga0209257_1000113 3300025304 Bacteria 233523
83 Ga0209257_1015227 3300025304 Bacteria 3221
84 Ga0207682_10008405 3300025893 Bacteria 4084
85 Ga0207692_10045895 3300025898 Bacteria 2188
86 Ga0207705_10000002 3300025909 Bacteria 2046852
87 Ga0207705_10029768 3300025909 Bacteria 3892
88 Ga0207707_10000001 3300025912 Bacteria 1212482
89 Ga0207707_10278959 3300025912 Bacteria 1448
90 Ga0207695_10030846 3300025913 Bacteria 5897
91 Ga0207695_10137621 3300025913 Bacteria 2394
92 Ga0207671_10054197 3300025914 Bacteria 2972
93 Ga0207693_10041897 3300025915 Bacteria 3604
94 Ga0207660_10003756 3300025917 Bacteria 9887
95 Ga0207657_10000601 3300025919 Bacteria 38257
96 Ga0207657_10028192 3300025919 Bacteria 5128
97 Ga0207657_10080109 3300025919 Bacteria 2746
98 Ga0207652_10000879 3300025921 Bacteria 28409
99 Ga0207652_10019823 3300025921 Bacteria 5537
100 Ga0207681_10192510 3300025923 Bacteria 1561
101 Ga0207650_10033872 3300025925 Bacteria 3703
102 Ga0207659_10377620 3300025926 Bacteria 1181
103 Ga0207664_10156366 3300025929 Bacteria 1941
104 Ga0207664_10531517 3300025929 Bacteria 1054
105 Ga0207644_10007442 3300025931 Bacteria 7139
106 Ga0207690_10000001 3300025932 Bacteria 807539
107 Ga0207690_10030308 3300025932 Bacteria 3449
108 Ga0207706_10176640 3300025933 Bacteria 1876
109 Ga0207670_10097191 3300025936 Bacteria 2096
110 Ga0207669_10122311 3300025937 Bacteria 1770
111 Ga0207691_10057569 3300025940 Bacteria 3537
112 Ga0207711_10000002 3300025941 Bacteria 1228676
113 Ga0207689_10271080 3300025942 Bacteria 1405
114 Ga0207661_10284568 3300025944 Bacteria 1478
115 Ga0207667_10086557 3300025949 Bacteria 3243
116 Ga0207651_10112787 3300025960 Bacteria 2044
117 Ga0207640_10048981 3300025981 Bacteria 2734
118 Ga0207677_10004348 3300026023 Bacteria 7591
119 Ga0207703_10274698 3300026035 Bacteria 1528
120 Ga0207639_10000220 3300026041 Bacteria 42726
121 Ga0207639_10089891 3300026041 Bacteria 2455
122 Ga0207708_10392740 3300026075 Bacteria 1146
123 Ga0207702_10166764 3300026078 Bacteria 2016
124 Ga0207641_10017586 3300026088 Bacteria 5853
125 Ga0207674_10078392 3300026116 Bacteria 3309
126 Ga0207698_10673143 3300026142 Bacteria 1027
127 Ga0209813_10001732 3300027866 Bacteria 4916
128 Ga0268266_10000083 3300028379 Bacteria 202393
129 Ga0268266_10000459 3300028379 Bacteria 59218
130 Ga0268266_10001187 3300028379 Bacteria 32144
131 Ga0268266_10343331 3300028379 Bacteria 1402
132 Ga0268264_10041584 3300028381 Bacteria 3803
133 Ga0265334_10012457 3300028573 Bacteria 3573
134 Ga0265338_10000005 3300028800 Bacteria 571137
135 Ga0265338_10011364 3300028800 Bacteria 10292
136 Ga0265338_10073228 3300028800 Bacteria 2921
137 Ga0265338_10168640 3300028800 Bacteria 1682
138 Ga0265332_10047253 3300031238 Bacteria 1852
139 Ga0265332_10050728 3300031238 Bacteria 1783
140 Ga0265320_10009024 3300031240 Bacteria 6046
141 Ga0265325_10000005 3300031241 Bacteria 321343
142 Ga0265325_10035353 3300031241 Bacteria 2654
143 Ga0265325_10137479 3300031241 Bacteria 1165
144 Ga0265339_10005179 3300031249 Bacteria 8739
145 Ga0265331_10008312 3300031250 Bacteria 5910
146 Ga0265331_10025003 3300031250 Bacteria 3016
147 Ga0307408_100060621 3300031548 Bacteria 2758
148 Ga0265313_10008815 3300031595 Bacteria 6644
149 Ga0265313_10011930 3300031595 Bacteria 5362
150 Ga0265313_10015787 3300031595 Bacteria 4374
151 Ga0307508_10098941 3300031616 Bacteria 2510
152 Ga0265314_10021624 3300031711 Bacteria 4941
153 Ga0265314_10025347 3300031711 Bacteria 4475
154 Ga0265314_10151363 3300031711 Bacteria 1422
155 Ga0307405_10134236 3300031731 Bacteria 1715
156 Ga0307405_10207248 3300031731 Bacteria 1428
157 Ga0307413_10003276 3300031824 Bacteria 6790
158 Ga0307410_10225403 3300031852 Bacteria 1444
159 Ga0307406_10112523 3300031901 Bacteria 1877
160 Ga0307406_10200723 3300031901 Bacteria 1468
161 Ga0307406_10221839 3300031901 Bacteria 1405
162 Ga0307412_10000755 3300031911 Bacteria 18765
163 Ga0307412_10050039 3300031911 Bacteria 2756
164 Ga0307412_10094963 3300031911 Bacteria 2095
165 Ga0307412_10255729 3300031911 Bacteria 1362
166 Ga0307409_100419514 3300031995 Bacteria 1283
167 Ga0307416_100205935 3300032002 Bacteria 1871
168 Ga0307414_10001853 3300032004 Bacteria 10942
169 Ga0307414_10010139 3300032004 Bacteria 5450
170 Ga0307414_10016781 3300032004 Bacteria 4463
171 Ga0307414_10022063 3300032004 Bacteria 4008
172 Ga0307414_10042519 3300032004 Bacteria 3088
173 Ga0307415_100120909 3300032126 Bacteria 1963
174 Ga0307510_10150103 3300033180 Bacteria 1952
175 Ga0373944_0000663 3300035089 Bacteria 8205
176 Ga0373923_0014862 3300035111 Bacteria 2931
177 Ga0373923_0114556 3300035111 Bacteria 1200
178 Ga0373945_0045902 3300035116 Bacteria 1592
179 Ga0373954_0023519 3300035118 Bacteria 2802
180 Ga0373956_0009289 3300035119 Bacteria 3996
181 Ga0373956_0068858 3300035119 Bacteria 1612
182 Ga0373943_0000717 3300035170 Bacteria 14508
183 Ga0373943_0169793 3300035170 Bacteria 1193
184 Ga0373955_0004793 3300035172 Bacteria 6024
185 Ga0373955_0049973 3300035172 Bacteria 2272
186 Ga0373955_0058797 3300035172 Bacteria 2116
187 Ga0373955_0098999 3300035172 Bacteria 1671
188 Ga0373924_0047420 3300035410 Bacteria 1772
189 Ga0373935_0090320 3300035692 Bacteria 2004
190 Ga0373935_0136238 3300035692 Bacteria 1654
191 Ga0373933_0003096 3300035724 Bacteria 9274
192 Ga0373933_0021124 3300035724 Bacteria 3695
193 Ga0373933_0294669 3300035724 Bacteria 1050
194 Ga0373947_0001210 3300035725 Bacteria 15877
195 Ga0373947_0062054 3300035725 Bacteria 2273
196 Ga0373947_0169601 3300035725 Bacteria 1415
197 Ga0373937_0120796 3300036401 Bacteria 2441
198 Ga0373937_0214256 3300036401 Bacteria 1812
199 Ga0373925_0012311 3300037068 Bacteria 6191
200 Ga0373925_0074041 3300037068 Bacteria 2579
201 Ga0373925_0391571 3300037068 Bacteria 1132
202 Ga0395899_0115406 3300037312 Bacteria 1927
203 Ga0395899_0201008 3300037312 Bacteria 1389
204 Ga0395900_0179640 3300037418 Bacteria 2151
205 Ga0395900_0425708 3300037418 Bacteria 1287
206 Ga0395898_0067087 3300037466 Bacteria 3474
207 Ga0395898_0167961 3300037466 Bacteria 2097
208 Ga0395905_0125225 3300037471 Bacteria 2416
209 Ga0395905_0443752 3300037471 Bacteria 1195
210 Ga0436364_0973593 3300037853 Bacteria 1458
211 Ga0436365_0010969 3300039437 Bacteria 175809
212 Ga0436365_1453675 3300039437 Bacteria 1711
213 Ga0436365_1505188 3300039437 Bacteria 1881
214 Ga0436360_0118418 3300039438 Bacteria 2910
215 Ga0436363_0372048 3300039450 Bacteria 1298
216 Ga0466968_0051095 3300044735 Bacteria 1766
217 Ga0466957_0266784 3300044842 Bacteria 1142
218 Ga0466959_0123566 3300045049 Bacteria 1838
219 Ga0451576_0103373 3300045051 Bacteria 2963
220 Ga0451576_0130328 3300045051 Bacteria 2621
221 Ga0451576_0240272 3300045051 Bacteria 1892
222 Ga0466958_0031237 3300045836 Bacteria 3165
223 Ga0466958_0165932 3300045836 Bacteria 1397
224 Ga0466967_0219787 3300045976 Bacteria 1805
225 Ga0495592_0012028 3300046454 Bacteria 6559
226 Ga0495592_0033389 3300046454 Bacteria 3881
227 Ga0495603_0060015 3300046455 Bacteria 2247
228 Ga0495629_0002506 3300046459 Bacteria 14099
229 Ga0495651_0005603 3300046462 Bacteria 9570
230 Ga0495653_0065711 3300046463 Bacteria 2729
231 Ga0495653_0249839 3300046463 Bacteria 1177
232 Ga0495605_0055670 3300046474 Bacteria 1910
233 Ga0495639_0061953 3300046475 Bacteria 1716
234 Ga0495662_0001748 3300046476 Bacteria 10854
235 Ga0495662_0027901 3300046476 Bacteria 2727
236 Ga0495662_0107818 3300046476 Bacteria 1364
237 Ga0495664_0003702 3300046477 Bacteria 8339
238 Ga0495664_0102715 3300046477 Bacteria 1723
239 Ga0495664_0201552 3300046477 Bacteria 1206
240 Ga0495584_0046166 3300046491 Bacteria 2197
241 Ga0495585_0048038 3300046492 Bacteria 2374
242 Ga0495594_0259004 3300046499 Bacteria 991
243 Ga0495608_0004975 3300046511 Bacteria 9510
244 Ga0495608_0292005 3300046511 Bacteria 1010
245 Ga0495616_0000017 3300046513 Bacteria 167324
246 Ga0495618_0006095 3300046514 Bacteria 7313
247 Ga0495618_0008522 3300046514 Bacteria 6199
248 Ga0495628_0060808 3300046516 Bacteria 2963
249 Ga0495628_0211544 3300046516 Bacteria 1458
250 Ga0495630_0163700 3300046517 Bacteria 1693
251 Ga0495630_0190354 3300046517 Bacteria 1565
252 Ga0495666_0059238 3300046526 Bacteria 1831
253 Ga0495666_0072211 3300046526 Bacteria 1639
254 Ga0495642_0098367 3300046528 Bacteria 1243
255 Ga0495652_0007492 3300046529 Bacteria 10059
256 Ga0495652_0044599 3300046529 Bacteria 3817
257 Ga0495652_0221026 3300046529 Bacteria 1423
258 Ga0495654_0089447 3300046530 Bacteria 1431
259 Ga0495665_0064362 3300046531 Bacteria 1935
260 Ga0495665_0124960 3300046531 Bacteria 1347
261 Ga0495640_0001002 3300046533 Bacteria 21866
262 Ga0495640_0021200 3300046533 Bacteria 4772
263 Ga0495640_0085117 3300046533 Bacteria 2095
264 Ga0495640_0134992 3300046533 Bacteria 1594
265 Ga0495587_0006136 3300046536 Bacteria 7840
266 Ga0495587_0023338 3300046536 Bacteria 3801
267 Ga0495645_0012008 3300046543 Bacteria 6104
268 Ga0495645_0044812 3300046543 Bacteria 3226
269 Ga0495622_0010255 3300046557 Bacteria 4332
270 Ga0495622_0070766 3300046557 Bacteria 1610
271 Ga0495667_0000595 3300046559 Bacteria 23008
272 Ga0495656_0003266 3300046615 Bacteria 5471
273 Ga0495656_0046612 3300046615 Bacteria 1835
274 Ga0495668_0000004 3300046616 Bacteria 574236
275 Ga0495634_0070632 3300046642 Bacteria 2301
276 Ga0495625_0014924 3300046660 Bacteria 6177
277 Ga0495635_0000375 3300046663 Bacteria 28276
278 Ga0495635_0009867 3300046663 Bacteria 6672
279 Ga0495657_0016147 3300046675 Bacteria 5444
280 Ga0495599_0007301 3300046678 Bacteria 6694
281 Ga0495599_0042044 3300046678 Bacteria 2868
282 Ga0495623_0000847 3300046679 Bacteria 20690
283 Ga0495623_0083593 3300046679 Bacteria 1971
284 Ga0495646_0025588 3300046680 Bacteria 3712
285 Ga0495646_0040684 3300046680 Bacteria 2861
286 Ga0495646_0101554 3300046680 Bacteria 1648
287 Ga0495647_0008990 3300046681 Bacteria 3370
288 Ga0495658_0010718 3300046683 Bacteria 4590
289 Ga0495613_0103602 3300046689 Bacteria 2054
290 Ga0495624_0003125 3300046690 Bacteria 12373
291 Ga0495624_0072841 3300046690 Bacteria 2136
292 Ga0495624_0169886 3300046690 Bacteria 1330
293 Ga0495671_0006427 3300046692 Bacteria 6786
294 Ga0495649_0024218 3300046694 Bacteria 3386
295 Ga0495600_0000264 3300046809 Bacteria 28757
296 Ga0495600_0222642 3300046809 Bacteria 1206
297 Ga0495581_0007765 3300047315 Bacteria 6209
298 Ga0495604_0000130 3300047317 Bacteria 63418
299 Ga0495674_0003109 3300047319 Bacteria 16124
300 Ga0495676_0016319 3300047321 Bacteria 6596
301 Ga0495676_0105629 3300047321 Bacteria 2076
302 Ga0495680_0006651 3300047322 Bacteria 10703
303 Ga0495680_0021485 3300047322 Bacteria 5401
304 Ga0495675_0105045 3300047444 Bacteria 1765
305 Ga0495684_0121321 3300047471 Bacteria 1968
306 Ga0495684_0280825 3300047471 Bacteria 1201
307 Ga0495593_0056018 3300047673 Bacteria 2073
308 Ga0495602_0000910 3300048088 Bacteria 28607
309 Ga0496100_0129266 3300048903 Bacteria 1777
310 Ga0496107_0148081 3300048910 Bacteria 1736
311 Ga0496107_0228254 3300048910 Bacteria 1385
312 Ga0496110_0452894 3300048913 Bacteria 1169
313 Ga0496112_0004430 3300048915 Bacteria 11892
314 Ga0496114_0058870 3300048917 Bacteria 3208
315 Ga0496115_0006959 3300048918 Bacteria 8307
316 Ga0496115_0247085 3300048918 Bacteria 1470
317 Ga0496117_0009044 3300048920 Bacteria 9366
318 Ga0496117_0166979 3300048920 Bacteria 1282
319 Ga0496119_0040304 3300048922 Bacteria 2989
320 Ga0496119_0066579 3300048922 Bacteria 2128
321 Ga0496120_0042076 3300048923 Bacteria 2670
322 Ga0496120_0064252 3300048923 Bacteria 2038
323 Ga0496121_0106372 3300048924 Bacteria 2151
324 Ga0496122_0000306 3300048925 Bacteria 108166
325 Ga0496123_0001592 3300048926 Bacteria 30871
326 Ga0496124_0004042 3300048927 Bacteria 17417
327 Ga0496124_0112082 3300048927 Bacteria 2194
328 Ga0496125_0131456 3300048928 Bacteria 1761
329 Ga0496126_0302121 3300048929 Bacteria 1320
330 Ga0496126_0517442 3300048929 Bacteria 951
331 Ga0501032_0036007 3300049569 Bacteria 3380
332 Ga0501033_0156735 3300049570 Bacteria 1640
333 Ga0501033_0162665 3300049570 Bacteria 1606
334 Ga0501034_0101595 3300049571 Bacteria 2869
335 Ga0501034_0102424 3300049571 Bacteria 2856
336 Ga0501034_0171996 3300049571 Bacteria 2133
337 Ga0501034_0223173 3300049571 Bacteria 1836
338 Ga0501036_0052857 3300049572 Bacteria 3440
339 Ga0501036_0304442 3300049572 Bacteria 1333
340 Ga0501036_0413480 3300049572 Bacteria 1125
341 Ga0501037_0236144 3300049573 Bacteria 1282
342 Ga0501038_0049178 3300049574 Bacteria 3646
343 Ga0501038_0131080 3300049574 Bacteria 2058
344 Ga0501038_0206446 3300049574 Bacteria 1574
345 Ga0501039_0056777 3300049575 Bacteria 3033
346 Ga0501039_0274480 3300049575 Bacteria 1325
347 Ga0501043_0069682 3300049579 Bacteria 2762
348 Ga0501043_0189212 3300049579 Bacteria 1601
349 Ga0501046_0023011 3300049580 Bacteria 5130
350 Ga0501046_0121797 3300049580 Bacteria 1984
351 Ga0501047_0029027 3300049581 Bacteria 5335
352 Ga0501047_0180859 3300049581 Bacteria 1975
353 Ga0501047_0264199 3300049581 Bacteria 1568
354 Ga0501047_0407869 3300049581 Bacteria 1191
355 Ga0501047_0444294 3300049581 Bacteria 1126
356 Ga0501068_0043678 3300049584 Bacteria 2697
357 Ga0501069_0034249 3300049585 Bacteria 2797
358 Ga0501070_0078899 3300049586 Bacteria 2724
359 Ga0501071_0140465 3300049587 Bacteria 1798
360 Ga0501073_0079153 3300049589 Bacteria 2287
361 Ga0501080_0037772 3300049742 Bacteria 4509
362 Ga0501080_0151243 3300049742 Bacteria 2145
363 Ga0501035_0052796 3300049822 Bacteria 3636
364 Ga0501035_0196686 3300049822 Bacteria 1731
365 Ga0501044_0000398 3300049823 Bacteria 53733
366 Ga0501044_0002015 3300049823 Bacteria 23423
367 Ga0501044_0073055 3300049823 Bacteria 3486
368 Ga0501044_0214686 3300049823 Bacteria 1877
369 Ga0501045_0004946 3300049824 Bacteria 9234
370 nmdc:mga03683_49878_c1 3300050489 Bacteria 1744
371 nmdc:mga05p37_662093_c1 3300050507 Bacteria 1167
372 nmdc:mga08y16_386407_c1 3300050511 Bacteria 1434
373 nmdc:mga0n895_202561_c1 3300050512 Bacteria 2015
374 nmdc:mga0n895_43840_c1 3300050512 Bacteria 4361
375 nmdc:mga0rr50_120135_c1 3300050513 Bacteria 2090
376 nmdc:mga0a205_102201_c1 3300050515 Bacteria 2174
377 nmdc:mga0a205_190174_c1 3300050515 Bacteria 1945
378 Ga0495601_0008991 3300053077 Bacteria 5897
379 Ga0495601_0032115 3300053077 Bacteria 3266
380 Ga0495612_0000597 3300053078 Bacteria 14498
381 Ga0495612_0006632 3300053078 Bacteria 4748
382 Ga0495595_0003518 3300053084 Bacteria 6216
383 Ga0495595_0026891 3300053084 Bacteria 2559
384 Ga0495619_0001313 3300053085 Bacteria 16327
385 Ga0495619_0001707 3300053085 Bacteria 14549
386 Ga0495619_0029723 3300053085 Bacteria 3532
387 Ga0500643_001306 3300053087 Bacteria 14670
388 Ga0500646_0055016 3300053090 Bacteria 1157
389 Ga0500554_080115 3300053102 Bacteria 1074
390 Ga0500593_042997 3300053117 Bacteria 2017
391 Ga0500595_000260 3300053119 Bacteria 35035
392 Ga0500595_012016 3300053119 Bacteria 3360
393 Ga0500568_0000005 3300053139 Bacteria 614296
394 Ga0500568_0019395 3300053139 Bacteria 2956
395 Ga0500568_0029743 3300053139 Bacteria 2264
396 Ga0500573_0000012 3300053140 Bacteria 208486
397 Ga0500577_0049198 3300053142 Bacteria 1575
398 Ga0500604_0000124 3300053151 Bacteria 23474
399 Ga0500616_0011459 3300053153 Bacteria 5233
400 Ga0500616_0069753 3300053153 Bacteria 1796
401 Ga0500627_0012763 3300053158 Bacteria 3160
402 Ga0500627_0049999 3300053158 Bacteria 1820
403 Ga0500638_000558 3300053162 Bacteria 9441
404 Ga0500637_0012895 3300053178 Bacteria 4365
405 Ga0500587_002173 3300053739 Bacteria 2795
406 Ga0500661_006815 3300055283 Bacteria 2123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100060621 Ga0307408_1000606212 235
2 3300031731 Ga0307405_10207248 Ga0307405_102072482 235
3 3300031901 Ga0307406_10112523 Ga0307406_101125232 235
4 3300031911 Ga0307412_10255729 Ga0307412_102557292 235
5 3300032002 Ga0307416_100205935 Ga0307416_1002059352 235
6 3300032126 Ga0307415_100120909 Ga0307415_1001209092 235
7 3300005338 Ga0068868_100000752 Ga0068868_1000007522 241
8 3300005339 Ga0070660_100000322 Ga0070660_10000032238 241
9 3300005354 Ga0070675_100010738 Ga0070675_1000107383 241
10 3300005366 Ga0070659_100000032 Ga0070659_10000003230 241
11 3300025919 Ga0207657_10000601 Ga0207657_1000060145 241
12 3300025932 Ga0207690_10000001 Ga0207690_10000001800 241
13 3300026023 Ga0207677_10004348 Ga0207677_100043482 241
14 3300048929 Ga0496126_0517442 Ga0496126_0517442_198_932 243
15 3300005333 Ga0070677_10007729 Ga0070677_100077292 244
16 3300025893 Ga0207682_10008405 Ga0207682_100084052 244
17 3300045051 Ga0451576_0240272 Ga0451576_0240272_507_1382 251
18 3300046477 Ga0495664_0201552 Ga0495664_0201552_19_822 252
19 3300025304 Ga0209257_1015227 Ga0209257_10152272 257
20 3300005548 Ga0070665_100009398 Ga0070665_1000093987 258
21 3300028379 Ga0268266_10000459 Ga0268266_1000045926 258
22 3300031901 Ga0307406_10200723 Ga0307406_102007232 264
23 3300032004 Ga0307414_10042519 Ga0307414_100425192 264
24 3300048925 Ga0496122_0000306 Ga0496122_0000306_40173_41048 264
25 3300048926 Ga0496123_0001592 Ga0496123_0001592_4336_5211 264
26 3300039437 Ga0436365_1453675 Ga0436365_1453675_58_912 265
27 3300046499 Ga0495594_0259004 Ga0495594_0259004_17_820 265
28 3300048920 Ga0496117_0166979 Ga0496117_0166979_24_827 265
29 3300005578 Ga0068854_100063083 Ga0068854_1000630833 266
30 3300048910 Ga0496107_0228254 Ga0496107_0228254_27_905 266
31 3300005983 Ga0081540_1008698 Ga0081540_10086985 267
32 3300005983 Ga0081540_1016698 Ga0081540_10166983 267
33 3300046476 Ga0495662_0107818 Ga0495662_0107818_15_824 267
34 3300046543 Ga0495645_0044812 Ga0495645_0044812_2398_3207 267
35 3300053102 Ga0500554_080115 Ga0500554_080115_16_825 267
36 3300005578 Ga0068854_100023901 Ga0068854_1000239012 268
37 3300009545 Ga0105237_10029201 Ga0105237_100292015 268
38 3300010375 Ga0105239_10336174 Ga0105239_103361742 268
39 3300025254 Ga0209148_1002869 Ga0209148_10028694 268
40 3300025272 Ga0209455_1016297 Ga0209455_10162971 268
41 3300025914 Ga0207671_10054197 Ga0207671_100541972 268
42 3300025926 Ga0207659_10377620 Ga0207659_103776202 268
43 3300025981 Ga0207640_10048981 Ga0207640_100489812 268
44 3300031731 Ga0307405_10134236 Ga0307405_101342362 268
45 3300031824 Ga0307413_10003276 Ga0307413_100032762 268
46 3300031852 Ga0307410_10225403 Ga0307410_102254032 268
47 3300031901 Ga0307406_10221839 Ga0307406_102218392 268
48 3300031911 Ga0307412_10000755 Ga0307412_100007553 268
49 3300032004 Ga0307414_10010139 Ga0307414_100101394 268
50 3300048923 Ga0496120_0042076 Ga0496120_0042076_965_1840 268
51 3300048927 Ga0496124_0004042 Ga0496124_0004042_1135_2010 268
52 3300048928 Ga0496125_0131456 Ga0496125_0131456_569_1444 268
53 3300005539 Ga0068853_100000183 Ga0068853_10000018317 269
54 3300005616 Ga0068852_100363198 Ga0068852_1003631982 269
55 3300026041 Ga0207639_10000220 Ga0207639_1000022034 269
56 3300026116 Ga0207674_10078392 Ga0207674_100783922 269
57 3300032004 Ga0307414_10001853 Ga0307414_1000185311 269
58 3300025292 Ga0209676_1042269 Ga0209676_10422692 270
59 3300048929 Ga0496126_0302121 Ga0496126_0302121_166_1038 270
60 3300003784 Ga0055534_1015648 Ga0055534_10156482 271
61 3300003791 Ga0055530_10000005 Ga0055530_10000005139 271
62 3300025291 Ga0209675_1000245 Ga0209675_100024513 271
63 3300025292 Ga0209676_1003576 Ga0209676_10035762 271
64 3300025292 Ga0209676_1007169 Ga0209676_10071694 271
65 3300025294 Ga0209025_1034619 Ga0209025_10346192 271
66 3300025297 Ga0209758_1055121 Ga0209758_10551212 271
67 3300025304 Ga0209257_1000113 Ga0209257_100011338 271
68 3300031911 Ga0307412_10050039 Ga0307412_100500392 271
69 3300031911 Ga0307412_10094963 Ga0307412_100949632 271
70 3300032004 Ga0307414_10016781 Ga0307414_100167812 271
71 3300039450 Ga0436363_0372048 Ga0436363_0372048_158_1036 271
72 3300046660 Ga0495625_0014924 Ga0495625_0014924_1220_2095 271
73 3300049569 Ga0501032_0036007 Ga0501032_0036007_1174_2049 271
74 3300049570 Ga0501033_0156735 Ga0501033_0156735_745_1620 271
75 3300049572 Ga0501036_0052857 Ga0501036_0052857_362_1237 271
76 3300049574 Ga0501038_0131080 Ga0501038_0131080_634_1509 271
77 3300049575 Ga0501039_0056777 Ga0501039_0056777_899_1774 271
78 3300049581 Ga0501047_0444294 Ga0501047_0444294_167_1042 271
79 3300053139 Ga0500568_0019395 Ga0500568_0019395_1238_2113 271
80 3300037312 Ga0395899_0201008 Ga0395899_0201008_96_968 272
81 3300037418 Ga0395900_0425708 Ga0395900_0425708_107_979 272
82 3300037466 Ga0395898_0067087 Ga0395898_0067087_2507_3379 272
83 3300037466 Ga0395898_0167961 Ga0395898_0167961_1130_2002 272
84 3300045051 Ga0451576_0103373 Ga0451576_0103373_1020_1907 274
85 3300048922 Ga0496119_0066579 Ga0496119_0066579_1109_1942 274
86 3300046530 Ga0495654_0089447 Ga0495654_0089447_533_1405 275
87 3300046616 Ga0495668_0000004 Ga0495668_0000004_361299_362174 275
88 3300049822 Ga0501035_0196686 Ga0501035_0196686_889_1719 275
89 3300032004 Ga0307414_10022063 Ga0307414_100220633 280
90 3300049571 Ga0501034_0101595 Ga0501034_0101595_831_1712 280
91 3300049572 Ga0501036_0413480 Ga0501036_0413480_182_1063 280
92 3300049581 Ga0501047_0264199 Ga0501047_0264199_644_1489 280
93 3300049585 Ga0501069_0034249 Ga0501069_0034249_1005_1886 280
94 3300049742 Ga0501080_0151243 Ga0501080_0151243_563_1408 280
95 3300046513 Ga0495616_0000017 Ga0495616_0000017_117177_118052 281
96 3300053158 Ga0500627_0012763 Ga0500627_0012763_1306_2181 281
97 3300053158 Ga0500627_0049999 Ga0500627_0049999_433_1308 281
98 3300046557 Ga0495622_0010255 Ga0495622_0010255_2821_3693 282
99 3300046692 Ga0495671_0006427 Ga0495671_0006427_546_1418 282
100 3300005353 Ga0070669_100184829 Ga0070669_1001848292 283
101 3300014326 Ga0157380_10103744 Ga0157380_101037442 283
102 3300025923 Ga0207681_10192510 Ga0207681_101925102 283
103 3300053087 Ga0500643_001306 Ga0500643_001306_12703_13575 283
104 3300050489 nmdc:mga03683_49878_c1 nmdc:mga03683_49878_c1_870_1730 284
105 3300053119 Ga0500595_012016 Ga0500595_012016_1119_1979 284
106 3300053162 Ga0500638_000558 Ga0500638_000558_7945_8805 284
107 3300053178 Ga0500637_0012895 Ga0500637_0012895_2076_2936 284
108 3300055283 Ga0500661_006815 Ga0500661_006815_756_1616 284
109 iso_pu_bacteria 2919138771 2919140178 285
110 3300005336 Ga0070680_100000084 Ga0070680_10000008436 286
111 3300005458 Ga0070681_10000001 Ga0070681_10000001562 286
112 3300005530 Ga0070679_100000577 Ga0070679_1000005775 286
113 3300005548 Ga0070665_100340933 Ga0070665_1003409332 286
114 3300009093 Ga0105240_10319941 Ga0105240_103199412 286
115 3300009174 Ga0105241_10201929 Ga0105241_102019292 286
116 3300009177 Ga0105248_10000005 Ga0105248_10000005704 286
117 3300010375 Ga0105239_10190992 Ga0105239_101909922 286
118 3300013105 Ga0157369_10105249 Ga0157369_101052494 286
119 3300025297 Ga0209758_1000013 Ga0209758_1000013494 286
120 3300025912 Ga0207707_10000001 Ga0207707_10000001246 286
121 3300025917 Ga0207660_10003756 Ga0207660_100037562 286
122 3300025921 Ga0207652_10000879 Ga0207652_1000087928 286
123 3300025941 Ga0207711_10000002 Ga0207711_10000002701 286
124 3300026041 Ga0207639_10089891 Ga0207639_100898912 286
125 3300026142 Ga0207698_10673143 Ga0207698_106731431 286
126 3300028573 Ga0265334_10012457 Ga0265334_100124571 286
127 3300028800 Ga0265338_10000005 Ga0265338_10000005207 286
128 3300031238 Ga0265332_10047253 Ga0265332_100472532 286
129 3300031241 Ga0265325_10000005 Ga0265325_10000005310 286
130 3300031249 Ga0265339_10005179 Ga0265339_100051794 286
131 3300031250 Ga0265331_10008312 Ga0265331_100083127 286
132 3300031595 Ga0265313_10008815 Ga0265313_100088152 286
133 3300037312 Ga0395899_0115406 Ga0395899_0115406_422_1294 286
134 3300037418 Ga0395900_0179640 Ga0395900_0179640_1201_2073 286
135 3300037471 Ga0395905_0125225 Ga0395905_0125225_821_1693 286
136 3300037471 Ga0395905_0443752 Ga0395905_0443752_144_1016 286
137 3300044735 Ga0466968_0051095 Ga0466968_0051095_283_1155 286
138 3300048918 Ga0496115_0247085 Ga0496115_0247085_350_1213 286
139 3300049581 Ga0501047_0180859 Ga0501047_0180859_548_1411 286
140 iso_pu_bacteria 2599185359 2600227345 286
141 iso_pu_bacteria 2643221560 2643820470 286
142 iso_pu_bacteria 2643221563 2643836289 286
143 iso_pu_bacteria 2643221608 2644052766 286
144 iso_pu_bacteria 2738541275 2738709415 286
145 iso_pu_bacteria 2738541301 2738847840 286
146 iso_pu_bacteria 2738541304 2738863569 286
147 iso_pu_bacteria 2738543022 2739296087 286
148 iso_pu_bacteria 2738543033 2739357765 286
149 iso_pu_bacteria 2818991466 2819715874 286
150 iso_pu_bacteria 2852653556 2852653901 286
151 iso_pu_bacteria 2852680915 2852682702 286
152 iso_pu_bacteria 2879163058 2879163360 286
153 iso_pu_bacteria 2928100450 2928102553 286
154 iso_pu_bacteria 2928526807 2928529918 286
155 iso_pu_bacteria 2928959182 2928959361 286
156 iso_pu_bacteria 2928968154 2928970664 286
157 iso_pu_bacteria 8001845381 8001846926 286
158 3300028800 Ga0265338_10073228 Ga0265338_100732281 287
159 3300031241 Ga0265325_10035353 Ga0265325_100353532 287
160 3300031595 Ga0265313_10015787 Ga0265313_100157873 287
161 3300049571 Ga0501034_0171996 Ga0501034_0171996_1257_2120 287
162 3300049571 Ga0501034_0223173 Ga0501034_0223173_620_1483 287
163 3300053119 Ga0500595_000260 Ga0500595_000260_19676_20542 287
164 3300005327 Ga0070658_10000001 Ga0070658_10000001212 288
165 3300005327 Ga0070658_10007416 Ga0070658_100074162 288
166 3300005339 Ga0070660_100000862 Ga0070660_1000008625 288
167 3300005339 Ga0070660_100165155 Ga0070660_1001651552 288
168 3300005344 Ga0070661_100061799 Ga0070661_1000617992 288
169 3300005366 Ga0070659_100180661 Ga0070659_1001806612 288
170 3300005458 Ga0070681_10203875 Ga0070681_102038752 288
171 3300005530 Ga0070679_100006819 Ga0070679_10000681911 288
172 3300005548 Ga0070665_100000443 Ga0070665_1000004432 288
173 3300005548 Ga0070665_100273581 Ga0070665_1002735812 288
174 3300005563 Ga0068855_100081458 Ga0068855_1000814582 288
175 3300005614 Ga0068856_100192641 Ga0068856_1001926412 288
176 3300009093 Ga0105240_10272413 Ga0105240_102724132 288
177 3300013105 Ga0157369_10535423 Ga0157369_105354232 288
178 3300021377 Ga0213874_10053750 Ga0213874_100537502 288
179 3300021384 Ga0213876_10000332 Ga0213876_100003324 288
180 3300025909 Ga0207705_10000002 Ga0207705_100000021667 288
181 3300025909 Ga0207705_10029768 Ga0207705_100297682 288
182 3300025912 Ga0207707_10278959 Ga0207707_102789591 288
183 3300025913 Ga0207695_10030846 Ga0207695_100308466 288
184 3300025913 Ga0207695_10137621 Ga0207695_101376212 288
185 3300025919 Ga0207657_10028192 Ga0207657_100281922 288
186 3300025919 Ga0207657_10080109 Ga0207657_100801092 288
187 3300025921 Ga0207652_10019823 Ga0207652_100198232 288
188 3300025932 Ga0207690_10030308 Ga0207690_100303082 288
189 3300025949 Ga0207667_10086557 Ga0207667_100865572 288
190 3300026078 Ga0207702_10166764 Ga0207702_101667642 288
191 3300028379 Ga0268266_10001187 Ga0268266_100011876 288
192 3300028800 Ga0265338_10011364 Ga0265338_100113642 288
193 3300031238 Ga0265332_10050728 Ga0265332_100507282 288
194 3300031250 Ga0265331_10025003 Ga0265331_100250032 288
195 3300031711 Ga0265314_10021624 Ga0265314_100216242 288
196 3300035172 Ga0373955_0098999 Ga0373955_0098999_546_1415 288
197 3300037853 Ga0436364_0973593 Ga0436364_0973593_85_957 288
198 3300039437 Ga0436365_0010969 Ga0436365_0010969_46794_47672 288
199 3300045836 Ga0466958_0165932 Ga0466958_0165932_28_900 288
200 3300049574 Ga0501038_0206446 Ga0501038_0206446_584_1453 288
201 3300049575 Ga0501039_0274480 Ga0501039_0274480_321_1190 288
202 3300049579 Ga0501043_0189212 Ga0501043_0189212_183_1052 288
203 3300049580 Ga0501046_0121797 Ga0501046_0121797_328_1197 288
204 3300049581 Ga0501047_0029027 Ga0501047_0029027_712_1581 288
205 3300049823 Ga0501044_0002015 Ga0501044_0002015_2067_2936 288
206 3300053140 Ga0500573_0000012 Ga0500573_0000012_163846_164715 288
207 3300005548 Ga0070665_100206787 Ga0070665_1002067872 289
208 3300006177 Ga0075362_10093977 Ga0075362_100939772 289
209 3300009148 Ga0105243_10378491 Ga0105243_103784912 289
210 3300021384 Ga0213876_10049954 Ga0213876_100499542 289
211 3300026075 Ga0207708_10392740 Ga0207708_103927401 289
212 3300031616 Ga0307508_10098941 Ga0307508_100989412 289
213 3300033180 Ga0307510_10150103 Ga0307510_101501033 289
214 3300049586 Ga0501070_0078899 Ga0501070_0078899_653_1534 289
215 3300049823 Ga0501044_0214686 Ga0501044_0214686_609_1490 289
216 3300005340 Ga0070689_100216221 Ga0070689_1002162212 290
217 3300005355 Ga0070671_100002907 Ga0070671_10000290710 290
218 3300005364 Ga0070673_100178456 Ga0070673_1001784562 290
219 3300005365 Ga0070688_100090440 Ga0070688_1000904402 290
220 3300005437 Ga0070710_10057420 Ga0070710_100574202 290
221 3300005548 Ga0070665_100144123 Ga0070665_1001441232 290
222 3300005842 Ga0068858_100263500 Ga0068858_1002635002 290
223 3300006038 Ga0075365_10011698 Ga0075365_100116983 290
224 3300006178 Ga0075367_10113182 Ga0075367_101131822 290
225 3300006871 Ga0075434_100151229 Ga0075434_1001512292 290
226 3300007076 Ga0075435_100286947 Ga0075435_1002869472 290
227 3300009098 Ga0105245_10356504 Ga0105245_103565041 290
228 3300009147 Ga0114129_10203220 Ga0114129_102032203 290
229 3300009147 Ga0114129_10615663 Ga0114129_106156632 290
230 3300013105 Ga0157369_10023927 Ga0157369_100239272 290
231 3300025898 Ga0207692_10045895 Ga0207692_100458952 290
232 3300025915 Ga0207693_10041897 Ga0207693_100418971 290
233 3300025925 Ga0207650_10033872 Ga0207650_100338722 290
234 3300025929 Ga0207664_10156366 Ga0207664_101563662 290
235 3300025929 Ga0207664_10531517 Ga0207664_105315171 290
236 3300025931 Ga0207644_10007442 Ga0207644_100074426 290
237 3300025933 Ga0207706_10176640 Ga0207706_101766402 290
238 3300025936 Ga0207670_10097191 Ga0207670_100971912 290
239 3300025940 Ga0207691_10057569 Ga0207691_100575692 290
240 3300025942 Ga0207689_10271080 Ga0207689_102710802 290
241 3300025960 Ga0207651_10112787 Ga0207651_101127872 290
242 3300026035 Ga0207703_10274698 Ga0207703_102746982 290
243 3300027866 Ga0209813_10001732 Ga0209813_100017322 290
244 3300028379 Ga0268266_10343331 Ga0268266_103433311 290
245 3300035089 Ga0373944_0000663 Ga0373944_0000663_5746_6624 290
246 3300035111 Ga0373923_0014862 Ga0373923_0014862_1166_2044 290
247 3300035111 Ga0373923_0114556 Ga0373923_0114556_51_932 290
248 3300035116 Ga0373945_0045902 Ga0373945_0045902_52_933 290
249 3300035118 Ga0373954_0023519 Ga0373954_0023519_1127_2005 290
250 3300035119 Ga0373956_0009289 Ga0373956_0009289_138_1016 290
251 3300035119 Ga0373956_0068858 Ga0373956_0068858_659_1537 290
252 3300035170 Ga0373943_0000717 Ga0373943_0000717_9500_10378 290
253 3300035170 Ga0373943_0169793 Ga0373943_0169793_25_903 290
254 3300035172 Ga0373955_0004793 Ga0373955_0004793_4365_5243 290
255 3300035172 Ga0373955_0049973 Ga0373955_0049973_797_1675 290
256 3300035172 Ga0373955_0058797 Ga0373955_0058797_664_1542 290
257 3300035410 Ga0373924_0047420 Ga0373924_0047420_675_1553 290
258 3300035692 Ga0373935_0090320 Ga0373935_0090320_340_1221 290
259 3300035692 Ga0373935_0136238 Ga0373935_0136238_639_1517 290
260 3300035724 Ga0373933_0003096 Ga0373933_0003096_3631_4509 290
261 3300035724 Ga0373933_0021124 Ga0373933_0021124_598_1476 290
262 3300035724 Ga0373933_0294669 Ga0373933_0294669_107_988 290
263 3300035725 Ga0373947_0001210 Ga0373947_0001210_5200_6078 290
264 3300035725 Ga0373947_0062054 Ga0373947_0062054_777_1655 290
265 3300035725 Ga0373947_0169601 Ga0373947_0169601_283_1161 290
266 3300036401 Ga0373937_0120796 Ga0373937_0120796_1017_1895 290
267 3300036401 Ga0373937_0214256 Ga0373937_0214256_153_1031 290
268 3300037068 Ga0373925_0012311 Ga0373925_0012311_4850_5728 290
269 3300037068 Ga0373925_0074041 Ga0373925_0074041_257_1135 290
270 3300037068 Ga0373925_0391571 Ga0373925_0391571_133_1014 290
271 3300039438 Ga0436360_0118418 Ga0436360_0118418_1360_2238 290
272 3300044842 Ga0466957_0266784 Ga0466957_0266784_247_1125 290
273 3300045049 Ga0466959_0123566 Ga0466959_0123566_935_1813 290
274 3300045051 Ga0451576_0130328 Ga0451576_0130328_380_1258 290
275 3300045836 Ga0466958_0031237 Ga0466958_0031237_238_1116 290
276 3300045976 Ga0466967_0219787 Ga0466967_0219787_527_1405 290
277 3300046454 Ga0495592_0012028 Ga0495592_0012028_1833_2711 290
278 3300046454 Ga0495592_0033389 Ga0495592_0033389_1160_2038 290
279 3300046455 Ga0495603_0060015 Ga0495603_0060015_653_1534 290
280 3300046459 Ga0495629_0002506 Ga0495629_0002506_2612_3490 290
281 3300046462 Ga0495651_0005603 Ga0495651_0005603_768_1646 290
282 3300046463 Ga0495653_0065711 Ga0495653_0065711_512_1390 290
283 3300046463 Ga0495653_0249839 Ga0495653_0249839_263_1141 290
284 3300046474 Ga0495605_0055670 Ga0495605_0055670_563_1444 290
285 3300046475 Ga0495639_0061953 Ga0495639_0061953_358_1239 290
286 3300046476 Ga0495662_0001748 Ga0495662_0001748_6765_7646 290
287 3300046476 Ga0495662_0027901 Ga0495662_0027901_1471_2352 290
288 3300046477 Ga0495664_0003702 Ga0495664_0003702_5513_6394 290
289 3300046477 Ga0495664_0102715 Ga0495664_0102715_585_1463 290
290 3300046491 Ga0495584_0046166 Ga0495584_0046166_780_1661 290
291 3300046492 Ga0495585_0048038 Ga0495585_0048038_918_1799 290
292 3300046511 Ga0495608_0004975 Ga0495608_0004975_6393_7271 290
293 3300046511 Ga0495608_0292005 Ga0495608_0292005_32_913 290
294 3300046514 Ga0495618_0006095 Ga0495618_0006095_755_1636 290
295 3300046514 Ga0495618_0008522 Ga0495618_0008522_4627_5505 290
296 3300046516 Ga0495628_0060808 Ga0495628_0060808_1639_2517 290
297 3300046516 Ga0495628_0211544 Ga0495628_0211544_126_1004 290
298 3300046517 Ga0495630_0163700 Ga0495630_0163700_508_1386 290
299 3300046517 Ga0495630_0190354 Ga0495630_0190354_549_1430 290
300 3300046526 Ga0495666_0059238 Ga0495666_0059238_433_1311 290
301 3300046526 Ga0495666_0072211 Ga0495666_0072211_526_1407 290
302 3300046529 Ga0495652_0007492 Ga0495652_0007492_791_1669 290
303 3300046529 Ga0495652_0044599 Ga0495652_0044599_257_1138 290
304 3300046529 Ga0495652_0221026 Ga0495652_0221026_263_1141 290
305 3300046531 Ga0495665_0064362 Ga0495665_0064362_487_1365 290
306 3300046531 Ga0495665_0124960 Ga0495665_0124960_15_896 290
307 3300046533 Ga0495640_0001002 Ga0495640_0001002_10736_11617 290
308 3300046533 Ga0495640_0021200 Ga0495640_0021200_2544_3422 290
309 3300046533 Ga0495640_0085117 Ga0495640_0085117_382_1260 290
310 3300046533 Ga0495640_0134992 Ga0495640_0134992_532_1413 290
311 3300046536 Ga0495587_0006136 Ga0495587_0006136_2198_3076 290
312 3300046536 Ga0495587_0023338 Ga0495587_0023338_2714_3592 290
313 3300046543 Ga0495645_0012008 Ga0495645_0012008_5042_5923 290
314 3300046557 Ga0495622_0070766 Ga0495622_0070766_564_1445 290
315 3300046559 Ga0495667_0000595 Ga0495667_0000595_21148_22026 290
316 3300046615 Ga0495656_0003266 Ga0495656_0003266_454_1335 290
317 3300046615 Ga0495656_0046612 Ga0495656_0046612_849_1727 290
318 3300046642 Ga0495634_0070632 Ga0495634_0070632_785_1663 290
319 3300046663 Ga0495635_0000375 Ga0495635_0000375_20113_20994 290
320 3300046663 Ga0495635_0009867 Ga0495635_0009867_2410_3288 290
321 3300046675 Ga0495657_0016147 Ga0495657_0016147_1109_1987 290
322 3300046678 Ga0495599_0007301 Ga0495599_0007301_3713_4591 290
323 3300046678 Ga0495599_0042044 Ga0495599_0042044_518_1396 290
324 3300046679 Ga0495623_0000847 Ga0495623_0000847_9000_9878 290
325 3300046679 Ga0495623_0083593 Ga0495623_0083593_282_1160 290
326 3300046680 Ga0495646_0025588 Ga0495646_0025588_497_1375 290
327 3300046680 Ga0495646_0040684 Ga0495646_0040684_1161_2042 290
328 3300046680 Ga0495646_0101554 Ga0495646_0101554_402_1280 290
329 3300046681 Ga0495647_0008990 Ga0495647_0008990_2245_3126 290
330 3300046683 Ga0495658_0010718 Ga0495658_0010718_611_1489 290
331 3300046689 Ga0495613_0103602 Ga0495613_0103602_918_1796 290
332 3300046690 Ga0495624_0003125 Ga0495624_0003125_383_1264 290
333 3300046690 Ga0495624_0072841 Ga0495624_0072841_1200_2081 290
334 3300046690 Ga0495624_0169886 Ga0495624_0169886_177_1055 290
335 3300046809 Ga0495600_0000264 Ga0495600_0000264_4571_5449 290
336 3300046809 Ga0495600_0222642 Ga0495600_0222642_126_1004 290
337 3300047315 Ga0495581_0007765 Ga0495581_0007765_3719_4597 290
338 3300047317 Ga0495604_0000130 Ga0495604_0000130_61748_62626 290
339 3300047319 Ga0495674_0003109 Ga0495674_0003109_5428_6309 290
340 3300047321 Ga0495676_0016319 Ga0495676_0016319_2769_3647 290
341 3300047321 Ga0495676_0105629 Ga0495676_0105629_738_1616 290
342 3300047322 Ga0495680_0006651 Ga0495680_0006651_5060_5938 290
343 3300047322 Ga0495680_0021485 Ga0495680_0021485_1639_2517 290
344 3300047444 Ga0495675_0105045 Ga0495675_0105045_134_1012 290
345 3300047471 Ga0495684_0121321 Ga0495684_0121321_247_1125 290
346 3300047471 Ga0495684_0280825 Ga0495684_0280825_294_1172 290
347 3300047673 Ga0495593_0056018 Ga0495593_0056018_219_1097 290
348 3300048088 Ga0495602_0000910 Ga0495602_0000910_2171_3049 290
349 3300048903 Ga0496100_0129266 Ga0496100_0129266_194_1072 290
350 3300048913 Ga0496110_0452894 Ga0496110_0452894_42_920 290
351 3300048915 Ga0496112_0004430 Ga0496112_0004430_1023_1901 290
352 3300048920 Ga0496117_0009044 Ga0496117_0009044_7938_8813 290
353 3300048922 Ga0496119_0040304 Ga0496119_0040304_1276_2151 290
354 3300048923 Ga0496120_0064252 Ga0496120_0064252_384_1259 290
355 3300048924 Ga0496121_0106372 Ga0496121_0106372_866_1738 290
356 3300048927 Ga0496124_0112082 Ga0496124_0112082_235_1110 290
357 3300049570 Ga0501033_0162665 Ga0501033_0162665_549_1427 290
358 3300049571 Ga0501034_0102424 Ga0501034_0102424_1554_2432 290
359 3300049572 Ga0501036_0304442 Ga0501036_0304442_229_1107 290
360 3300049573 Ga0501037_0236144 Ga0501037_0236144_372_1250 290
361 3300049574 Ga0501038_0049178 Ga0501038_0049178_16_894 290
362 3300049579 Ga0501043_0069682 Ga0501043_0069682_1226_2104 290
363 3300049580 Ga0501046_0023011 Ga0501046_0023011_2987_3865 290
364 3300049581 Ga0501047_0407869 Ga0501047_0407869_70_948 290
365 3300049584 Ga0501068_0043678 Ga0501068_0043678_909_1787 290
366 3300049587 Ga0501071_0140465 Ga0501071_0140465_92_970 290
367 3300049589 Ga0501073_0079153 Ga0501073_0079153_1317_2195 290
368 3300049742 Ga0501080_0037772 Ga0501080_0037772_2290_3168 290
369 3300049822 Ga0501035_0052796 Ga0501035_0052796_372_1250 290
370 3300049823 Ga0501044_0000398 Ga0501044_0000398_34147_35025 290
371 3300049823 Ga0501044_0073055 Ga0501044_0073055_2387_3265 290
372 3300049824 Ga0501045_0004946 Ga0501045_0004946_8203_9081 290
373 3300050507 nmdc:mga05p37_662093_c1 nmdc:mga05p37_662093_c1_75_953 290
374 3300050511 nmdc:mga08y16_386407_c1 nmdc:mga08y16_386407_c1_528_1406 290
375 3300050512 nmdc:mga0n895_43840_c1 nmdc:mga0n895_43840_c1_2484_3362 290
376 3300050513 nmdc:mga0rr50_120135_c1 nmdc:mga0rr50_120135_c1_607_1485 290
377 3300050515 nmdc:mga0a205_102201_c1 nmdc:mga0a205_102201_c1_784_1662 290
378 3300050515 nmdc:mga0a205_190174_c1 nmdc:mga0a205_190174_c1_481_1359 290
379 3300053077 Ga0495601_0008991 Ga0495601_0008991_2571_3452 290
380 3300053077 Ga0495601_0032115 Ga0495601_0032115_1753_2631 290
381 3300053078 Ga0495612_0000597 Ga0495612_0000597_8423_9304 290
382 3300053078 Ga0495612_0006632 Ga0495612_0006632_2680_3558 290
383 3300053084 Ga0495595_0003518 Ga0495595_0003518_3714_4592 290
384 3300053084 Ga0495595_0026891 Ga0495595_0026891_1418_2296 290
385 3300053085 Ga0495619_0001313 Ga0495619_0001313_12251_13129 290
386 3300053085 Ga0495619_0001707 Ga0495619_0001707_6009_6887 290
387 3300053085 Ga0495619_0029723 Ga0495619_0029723_1029_1907 290
388 3300053117 Ga0500593_042997 Ga0500593_042997_426_1298 290
389 3300053139 Ga0500568_0000005 Ga0500568_0000005_107140_108012 290
390 3300001989 JGI24739J22299_10047538 JGI24739J22299_100475381 291
391 3300005535 Ga0070684_100495247 Ga0070684_1004952471 291
392 3300005539 Ga0068853_100054057 Ga0068853_1000540572 291
393 3300005544 Ga0070686_100000490 Ga0070686_10000049023 291
394 3300005548 Ga0070665_100000477 Ga0070665_10000047754 291
395 3300005841 Ga0068863_100080147 Ga0068863_1000801472 291
396 3300013105 Ga0157369_10370857 Ga0157369_103708572 291
397 3300020070 Ga0206356_11086493 Ga0206356_110864932 291
398 3300021361 Ga0213872_10119343 Ga0213872_101193432 291
399 3300021384 Ga0213876_10060041 Ga0213876_100600412 291
400 3300025937 Ga0207669_10122311 Ga0207669_101223112 291
401 3300025944 Ga0207661_10284568 Ga0207661_102845682 291
402 3300026088 Ga0207641_10017586 Ga0207641_100175862 291
403 3300028379 Ga0268266_10000083 Ga0268266_10000083174 291
404 3300028381 Ga0268264_10041584 Ga0268264_100415842 291
405 3300028800 Ga0265338_10168640 Ga0265338_101686401 291
406 3300031240 Ga0265320_10009024 Ga0265320_100090245 291
407 3300031241 Ga0265325_10137479 Ga0265325_101374792 291
408 3300031595 Ga0265313_10011930 Ga0265313_100119304 291
409 3300031711 Ga0265314_10025347 Ga0265314_100253475 291
410 3300031711 Ga0265314_10151363 Ga0265314_101513632 291
411 3300031995 Ga0307409_100419514 Ga0307409_1004195142 291
412 3300039437 Ga0436365_1505188 Ga0436365_1505188_969_1847 291
413 3300046528 Ga0495642_0098367 Ga0495642_0098367_33_914 291
414 3300046694 Ga0495649_0024218 Ga0495649_0024218_2009_2887 291
415 3300048910 Ga0496107_0148081 Ga0496107_0148081_343_1239 291
416 3300048917 Ga0496114_0058870 Ga0496114_0058870_1891_2787 291
417 3300048918 Ga0496115_0006959 Ga0496115_0006959_4198_5094 291
418 3300050512 nmdc:mga0n895_202561_c1 nmdc:mga0n895_202561_c1_500_1378 291
419 3300053090 Ga0500646_0055016 Ga0500646_0055016_116_1000 291
420 3300053139 Ga0500568_0029743 Ga0500568_0029743_401_1282 291
421 3300053142 Ga0500577_0049198 Ga0500577_0049198_375_1256 291
422 3300053151 Ga0500604_0000124 Ga0500604_0000124_18662_19543 291
423 3300053153 Ga0500616_0011459 Ga0500616_0011459_3864_4745 291
424 3300053153 Ga0500616_0069753 Ga0500616_0069753_236_1117 291
425 3300053739 Ga0500587_002173 Ga0500587_002173_1603_2484 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00231

ATP-synt

ATP synthase

13

302

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6foc-assembly1.cif.gz_G f1-atpase from mycobacterium smegmatis 0.8557 3 291
6foc-assembly1.cif.gz_G f1-atpase from mycobacterium smegmatis 0.8477 3 291
7tjt-assembly1.cif.gz_G yeast atp synthase f1 region state 1-3catalytic beta_tight open without exogenous atp 0.8452 2 289
6q45-assembly2.cif.gz_O f1-atpase from fusobacterium nucleatum 0.8417 2 291
6q45-assembly2.cif.gz_O f1-atpase from fusobacterium nucleatum 0.8391 2 291
ID Description Score Start End Superfamily
af_I1KY89_89_218_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8645 75 197 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8627 28 248 3.40.1380.10
af_A0A1D6QQB0_1_102_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8521 78 175 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8503 28 248 3.40.1380.10
2xokG02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8443 28 249 3.40.1380.10
ID Description Score Start End GO Terms
AF-A0A4Q3BU51-F1-model_v4 ATP synthase F1 subunit gamma 0.8996 91 291 GO:0045261
GO:0046933
AF-A0A258XLR0-F1-model_v4 ATP synthase F1 subunit gamma 0.8975 1 246 GO:0045261
GO:0046933
AF-A0A1D8UVG0-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.894 1 291 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933
AF-A0A7X8K7C9-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.891 1 286 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933
AF-A0A258XLR0-F1-model_v4 ATP synthase F1 subunit gamma 0.8907 1 246 GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
89.76 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map