F440978

General Info

Members Datasets Scaffolds Average Seq Length
425 233 850 95

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_12541148|Ga0163163_125411481
Length 107
Sequence LSAGKNRQQEFEMSVDAATVKRIGRLARIRVEANEVAKYQGEINAILGFVEQLGEVNVDGVEPMTSVTPMQLRRREDKVTDGGYPERIVKNAPLSEDNFFMVPKVIE

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 2643221580 Devosia sp. Root635 Isolate Unclassified
222 2643221591 Devosia sp. Root685 Isolate Unclassified
223 2643221629 Devosia sp. Root105 Isolate Unclassified
224 2643221662 Devosia sp. Root413D1 Isolate Unclassified
225 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
226 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
227 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
228 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
229 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
230 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
231 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
232 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
233 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0
Isolates 3.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0
Rhizoplane 3.53
Rhizosphere 85.65
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_12541148 3300014325 Bacteria 570
2 JGI24739J22299_10020635 3300001989 Bacteria 2353
3 JGI24737J22298_10002724 3300001990 Bacteria 6249
4 JGI24735J21928_10011544 3300002067 Bacteria 2798
5 rootH1_10149556 3300003323 Bacteria 2877
6 Ga0065712_10660189 3300005290 Bacteria 563
7 Ga0070658_10035782 3300005327 Bacteria 4000
8 Ga0070658_10044563 3300005327 Bacteria 3585
9 Ga0070683_100139530 3300005329 Bacteria 2296
10 Ga0070670_100303788 3300005331 Bacteria 1396
11 Ga0070682_100194737 3300005337 Bacteria 1426
12 Ga0068868_100222230 3300005338 Bacteria 1582
13 Ga0070660_100080807 3300005339 Bacteria 2551
14 Ga0070660_100564718 3300005339 Bacteria 950
15 Ga0070660_100842881 3300005339 Bacteria 772
16 Ga0070661_100005122 3300005344 Bacteria 9034
17 Ga0070661_100037209 3300005344 Bacteria 3539
18 Ga0070661_100113157 3300005344 Bacteria 2028
19 Ga0070661_100165008 3300005344 Bacteria 1679
20 Ga0070661_100683780 3300005344 Bacteria 835
21 Ga0070675_100378795 3300005354 Bacteria 1259
22 Ga0070675_101143534 3300005354 Bacteria 716
23 Ga0070674_100459470 3300005356 Unclassified 1052
24 Ga0070674_101201491 3300005356 Bacteria 673
25 Ga0070673_100050706 3300005364 Bacteria 3246
26 Ga0070673_100724067 3300005364 Bacteria 915
27 Ga0070659_100028553 3300005366 Bacteria 4309
28 Ga0070659_100031601 3300005366 Bacteria 4102
29 Ga0070713_100221905 3300005436 Bacteria 1715
30 Ga0070700_100727018 3300005441 Bacteria 792
31 Ga0070694_100279955 3300005444 Bacteria 1271
32 Ga0070663_100364591 3300005455 Bacteria 1173
33 Ga0070663_100398258 3300005455 Bacteria 1125
34 Ga0070663_100600177 3300005455 Bacteria 926
35 Ga0070663_101213526 3300005455 Bacteria 663
36 Ga0070662_100118677 3300005457 Bacteria 2025
37 Ga0070662_101065222 3300005457 Bacteria 693
38 Ga0068867_100196155 3300005459 Bacteria 1614
39 Ga0068867_101199925 3300005459 Bacteria 697
40 Ga0070679_100364095 3300005530 Bacteria 1393
41 Ga0068853_100001361 3300005539 Bacteria 17623
42 Ga0068853_100478550 3300005539 Bacteria 1174
43 Ga0068853_100624838 3300005539 Bacteria 1024
44 Ga0070695_100837726 3300005545 Bacteria 739
45 Ga0070693_100912521 3300005547 Bacteria 659
46 Ga0070693_101256268 3300005547 Bacteria 571
47 Ga0070693_101336446 3300005547 Bacteria 555
48 Ga0070665_100005843 3300005548 Bacteria 12623
49 Ga0070665_100333325 3300005548 Bacteria 1522
50 Ga0070665_100490833 3300005548 Bacteria 1239
51 Ga0070704_100483019 3300005549 Bacteria 1072
52 Ga0068855_100036343 3300005563 Bacteria 5863
53 Ga0068855_100061477 3300005563 Bacteria 4388
54 Ga0068855_100546721 3300005563 Bacteria 1254
55 Ga0068855_100644104 3300005563 Bacteria 1139
56 Ga0070664_100234163 3300005564 Bacteria 1647
57 Ga0070664_100525222 3300005564 Bacteria 1093
58 Ga0068857_100114017 3300005577 Bacteria 2430
59 Ga0068857_100316874 3300005577 Bacteria 1440
60 Ga0068857_100696410 3300005577 Bacteria 965
61 Ga0068857_100891223 3300005577 Bacteria 853
62 Ga0068854_100035435 3300005578 Bacteria 3492
63 Ga0068854_100400316 3300005578 Bacteria 1136
64 Ga0068854_101146125 3300005578 Bacteria 695
65 Ga0068856_100043727 3300005614 Bacteria 4406
66 Ga0068856_100218875 3300005614 Bacteria 1919
67 Ga0068856_100374439 3300005614 Bacteria 1443
68 Ga0068856_100466897 3300005614 Bacteria 1283
69 Ga0068856_100536978 3300005614 Bacteria 1191
70 Ga0068852_100002584 3300005616 Bacteria 12497
71 Ga0068852_100014256 3300005616 Bacteria 6110
72 Ga0068852_100073745 3300005616 Bacteria 3003
73 Ga0068852_100727796 3300005616 Bacteria 1003
74 Ga0068852_101737981 3300005616 Bacteria 646
75 Ga0068851_10023798 3300005834 Bacteria 2995
76 Ga0068851_10072012 3300005834 Bacteria 1790
77 Ga0068851_10655403 3300005834 Bacteria 643
78 Ga0068862_100591768 3300005844 Bacteria 1064
79 Ga0081539_10004809 3300005985 Bacteria 14508
80 Ga0070717_10261179 3300006028 Bacteria 1532
81 Ga0075365_10095246 3300006038 Bacteria 2033
82 Ga0075365_10322937 3300006038 Bacteria 1087
83 Ga0075365_11083525 3300006038 Bacteria 564
84 Ga0075368_10029042 3300006042 Bacteria 2138
85 Ga0075363_100150393 3300006048 Bacteria 1314
86 Ga0075363_100223918 3300006048 Bacteria 1078
87 Ga0075363_100371666 3300006048 Bacteria 837
88 Ga0075362_10002800 3300006177 Bacteria 5947
89 Ga0075367_10102923 3300006178 Bacteria 1747
90 Ga0075366_10007995 3300006195 Bacteria 5858
91 Ga0075370_10010892 3300006353 Bacteria 4766
92 Ga0075370_10134017 3300006353 Bacteria 1446
93 Ga0068871_100505642 3300006358 Bacteria 1090
94 Ga0068871_100536066 3300006358 Bacteria 1059
95 Ga0075428_100109734 3300006844 Bacteria 3006
96 Ga0075431_100342723 3300006847 Bacteria 1504
97 Ga0068865_100146572 3300006881 Bacteria 1786
98 Ga0105240_10018209 3300009093 Bacteria 9442
99 Ga0105240_10226968 3300009093 Bacteria 2172
100 Ga0105240_10487516 3300009093 Bacteria 1373
101 Ga0105240_10637212 3300009093 Bacteria 1170
102 Ga0105240_11249350 3300009093 Bacteria 785
103 Ga0105245_12572257 3300009098 Bacteria 562
104 Ga0114129_10418006 3300009147 Bacteria 1764
105 Ga0114129_13118014 3300009147 Bacteria 541
106 Ga0105241_10025491 3300009174 Bacteria 4394
107 Ga0105241_10369766 3300009174 Bacteria 1250
108 Ga0105241_10373539 3300009174 Bacteria 1244
109 Ga0105248_12676552 3300009177 Bacteria 569
110 Ga0105237_10307816 3300009545 Bacteria 1587
111 Ga0105238_10007784 3300009551 Bacteria 10718
112 Ga0105238_10028969 3300009551 Bacteria 5641
113 Ga0105238_10067801 3300009551 Bacteria 3568
114 Ga0105238_11968112 3300009551 Bacteria 618
115 Ga0099796_10130638 3300010159 Bacteria 973
116 Ga0105239_10063115 3300010375 Bacteria 4067
117 Ga0105239_10089462 3300010375 Bacteria 3395
118 Ga0105239_10259297 3300010375 Bacteria 1953
119 Ga0105239_13020334 3300010375 Bacteria 548
120 Ga0105246_10192954 3300011119 Bacteria 1578
121 Ga0157373_10305432 3300013100 Bacteria 1130
122 Ga0157371_10004729 3300013102 Bacteria 11760
123 Ga0157370_10020275 3300013104 Bacteria 6640
124 Ga0157370_10041820 3300013104 Bacteria 4418
125 Ga0157370_10553119 3300013104 Bacteria 1055
126 Ga0157370_10972708 3300013104 Bacteria 769
127 Ga0157369_10021628 3300013105 Bacteria 7193
128 Ga0157369_10090815 3300013105 Bacteria 3261
129 Ga0157369_10735881 3300013105 Bacteria 1015
130 Ga0157374_10279841 3300013296 Bacteria 1647
131 Ga0157374_10640711 3300013296 Bacteria 1074
132 Ga0157378_11101347 3300013297 Bacteria 831
133 Ga0157378_12130961 3300013297 Bacteria 611
134 Ga0163162_10286561 3300013306 Bacteria 1779
135 Ga0157372_10019075 3300013307 Bacteria 7383
136 Ga0157372_10222500 3300013307 Bacteria 2188
137 Ga0157372_10515888 3300013307 Bacteria 1393
138 Ga0157372_13018641 3300013307 Bacteria 538
139 Ga0157375_10799189 3300013308 Bacteria 1092
140 Ga0182005_1086793 3300015265 Bacteria 867
141 Ga0209025_1179689 3300025294 Bacteria 545
142 Ga0207656_10018797 3300025321 Bacteria 2725
143 Ga0207656_10042576 3300025321 Bacteria 1933
144 Ga0207647_10008767 3300025904 Bacteria 7221
145 Ga0207647_10040939 3300025904 Bacteria 2916
146 Ga0207647_10207006 3300025904 Bacteria 1134
147 Ga0207647_10407453 3300025904 Bacteria 765
148 Ga0207645_10056303 3300025907 Bacteria 2510
149 Ga0207705_10243809 3300025909 Bacteria 1369
150 Ga0207654_10431775 3300025911 Bacteria 921
151 Ga0207695_10112632 3300025913 Bacteria 2698
152 Ga0207695_10722709 3300025913 Bacteria 876
153 Ga0207695_10861012 3300025913 Bacteria 786
154 Ga0207671_10229774 3300025914 Bacteria 1455
155 Ga0207693_10922285 3300025915 Bacteria 669
156 Ga0207657_10010037 3300025919 Bacteria 9472
157 Ga0207657_10201826 3300025919 Bacteria 1599
158 Ga0207657_10497272 3300025919 Bacteria 955
159 Ga0207649_10158742 3300025920 Bacteria 1565
160 Ga0207649_10169804 3300025920 Bacteria 1518
161 Ga0207649_10821059 3300025920 Bacteria 726
162 Ga0207649_10830983 3300025920 Bacteria 722
163 Ga0207694_10012796 3300025924 Bacteria 6320
164 Ga0207694_10133203 3300025924 Bacteria 1993
165 Ga0207694_10142100 3300025924 Bacteria 1931
166 Ga0207659_10541900 3300025926 Bacteria 988
167 Ga0207687_10906246 3300025927 Bacteria 754
168 Ga0207700_10035659 3300025928 Bacteria 3585
169 Ga0207700_10693480 3300025928 Bacteria 909
170 Ga0207690_10246458 3300025932 Bacteria 1378
171 Ga0207690_11102099 3300025932 Bacteria 662
172 Ga0207690_11402297 3300025932 Bacteria 584
173 Ga0207706_10098993 3300025933 Bacteria 2565
174 Ga0207706_10317608 3300025933 Bacteria 1356
175 Ga0207669_11028574 3300025937 Bacteria 693
176 Ga0207679_10376988 3300025945 Bacteria 1243
177 Ga0207679_10445307 3300025945 Bacteria 1148
178 Ga0207667_10067524 3300025949 Bacteria 3724
179 Ga0207667_10103393 3300025949 Bacteria 2938
180 Ga0207667_10104089 3300025949 Bacteria 2927
181 Ga0207667_10121062 3300025949 Bacteria 2696
182 Ga0207667_10194477 3300025949 Bacteria 2081
183 Ga0207667_10472678 3300025949 Bacteria 1273
184 Ga0207667_10875258 3300025949 Bacteria 891
185 Ga0207651_10913097 3300025960 Bacteria 782
186 Ga0207651_11128890 3300025960 Bacteria 703
187 Ga0207640_10099611 3300025981 Bacteria 2034
188 Ga0207640_10145543 3300025981 Bacteria 1733
189 Ga0207640_10157930 3300025981 Bacteria 1674
190 Ga0207640_10596885 3300025981 Bacteria 934
191 Ga0207658_11512010 3300025986 Bacteria 614
192 Ga0207677_11642843 3300026023 Bacteria 595
193 Ga0207639_10027816 3300026041 Bacteria 4122
194 Ga0207639_10152841 3300026041 Bacteria 1935
195 Ga0207639_10745813 3300026041 Bacteria 910
196 Ga0207639_10852933 3300026041 Bacteria 850
197 Ga0207678_10041815 3300026067 Bacteria 3973
198 Ga0207678_10109274 3300026067 Bacteria 2359
199 Ga0207678_10327353 3300026067 Bacteria 1319
200 Ga0207678_11079744 3300026067 Bacteria 711
201 Ga0207702_10111185 3300026078 Bacteria 2436
202 Ga0207702_10169125 3300026078 Bacteria 2002
203 Ga0207702_10348682 3300026078 Bacteria 1416
204 Ga0207702_10523207 3300026078 Bacteria 1158
205 Ga0207702_10940930 3300026078 Bacteria 857
206 Ga0207648_10250301 3300026089 Bacteria 1579
207 Ga0207674_10012932 3300026116 Bacteria 9307
208 Ga0207674_10046700 3300026116 Bacteria 4444
209 Ga0207674_10250085 3300026116 Bacteria 1720
210 Ga0207674_10393326 3300026116 Bacteria 1340
211 Ga0207674_10451080 3300026116 Bacteria 1243
212 Ga0207698_10035924 3300026142 Bacteria 3630
213 Ga0207698_10083221 3300026142 Bacteria 2589
214 Ga0207698_11060825 3300026142 Bacteria 822
215 Ga0207698_11302281 3300026142 Bacteria 741
216 Ga0209813_10030911 3300027866 Bacteria 1577
217 Ga0209974_10092964 3300027876 Bacteria 1047
218 Ga0268266_10015825 3300028379 Bacteria 6459
219 Ga0268266_10152113 3300028379 Bacteria 2087
220 Ga0268266_10187772 3300028379 Bacteria 1886
221 Ga0268265_10923251 3300028380 Bacteria 858
222 Ga0268264_12580701 3300028381 Bacteria 513
223 Ga0265324_10092744 3300029957 Bacteria 1027
224 Ga0265330_10014045 3300031235 Bacteria 3719
225 Ga0265332_10105974 3300031238 Bacteria 1185
226 Ga0265325_10007054 3300031241 Bacteria 6771
227 Ga0265329_10017889 3300031242 Bacteria 2432
228 Ga0265339_10002073 3300031249 Bacteria 14689
229 Ga0265316_10111233 3300031344 Bacteria 2074
230 Ga0265313_10002516 3300031595 Bacteria 15759
231 Ga0265314_10031996 3300031711 Bacteria 3876
232 Ga0307413_10975865 3300031824 Bacteria 725
233 Ga0307413_11803541 3300031824 Bacteria 548
234 Ga0307406_10612878 3300031901 Bacteria 899
235 Ga0307406_10798100 3300031901 Bacteria 796
236 Ga0307412_10811714 3300031911 Bacteria 813
237 Ga0307412_11139803 3300031911 Bacteria 696
238 Ga0307416_100444379 3300032002 Bacteria 1348
239 Ga0307414_10306248 3300032004 Bacteria 1346
240 Ga0307414_10976316 3300032004 Bacteria 779
241 Ga0307414_11025250 3300032004 Bacteria 760
242 Ga0316583_10212307 3300032133 Bacteria 671
243 Ga0373934_0069578 3300035086 Bacteria 1407
244 Ga0373949_0184777 3300035090 Bacteria 619
245 Ga0373952_0225149 3300035092 Bacteria 559
246 Ga0373941_0032567 3300035115 Bacteria 1561
247 Ga0373953_0536765 3300035117 Bacteria 520
248 Ga0373954_0357954 3300035118 Bacteria 721
249 Ga0373956_0088501 3300035119 Bacteria 1427
250 Ga0373960_0022880 3300035121 Bacteria 1679
251 Ga0373924_0149108 3300035410 Bacteria 1023
252 Ga0373931_0065679 3300035691 Bacteria 1967
253 Ga0373931_0363132 3300035691 Bacteria 909
254 Ga0373935_0969882 3300035692 Bacteria 631
255 Ga0373935_1449491 3300035692 Bacteria 514
256 Ga0373933_0734417 3300035724 Bacteria 649
257 Ga0373925_0693207 3300037068 Bacteria 840
258 Ga0395899_0153226 3300037312 Bacteria 1632
259 Ga0395899_0192714 3300037312 Bacteria 1425
260 Ga0395900_0069929 3300037418 Bacteria 3608
261 Ga0395900_0484087 3300037418 Bacteria 1189
262 Ga0395900_1514257 3300037418 Bacteria 583
263 Ga0395898_0152230 3300037466 Bacteria 2212
264 Ga0395898_0156151 3300037466 Bacteria 2182
265 Ga0395898_0299684 3300037466 Bacteria 1534
266 Ga0395905_0011565 3300037471 Bacteria 8526
267 Ga0395901_0310733 3300038443 Bacteria 1632
268 Ga0395901_0681265 3300038443 Bacteria 1028
269 Ga0395901_1035856 3300038443 Bacteria 794
270 Ga0436360_0365885 3300039438 Bacteria 1208
271 Ga0439466_0284114 3300041411 Bacteria 501
272 Ga0439465_0177354 3300041413 Bacteria 770
273 Ga0439465_0226991 3300041413 Bacteria 686
274 Ga0439465_0252195 3300041413 Bacteria 653
275 Ga0451793_1189447 3300041452 Bacteria 972
276 Ga0451797_0270653 3300041453 Bacteria 698
277 Ga0451797_0645602 3300041453 Bacteria 611
278 Ga0451800_0709892 3300041459 Unclassified 592
279 Ga0451800_1519639 3300041459 Bacteria 715
280 Ga0451802_1295978 3300041460 Bacteria 571
281 Ga0451807_2431911 3300041486 Bacteria 597
282 Ga0451851_0708563 3300041507 Bacteria 641
283 Ga0439442_092063 3300042002 Bacteria 653
284 Ga0439445_0085266 3300042004 Bacteria 886
285 Ga0439445_0147433 3300042004 Bacteria 684
286 Ga0439432_041128 3300042006 Bacteria 1465
287 Ga0439434_0055737 3300042435 Bacteria 1231
288 Ga0495592_0357350 3300046454 Bacteria 935
289 Ga0495592_0476946 3300046454 Bacteria 778
290 Ga0495580_0995492 3300046472 Bacteria 535
291 Ga0495608_0353138 3300046511 Bacteria 905
292 Ga0495628_1160294 3300046516 Bacteria 525
293 Ga0495652_0227303 3300046529 Bacteria 1398
294 Ga0495587_0535916 3300046536 Bacteria 646
295 Ga0495667_0148481 3300046559 Bacteria 1510
296 Ga0495625_0766021 3300046660 Bacteria 564
297 Ga0495657_0706193 3300046675 Bacteria 579
298 Ga0495613_0940217 3300046689 Bacteria 558
299 Ga0495604_0458742 3300047317 Bacteria 832
300 Ga0495675_0203883 3300047444 Bacteria 1203
301 Ga0495686_0500268 3300047472 Bacteria 640
302 Ga0496104_0001487 3300048907 Bacteria 20235
303 Ga0496105_0012075 3300048908 Bacteria 6839
304 Ga0496106_0198256 3300048909 Bacteria 1597
305 Ga0496109_1853211 3300048912 Bacteria 536
306 Ga0496110_0334262 3300048913 Bacteria 1380
307 Ga0496112_1405676 3300048915 Bacteria 612
308 Ga0496113_0542277 3300048916 Bacteria 933
309 Ga0496115_0143147 3300048918 Bacteria 1972
310 Ga0496117_0437703 3300048920 Bacteria 650
311 Ga0496118_0109367 3300048921 Bacteria 1840
312 Ga0496121_0220249 3300048924 Bacteria 1337
313 Ga0496124_0140521 3300048927 Bacteria 1906
314 Ga0496124_0694887 3300048927 Bacteria 646
315 Ga0496125_0000600 3300048928 Bacteria 61362
316 Ga0501031_0431806 3300049568 Bacteria 851
317 Ga0501032_0660458 3300049569 Bacteria 664
318 Ga0501032_0746920 3300049569 Bacteria 619
319 Ga0501033_0028728 3300049570 Bacteria 4178
320 Ga0501033_0369575 3300049570 Bacteria 1003
321 Ga0501034_0003057 3300049571 Bacteria 19317
322 Ga0501034_0030710 3300049571 Bacteria 5461
323 Ga0501034_0050009 3300049571 Bacteria 4217
324 Ga0501034_0071799 3300049571 Bacteria 3470
325 Ga0501034_0109265 3300049571 Bacteria 2756
326 Ga0501034_0127082 3300049571 Bacteria 2534
327 Ga0501034_0157945 3300049571 Bacteria 2240
328 Ga0501034_0277947 3300049571 Bacteria 1614
329 Ga0501034_0455124 3300049571 Bacteria 1197
330 Ga0501034_0505031 3300049571 Bacteria 1122
331 Ga0501034_0625846 3300049571 Bacteria 980
332 Ga0501034_0712363 3300049571 Bacteria 901
333 Ga0501034_0746801 3300049571 Bacteria 874
334 Ga0501034_0881187 3300049571 Bacteria 784
335 Ga0501034_1312317 3300049571 Bacteria 600
336 Ga0501036_0070182 3300049572 Bacteria 2962
337 Ga0501036_0564061 3300049572 Bacteria 946
338 Ga0501036_0805051 3300049572 Bacteria 774
339 Ga0501036_0908022 3300049572 Bacteria 723
340 Ga0501037_0027745 3300049573 Bacteria 4184
341 Ga0501037_0245811 3300049573 Bacteria 1253
342 Ga0501037_0343592 3300049573 Bacteria 1030
343 Ga0501037_0629315 3300049573 Bacteria 719
344 Ga0501038_0045781 3300049574 Bacteria 3796
345 Ga0501038_0214920 3300049574 Bacteria 1537
346 Ga0501038_0297979 3300049574 Bacteria 1266
347 Ga0501038_1050212 3300049574 Bacteria 597
348 Ga0501038_1107743 3300049574 Bacteria 578
349 Ga0501039_0081052 3300049575 Bacteria 2526
350 Ga0501039_0518693 3300049575 Bacteria 936
351 Ga0501041_0396364 3300049577 Bacteria 874
352 Ga0501043_0408635 3300049579 Bacteria 1025
353 Ga0501043_0472675 3300049579 Bacteria 939
354 Ga0501043_0557235 3300049579 Bacteria 851
355 Ga0501043_0571109 3300049579 Bacteria 838
356 Ga0501043_1067402 3300049579 Bacteria 572
357 Ga0501043_1198509 3300049579 Unclassified 533
358 Ga0501046_0031168 3300049580 Bacteria 4325
359 Ga0501046_0771245 3300049580 Bacteria 675
360 Ga0501047_0084594 3300049581 Bacteria 3048
361 Ga0501047_0095998 3300049581 Bacteria 2843
362 Ga0501047_0140584 3300049581 Bacteria 2293
363 Ga0501047_0669979 3300049581 Bacteria 856
364 Ga0501048_0327779 3300049582 Bacteria 1091
365 Ga0501068_0186452 3300049584 Bacteria 1313
366 Ga0501068_0823814 3300049584 Bacteria 609
367 Ga0501070_0098203 3300049586 Bacteria 2422
368 Ga0501070_0507852 3300049586 Bacteria 968
369 Ga0501070_1481150 3300049586 Bacteria 514
370 Ga0501071_0190135 3300049587 Bacteria 1540
371 Ga0501073_0085262 3300049589 Bacteria 2198
372 Ga0501073_0202042 3300049589 Bacteria 1374
373 Ga0501073_1038368 3300049589 Bacteria 564
374 Ga0501073_1146912 3300049589 Bacteria 534
375 Ga0501074_0363518 3300049590 Bacteria 1027
376 Ga0501074_0854127 3300049590 Bacteria 641
377 Ga0501075_1264225 3300049591 Bacteria 560
378 Ga0501076_0322104 3300049592 Bacteria 1268
379 Ga0501080_0403988 3300049742 Bacteria 1229
380 Ga0501080_1208399 3300049742 Bacteria 650
381 Ga0501080_1861856 3300049742 Bacteria 504
382 Ga0501035_0218399 3300049822 Bacteria 1628
383 Ga0501035_0407548 3300049822 Bacteria 1130
384 Ga0501035_0618261 3300049822 Bacteria 881
385 Ga0501044_0040406 3300049823 Bacteria 4861
386 Ga0501044_0349223 3300049823 Bacteria 1399
387 Ga0501044_0518065 3300049823 Bacteria 1092
388 Ga0501044_0762794 3300049823 Bacteria 849
389 Ga0501044_0765793 3300049823 Bacteria 846
390 nmdc:mga03683_2282_c1 3300050489 Bacteria 5923
391 nmdc:mga03n38_107620_c1 3300050490 Bacteria 1353
392 nmdc:mga03n38_255395_c1 3300050490 Bacteria 927
393 nmdc:mga0yw44_24211_c1 3300050492 Bacteria 3432
394 nmdc:mga0yw44_476671_c1 3300050492 Bacteria 846
395 nmdc:mga0k408_57890_c1 3300050493 Bacteria 2251
396 nmdc:mga06z11_8511_c1 3300050494 Bacteria 4284
397 nmdc:mga04h51_36848_c1 3300050495 Bacteria 1576
398 nmdc:mga07m45_10439_c1 3300050496 Bacteria 4851
399 nmdc:mga07m45_26534_c1 3300050496 Bacteria 3185
400 nmdc:mga05p37_184464_c1 3300050507 Bacteria 2537
401 nmdc:mga0qj67_927134_c1 3300050509 Bacteria 685
402 nmdc:mga06r32_1557922_c1 3300050510 Bacteria 600
403 Ga0495601_0127459 3300053077 Bacteria 1656
404 Ga0495612_0254454 3300053078 Unclassified 782
405 Ga0495655_0189213 3300053083 Bacteria 668
406 Ga0500595_013139 3300053119 Bacteria 3178
407 Ga0500618_013461 3300053125 Bacteria 2111
408 Ga0500642_0437952 3300053130 Bacteria 563
409 Ga0500616_0013814 3300053153 Bacteria 4664
410 Ga0501084_0620003 3300054114 Bacteria 914
411 Ga0501082_0215429 3300060353 Bacteria 1671
412 Ga0530510_0395757 3300061734 Bacteria 1041
413 2643910714 2643221580 Bacteria 3816678
414 2643963395 2643221591 Bacteria 4397626
415 2644166063 2643221629 Bacteria 5850260
416 2644346931 2643221662 Bacteria 5851492
417 2837679973 2837678835 Bacteria 5252418
418 2848299372 2848297114 Bacteria 3608511
419 2894818379 2894817345 Bacteria 4892941
420 2896186736 2896184354 Bacteria 3258548
421 2939671115 2939669807 Bacteria 5028511
422 2995392959 2995392953 Bacteria 4539380
423 8045865231 8045864390 Bacteria 5043873
424 8054566573 8054563764 Bacteria 5592885
425 8056879514 8056875544 Bacteria 4355797
426 Ga0163163_12541148
427 JGI24739J22299_10020635
428 JGI24737J22298_10002724
429 JGI24735J21928_10011544
430 rootH1_10149556
431 Ga0065712_10660189
432 Ga0070658_10035782
433 Ga0070658_10044563
434 Ga0070683_100139530
435 Ga0070670_100303788
436 Ga0070682_100194737
437 Ga0068868_100222230
438 Ga0070660_100080807
439 Ga0070660_100564718
440 Ga0070660_100842881
441 Ga0070661_100005122
442 Ga0070661_100037209
443 Ga0070661_100113157
444 Ga0070661_100165008
445 Ga0070661_100683780
446 Ga0070675_100378795
447 Ga0070675_101143534
448 Ga0070674_100459470
449 Ga0070674_101201491
450 Ga0070673_100050706
451 Ga0070673_100724067
452 Ga0070659_100028553
453 Ga0070659_100031601
454 Ga0070713_100221905
455 Ga0070700_100727018
456 Ga0070694_100279955
457 Ga0070663_100364591
458 Ga0070663_100398258
459 Ga0070663_100600177
460 Ga0070663_101213526
461 Ga0070662_100118677
462 Ga0070662_101065222
463 Ga0068867_100196155
464 Ga0068867_101199925
465 Ga0070679_100364095
466 Ga0068853_100001361
467 Ga0068853_100478550
468 Ga0068853_100624838
469 Ga0070695_100837726
470 Ga0070693_100912521
471 Ga0070693_101256268
472 Ga0070693_101336446
473 Ga0070665_100005843
474 Ga0070665_100333325
475 Ga0070665_100490833
476 Ga0070704_100483019
477 Ga0068855_100036343
478 Ga0068855_100061477
479 Ga0068855_100546721
480 Ga0068855_100644104
481 Ga0070664_100234163
482 Ga0070664_100525222
483 Ga0068857_100114017
484 Ga0068857_100316874
485 Ga0068857_100696410
486 Ga0068857_100891223
487 Ga0068854_100035435
488 Ga0068854_100400316
489 Ga0068854_101146125
490 Ga0068856_100043727
491 Ga0068856_100218875
492 Ga0068856_100374439
493 Ga0068856_100466897
494 Ga0068856_100536978
495 Ga0068852_100002584
496 Ga0068852_100014256
497 Ga0068852_100073745
498 Ga0068852_100727796
499 Ga0068852_101737981
500 Ga0068851_10023798
501 Ga0068851_10072012
502 Ga0068851_10655403
503 Ga0068862_100591768
504 Ga0081539_10004809
505 Ga0070717_10261179
506 Ga0075365_10095246
507 Ga0075365_10322937
508 Ga0075365_11083525
509 Ga0075368_10029042
510 Ga0075363_100150393
511 Ga0075363_100223918
512 Ga0075363_100371666
513 Ga0075362_10002800
514 Ga0075367_10102923
515 Ga0075366_10007995
516 Ga0075370_10010892
517 Ga0075370_10134017
518 Ga0068871_100505642
519 Ga0068871_100536066
520 Ga0075428_100109734
521 Ga0075431_100342723
522 Ga0068865_100146572
523 Ga0105240_10018209
524 Ga0105240_10226968
525 Ga0105240_10487516
526 Ga0105240_10637212
527 Ga0105240_11249350
528 Ga0105245_12572257
529 Ga0114129_10418006
530 Ga0114129_13118014
531 Ga0105241_10025491
532 Ga0105241_10369766
533 Ga0105241_10373539
534 Ga0105248_12676552
535 Ga0105237_10307816
536 Ga0105238_10007784
537 Ga0105238_10028969
538 Ga0105238_10067801
539 Ga0105238_11968112
540 Ga0099796_10130638
541 Ga0105239_10063115
542 Ga0105239_10089462
543 Ga0105239_10259297
544 Ga0105239_13020334
545 Ga0105246_10192954
546 Ga0157373_10305432
547 Ga0157371_10004729
548 Ga0157370_10020275
549 Ga0157370_10041820
550 Ga0157370_10553119
551 Ga0157370_10972708
552 Ga0157369_10021628
553 Ga0157369_10090815
554 Ga0157369_10735881
555 Ga0157374_10279841
556 Ga0157374_10640711
557 Ga0157378_11101347
558 Ga0157378_12130961
559 Ga0163162_10286561
560 Ga0157372_10019075
561 Ga0157372_10222500
562 Ga0157372_10515888
563 Ga0157372_13018641
564 Ga0157375_10799189
565 Ga0182005_1086793
566 Ga0209025_1179689
567 Ga0207656_10018797
568 Ga0207656_10042576
569 Ga0207647_10008767
570 Ga0207647_10040939
571 Ga0207647_10207006
572 Ga0207647_10407453
573 Ga0207645_10056303
574 Ga0207705_10243809
575 Ga0207654_10431775
576 Ga0207695_10112632
577 Ga0207695_10722709
578 Ga0207695_10861012
579 Ga0207671_10229774
580 Ga0207693_10922285
581 Ga0207657_10010037
582 Ga0207657_10201826
583 Ga0207657_10497272
584 Ga0207649_10158742
585 Ga0207649_10169804
586 Ga0207649_10821059
587 Ga0207649_10830983
588 Ga0207694_10012796
589 Ga0207694_10133203
590 Ga0207694_10142100
591 Ga0207659_10541900
592 Ga0207687_10906246
593 Ga0207700_10035659
594 Ga0207700_10693480
595 Ga0207690_10246458
596 Ga0207690_11102099
597 Ga0207690_11402297
598 Ga0207706_10098993
599 Ga0207706_10317608
600 Ga0207669_11028574
601 Ga0207679_10376988
602 Ga0207679_10445307
603 Ga0207667_10067524
604 Ga0207667_10103393
605 Ga0207667_10104089
606 Ga0207667_10121062
607 Ga0207667_10194477
608 Ga0207667_10472678
609 Ga0207667_10875258
610 Ga0207651_10913097
611 Ga0207651_11128890
612 Ga0207640_10099611
613 Ga0207640_10145543
614 Ga0207640_10157930
615 Ga0207640_10596885
616 Ga0207658_11512010
617 Ga0207677_11642843
618 Ga0207639_10027816
619 Ga0207639_10152841
620 Ga0207639_10745813
621 Ga0207639_10852933
622 Ga0207678_10041815
623 Ga0207678_10109274
624 Ga0207678_10327353
625 Ga0207678_11079744
626 Ga0207702_10111185
627 Ga0207702_10169125
628 Ga0207702_10348682
629 Ga0207702_10523207
630 Ga0207702_10940930
631 Ga0207648_10250301
632 Ga0207674_10012932
633 Ga0207674_10046700
634 Ga0207674_10250085
635 Ga0207674_10393326
636 Ga0207674_10451080
637 Ga0207698_10035924
638 Ga0207698_10083221
639 Ga0207698_11060825
640 Ga0207698_11302281
641 Ga0209813_10030911
642 Ga0209974_10092964
643 Ga0268266_10015825
644 Ga0268266_10152113
645 Ga0268266_10187772
646 Ga0268265_10923251
647 Ga0268264_12580701
648 Ga0265324_10092744
649 Ga0265330_10014045
650 Ga0265332_10105974
651 Ga0265325_10007054
652 Ga0265329_10017889
653 Ga0265339_10002073
654 Ga0265316_10111233
655 Ga0265313_10002516
656 Ga0265314_10031996
657 Ga0307413_10975865
658 Ga0307413_11803541
659 Ga0307406_10612878
660 Ga0307406_10798100
661 Ga0307412_10811714
662 Ga0307412_11139803
663 Ga0307416_100444379
664 Ga0307414_10306248
665 Ga0307414_10976316
666 Ga0307414_11025250
667 Ga0316583_10212307
668 Ga0373934_0069578
669 Ga0373949_0184777
670 Ga0373952_0225149
671 Ga0373941_0032567
672 Ga0373953_0536765
673 Ga0373954_0357954
674 Ga0373956_0088501
675 Ga0373960_0022880
676 Ga0373924_0149108
677 Ga0373931_0065679
678 Ga0373931_0363132
679 Ga0373935_0969882
680 Ga0373935_1449491
681 Ga0373933_0734417
682 Ga0373925_0693207
683 Ga0395899_0153226
684 Ga0395899_0192714
685 Ga0395900_0069929
686 Ga0395900_0484087
687 Ga0395900_1514257
688 Ga0395898_0152230
689 Ga0395898_0156151
690 Ga0395898_0299684
691 Ga0395905_0011565
692 Ga0395901_0310733
693 Ga0395901_0681265
694 Ga0395901_1035856
695 Ga0436360_0365885
696 Ga0439466_0284114
697 Ga0439465_0177354
698 Ga0439465_0226991
699 Ga0439465_0252195
700 Ga0451793_1189447
701 Ga0451797_0270653
702 Ga0451797_0645602
703 Ga0451800_0709892
704 Ga0451800_1519639
705 Ga0451802_1295978
706 Ga0451807_2431911
707 Ga0451851_0708563
708 Ga0439442_092063
709 Ga0439445_0085266
710 Ga0439445_0147433
711 Ga0439432_041128
712 Ga0439434_0055737
713 Ga0495592_0357350
714 Ga0495592_0476946
715 Ga0495580_0995492
716 Ga0495608_0353138
717 Ga0495628_1160294
718 Ga0495652_0227303
719 Ga0495587_0535916
720 Ga0495667_0148481
721 Ga0495625_0766021
722 Ga0495657_0706193
723 Ga0495613_0940217
724 Ga0495604_0458742
725 Ga0495675_0203883
726 Ga0495686_0500268
727 Ga0496104_0001487
728 Ga0496105_0012075
729 Ga0496106_0198256
730 Ga0496109_1853211
731 Ga0496110_0334262
732 Ga0496112_1405676
733 Ga0496113_0542277
734 Ga0496115_0143147
735 Ga0496117_0437703
736 Ga0496118_0109367
737 Ga0496121_0220249
738 Ga0496124_0140521
739 Ga0496124_0694887
740 Ga0496125_0000600
741 Ga0501031_0431806
742 Ga0501032_0660458
743 Ga0501032_0746920
744 Ga0501033_0028728
745 Ga0501033_0369575
746 Ga0501034_0003057
747 Ga0501034_0030710
748 Ga0501034_0050009
749 Ga0501034_0071799
750 Ga0501034_0109265
751 Ga0501034_0127082
752 Ga0501034_0157945
753 Ga0501034_0277947
754 Ga0501034_0455124
755 Ga0501034_0505031
756 Ga0501034_0625846
757 Ga0501034_0712363
758 Ga0501034_0746801
759 Ga0501034_0881187
760 Ga0501034_1312317
761 Ga0501036_0070182
762 Ga0501036_0564061
763 Ga0501036_0805051
764 Ga0501036_0908022
765 Ga0501037_0027745
766 Ga0501037_0245811
767 Ga0501037_0343592
768 Ga0501037_0629315
769 Ga0501038_0045781
770 Ga0501038_0214920
771 Ga0501038_0297979
772 Ga0501038_1050212
773 Ga0501038_1107743
774 Ga0501039_0081052
775 Ga0501039_0518693
776 Ga0501041_0396364
777 Ga0501043_0408635
778 Ga0501043_0472675
779 Ga0501043_0557235
780 Ga0501043_0571109
781 Ga0501043_1067402
782 Ga0501043_1198509
783 Ga0501046_0031168
784 Ga0501046_0771245
785 Ga0501047_0084594
786 Ga0501047_0095998
787 Ga0501047_0140584
788 Ga0501047_0669979
789 Ga0501048_0327779
790 Ga0501068_0186452
791 Ga0501068_0823814
792 Ga0501070_0098203
793 Ga0501070_0507852
794 Ga0501070_1481150
795 Ga0501071_0190135
796 Ga0501073_0085262
797 Ga0501073_0202042
798 Ga0501073_1038368
799 Ga0501073_1146912
800 Ga0501074_0363518
801 Ga0501074_0854127
802 Ga0501075_1264225
803 Ga0501076_0322104
804 Ga0501080_0403988
805 Ga0501080_1208399
806 Ga0501080_1861856
807 Ga0501035_0218399
808 Ga0501035_0407548
809 Ga0501035_0618261
810 Ga0501044_0040406
811 Ga0501044_0349223
812 Ga0501044_0518065
813 Ga0501044_0762794
814 Ga0501044_0765793
815 nmdc:mga03683_2282_c1
816 nmdc:mga03n38_107620_c1
817 nmdc:mga03n38_255395_c1
818 nmdc:mga0yw44_24211_c1
819 nmdc:mga0yw44_476671_c1
820 nmdc:mga0k408_57890_c1
821 nmdc:mga06z11_8511_c1
822 nmdc:mga04h51_36848_c1
823 nmdc:mga07m45_10439_c1
824 nmdc:mga07m45_26534_c1
825 nmdc:mga05p37_184464_c1
826 nmdc:mga0qj67_927134_c1
827 nmdc:mga06r32_1557922_c1
828 Ga0495601_0127459
829 Ga0495612_0254454
830 Ga0495655_0189213
831 Ga0500595_013139
832 Ga0500618_013461
833 Ga0500642_0437952
834 Ga0500616_0013814
835 Ga0501084_0620003
836 Ga0501082_0215429
837 Ga0530510_0395757
838 2643910714
839 2643963395
840 2644166063
841 2644346931
842 2837679973
843 2848299372
844 2894818379
845 2896186736
846 2939671115
847 2995392959
848 8045865231
849 8054566573
850 8056879514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

31

102

0.9

Map