F440970

General Info

Members Datasets Scaffolds Average Seq Length
425 286 381 298

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10094672|Ga0105237_100946725
Length 318
Sequence MRYDVLVVGGSFAGLSAAMQLARARRKVCVVDAGAPRNRFAAASHGFFGQDGTPPLKMVADARAKLLAYPSVDFVQGSVAAAEADDSGGFTVSVADGAQLSTRKLLLSFGVQDGLPDIPGIGQRWGKSVLHCPYCHGYEFGDRQLGLLFHAGGPPDHALLIAEWGPTTLFLNGSKGPDAEVRARLQSRGVTVEPGRIAGLEGEATDLAGVRLEDGRLMPVEALFVAPHTRPASPLAEQLGCAFDDGPMGQVLRVDAMKMSTVPGVYVAGDLAMAFSNATLASADGLMAGVSMHRSLVFGAERTFFPDSEKPVKNHPII

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
11 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
12 2643221658 Variovorax sp. Root411 Isolate Unclassified
13 2643221672 Variovorax sp. Root434 Isolate Unclassified
14 2643221683 Variovorax sp. Root473 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2738541277 Variovorax sp. GV051 Isolate Unclassified
17 2738543019 Variovorax sp. GV040 Isolate Unclassified
18 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
19 2818991446 Variovorax sp. 1180 Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
22 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
23 2842677519 Variovorax sp. R-72495 Isolate Unclassified
24 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
25 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
26 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
27 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
28 2885198086 Variovorax sp. 679 Isolate Unclassified
29 2885211737 Variovorax sp. 553 Isolate Unclassified
30 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
31 2899924645 Variovorax sp. 369 Isolate Unclassified
32 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
33 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
34 2928037797 Variovorax sp. 1126 Isolate Unclassified
35 2928044640 Variovorax sp. 1128 Isolate Unclassified
36 2928051484 Variovorax sp. 1133 Isolate Unclassified
37 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
38 2928070936 Variovorax gossypii 1167 Isolate Unclassified
39 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
40 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
41 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
42 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
45 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
56 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
116 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
190 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
196 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
197 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
198 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
199 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
200 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
201 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
221 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
222 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
223 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
224 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
225 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
273 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
274 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
275 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
276 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
277 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
278 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
279 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
286 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.18
Metatranscriptomes 0.47
Isolates 10.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.65
Nodule 1.41
Rhizoplane 1.65
Rhizosphere 49.65
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015956 3300001979 Bacteria 2727
2 JGI24737J22298_10001096 3300001990 Bacteria 9522
3 JGI24735J21928_10000741 3300002067 Bacteria 11611
4 JGI25152J39213_1002395 3300002773 Bacteria 7178
5 JGI25152J39213_1002636 3300002773 Bacteria 6664
6 JGI25152J39213_1014138 3300002773 Bacteria 1631
7 JGI25150J39212_1005132 3300002774 Bacteria 2827
8 JGI25150J39212_1015371 3300002774 Bacteria 1278
9 JGI25159J45721_1004150 3300002987 Bacteria 4903
10 JGI25151J46595_10001235 3300003187 Bacteria 18220
11 JGI25151J46595_10004704 3300003187 Bacteria 7178
12 JGI25153J46596_10001688 3300003215 Bacteria 13091
13 JGI25153J46596_10005453 3300003215 Bacteria 6673
14 JGI25153J46596_10005503 3300003215 Bacteria 6632
15 rootH1_10000730 3300003316 Bacteria 3756
16 rootH2_10009632 3300003320 Bacteria 3145
17 rootH2_10009634 3300003320 Bacteria 4641
18 JGI25160J50197_1005394 3300003354 Bacteria 5332
19 JGI25160J50197_1006129 3300003354 Bacteria 4903
20 JGI25161J50226_1001811 3300003374 Bacteria 6003
21 JGI25161J50226_1003240 3300003374 Bacteria 3805
22 Ga0006562J51391_1133847 3300003578 Bacteria 1290
23 Ga0006562J51391_1133848 3300003578 Bacteria 2160
24 Ga0055532_1005166 3300003758 Bacteria 1861
25 Ga0055535_1000214 3300003761 Bacteria 61307
26 Ga0055542_1000003 3300003762 Bacteria 582721
27 Ga0055526_1008953 3300003771 Bacteria 4903
28 Ga0055526_1026557 3300003771 Bacteria 1820
29 Ga0055537_1002031 3300003773 Bacteria 7178
30 Ga0055524_1000125 3300003775 Bacteria 90042
31 Ga0055524_1004174 3300003775 Bacteria 6738
32 Ga0055536_1001902 3300003781 Bacteria 12110
33 Ga0055536_1003492 3300003781 Bacteria 8428
34 Ga0055536_1006452 3300003781 Bacteria 5475
35 Ga0055534_1000211 3300003784 Bacteria 43081
36 Ga0055534_1003512 3300003784 Bacteria 4903
37 Ga0055528_1004037 3300003790 Bacteria 7178
38 Ga0055528_1009264 3300003790 Bacteria 4130
39 Ga0055530_10000470 3300003791 Bacteria 35231
40 Ga0055530_10002453 3300003791 Bacteria 11925
41 Ga0055530_10006040 3300003791 Bacteria 5538
42 Ga0055530_10011304 3300003791 Bacteria 3216
43 Ga0055540_1000011 3300003792 Bacteria 282927
44 Ga0055540_1000816 3300003792 Bacteria 21060
45 Ga0055540_1002194 3300003792 Bacteria 10616
46 Ga0055540_1004703 3300003792 Bacteria 6046
47 Ga0055531_10000408 3300003794 Bacteria 41358
48 Ga0055531_10002420 3300003794 Bacteria 12500
49 Ga0055531_10004006 3300003794 Bacteria 9136
50 Ga0055531_10006515 3300003794 Bacteria 6620
51 Ga0055543_1002067 3300004625 Bacteria 7012
52 Ga0055543_1002159 3300004625 Bacteria 6776
53 Ga0065165_1002512 3300005262 Bacteria 15315
54 Ga0065165_1008985 3300005262 Bacteria 4568
55 Ga0065165_1028372 3300005262 Bacteria 1808
56 Ga0070658_10019169 3300005327 Bacteria 5480
57 Ga0070683_100011787 3300005329 Bacteria 7571
58 Ga0070670_100034638 3300005331 Bacteria 4345
59 Ga0070680_100082430 3300005336 Bacteria 2655
60 Ga0068868_100244081 3300005338 Bacteria 1510
61 Ga0070660_100040845 3300005339 Bacteria 3533
62 Ga0070660_100117649 3300005339 Bacteria 2120
63 Ga0070661_100001154 3300005344 Bacteria 18602
64 Ga0070661_100012211 3300005344 Bacteria 6005
65 Ga0070668_100014658 3300005347 Bacteria 5858
66 Ga0070669_100034014 3300005353 Bacteria 3689
67 Ga0070675_100020962 3300005354 Bacteria 5219
68 Ga0070674_100341080 3300005356 Bacteria 1207
69 Ga0070673_100263531 3300005364 Bacteria 1506
70 Ga0070659_100019634 3300005366 Bacteria 5126
71 Ga0070667_100077595 3300005367 Bacteria 2837
72 Ga0070662_100002942 3300005457 Bacteria 10592
73 Ga0070681_10004263 3300005458 Bacteria 13563
74 Ga0070679_100013215 3300005530 Bacteria 7905
75 Ga0070684_100023179 3300005535 Bacteria 5187
76 Ga0070697_100034595 3300005536 Bacteria 4074
77 Ga0068853_100521791 3300005539 Bacteria 1123
78 Ga0068853_100576224 3300005539 Unclassified 1068
79 Ga0070672_100005227 3300005543 Bacteria 8592
80 Ga0070686_100142317 3300005544 Unclassified 1671
81 Ga0068855_100395372 3300005563 Bacteria 1516
82 Ga0070664_100002304 3300005564 Bacteria 15336
83 Ga0070664_100005110 3300005564 Bacteria 10533
84 Ga0070664_100006588 3300005564 Bacteria 9365
85 Ga0070664_100021022 3300005564 Bacteria 5376
86 Ga0070664_100414252 3300005564 Bacteria 1233
87 Ga0068857_100000324 3300005577 Bacteria 32787
88 Ga0068857_100001499 3300005577 Bacteria 18604
89 Ga0068857_100014686 3300005577 Bacteria 6833
90 Ga0070702_100294939 3300005615 Bacteria 1119
91 Ga0068852_100057433 3300005616 Bacteria 3367
92 Ga0068852_100090875 3300005616 Bacteria 2731
93 Ga0068852_100154586 3300005616 Bacteria 2136
94 Ga0068859_100117906 3300005617 Bacteria 2720
95 Ga0068864_100295307 3300005618 Bacteria 1516
96 Ga0068861_100029795 3300005719 Bacteria 3994
97 Ga0068851_10270284 3300005834 Bacteria 969
98 Ga0068863_100276724 3300005841 Bacteria 1625
99 Ga0068860_100077425 3300005843 Bacteria 3162
100 Ga0075363_100125300 3300006048 Bacteria 1438
101 Ga0075367_10020286 3300006178 Bacteria 3698
102 Ga0075367_10119575 3300006178 Bacteria 1623
103 Ga0075366_10057013 3300006195 Bacteria 2321
104 Ga0097621_100584634 3300006237 Bacteria 1019
105 Ga0075370_10005814 3300006353 Bacteria 6162
106 Ga0075370_10054626 3300006353 Bacteria 2269
107 Ga0075370_10085475 3300006353 Bacteria 1816
108 Ga0068871_100114654 3300006358 Bacteria 2271
109 Ga0075428_100068398 3300006844 Bacteria 3885
110 Ga0075431_100226882 3300006847 Bacteria 1904
111 Ga0075433_10059122 3300006852 Bacteria 3353
112 Ga0075434_100293937 3300006871 Unclassified 1644
113 Ga0068865_100465376 3300006881 Bacteria 1048
114 Ga0097620_100117912 3300006931 Bacteria 2720
115 Ga0079104_1000465 3300006946 Bacteria 45434
116 Ga0099826_10001011 3300006948 Bacteria 15767
117 Ga0099826_10154337 3300006948 Bacteria 1309
118 Ga0105244_10001299 3300009036 Bacteria 20450
119 Ga0105244_10081567 3300009036 Bacteria 1600
120 Ga0105240_10294655 3300009093 Bacteria 1858
121 Ga0105240_10372366 3300009093 Bacteria 1615
122 Ga0111539_10161217 3300009094 Bacteria 2623
123 Ga0111539_10589531 3300009094 Unclassified 1294
124 Ga0114129_10461408 3300009147 Unclassified 1665
125 Ga0105243_10001670 3300009148 Bacteria 19215
126 Ga0105243_10002062 3300009148 Bacteria 17038
127 Ga0105243_10032280 3300009148 Bacteria 4044
128 Ga0105243_10363652 3300009148 Bacteria 1333
129 Ga0105248_10127732 3300009177 Bacteria 2868
130 Ga0105237_10094672 3300009545 Bacteria 2976
131 Ga0105238_10000040 3300009551 Bacteria 156685
132 Ga0105238_10164912 3300009551 Bacteria 2191
133 Ga0105249_10004213 3300009553 Bacteria 12430
134 Ga0105239_10061561 3300010375 Bacteria 4119
135 Ga0105239_10481474 3300010375 Bacteria 1410
136 Ga0157373_10078252 3300013100 Bacteria 2332
137 Ga0157371_10008992 3300013102 Bacteria 7900
138 Ga0157370_10302188 3300013104 Bacteria 1477
139 Ga0157369_10032484 3300013105 Bacteria 5740
140 Ga0163162_10001822 3300013306 Bacteria 20042
141 Ga0157372_10027095 3300013307 Bacteria 6238
142 Ga0157375_10071390 3300013308 Bacteria 3485
143 Ga0163163_10378501 3300014325 Bacteria 1473
144 Ga0157380_10274555 3300014326 Bacteria 1539
145 Ga0157376_10120622 3300014969 Bacteria 2323
146 Ga0182007_10041064 3300015262 Bacteria 1543
147 Ga0163161_10038402 3300017792 Bacteria 3434
148 Ga0163161_10153769 3300017792 Bacteria 1750
149 Ga0213876_10044919 3300021384 Bacteria 2336
150 Ga0209436_102317 3300025208 Bacteria 5828
151 Ga0209436_104669 3300025208 Bacteria 3333
152 Ga0209672_100703 3300025228 Bacteria 16671
153 Ga0209147_101828 3300025229 Bacteria 6591
154 Ga0209258_100015 3300025242 Bacteria 706310
155 Ga0207425_1001226 3300025245 Bacteria 11262
156 Ga0207425_1001941 3300025245 Bacteria 7783
157 Ga0209148_1000028 3300025254 Bacteria 582773
158 Ga0209129_1000043 3300025258 Bacteria 298978
159 Ga0209129_1001448 3300025258 Bacteria 13238
160 Ga0209129_1002697 3300025258 Bacteria 8341
161 Ga0209565_1000302 3300025263 Bacteria 46480
162 Ga0209565_1000766 3300025263 Bacteria 18809
163 Ga0209565_1006277 3300025263 Bacteria 3356
164 Ga0209673_1000293 3300025273 Bacteria 93142
165 Ga0209673_1000400 3300025273 Bacteria 77176
166 Ga0209673_1003165 3300025273 Bacteria 10032
167 Ga0209673_1022506 3300025273 Bacteria 2172
168 Ga0209130_1000881 3300025284 Bacteria 24538
169 Ga0209130_1001173 3300025284 Bacteria 18818
170 Ga0209130_1035745 3300025284 Bacteria 992
171 Ga0209675_1000294 3300025291 Bacteria 46480
172 Ga0209675_1002416 3300025291 Bacteria 9633
173 Ga0209675_1004467 3300025291 Bacteria 6202
174 Ga0209675_1015925 3300025291 Bacteria 2212
175 Ga0209676_1000432 3300025292 Bacteria 72513
176 Ga0209676_1000575 3300025292 Bacteria 55372
177 Ga0209676_1001522 3300025292 Bacteria 21084
178 Ga0209025_1000305 3300025294 Bacteria 109479
179 Ga0209025_1000736 3300025294 Bacteria 55372
180 Ga0209025_1009673 3300025294 Bacteria 6669
181 Ga0209025_1028489 3300025294 Bacteria 2734
182 Ga0209025_1052548 3300025294 Bacteria 1607
183 Ga0209564_1000014 3300025295 Bacteria 621501
184 Ga0209564_1000110 3300025295 Bacteria 212842
185 Ga0209564_1000123 3300025295 Bacteria 202487
186 Ga0209564_1029237 3300025295 Bacteria 1740
187 Ga0209758_1000039 3300025297 Bacteria 428951
188 Ga0209758_1000093 3300025297 Bacteria 241169
189 Ga0209758_1048591 3300025297 Bacteria 1506
190 Ga0209050_1000015 3300025298 Bacteria 759102
191 Ga0209050_1000179 3300025298 Bacteria 143878
192 Ga0209050_1000532 3300025298 Bacteria 63063
193 Ga0209050_1000788 3300025298 Bacteria 45047
194 Ga0209050_1002916 3300025298 Bacteria 13427
195 Ga0209050_1012085 3300025298 Bacteria 4007
196 Ga0209256_1000074 3300025299 Bacteria 236893
197 Ga0209256_1000082 3300025299 Bacteria 221491
198 Ga0209256_1000113 3300025299 Bacteria 175296
199 Ga0209256_1040707 3300025299 Bacteria 1185
200 Ga0207426_1000112 3300025302 Bacteria 231436
201 Ga0207426_1000121 3300025302 Bacteria 219007
202 Ga0209051_1000020 3300025303 Bacteria 508628
203 Ga0209051_1000081 3300025303 Bacteria 195619
204 Ga0209051_1001360 3300025303 Bacteria 21203
205 Ga0209051_1003816 3300025303 Bacteria 9642
206 Ga0209257_1000026 3300025304 Bacteria 723225
207 Ga0209257_1000085 3300025304 Bacteria 291117
208 Ga0209257_1000607 3300025304 Bacteria 58779
209 Ga0209257_1001634 3300025304 Bacteria 25690
210 Ga0207656_10036733 3300025321 Bacteria 2057
211 Ga0207647_10207968 3300025904 Unclassified 1131
212 Ga0207705_10055338 3300025909 Bacteria 2860
213 Ga0207707_10005391 3300025912 Bacteria 11181
214 Ga0207695_10428914 3300025913 Bacteria 1206
215 Ga0207660_10076795 3300025917 Bacteria 2443
216 Ga0207657_10054753 3300025919 Bacteria 3448
217 Ga0207657_10214835 3300025919 Bacteria 1542
218 Ga0207649_10018601 3300025920 Bacteria 3955
219 Ga0207649_10042299 3300025920 Bacteria 2779
220 Ga0207649_10198021 3300025920 Unclassified 1417
221 Ga0207652_10004196 3300025921 Bacteria 11758
222 Ga0207681_10021449 3300025923 Bacteria 4106
223 Ga0207694_10000048 3300025924 Bacteria 163095
224 Ga0207694_10251765 3300025924 Bacteria 1445
225 Ga0207690_10021860 3300025932 Bacteria 3973
226 Ga0207706_10002015 3300025933 Bacteria 19881
227 Ga0207706_10011169 3300025933 Bacteria 8187
228 Ga0207709_10000234 3300025935 Bacteria 70092
229 Ga0207709_10000680 3300025935 Bacteria 27456
230 Ga0207691_10003037 3300025940 Bacteria 16370
231 Ga0207689_10318428 3300025942 Bacteria 1291
232 Ga0207661_10464707 3300025944 Unclassified 1154
233 Ga0207661_10574990 3300025944 Bacteria 1033
234 Ga0207679_10003141 3300025945 Bacteria 10201
235 Ga0207679_10021674 3300025945 Bacteria 4361
236 Ga0207679_10023787 3300025945 Bacteria 4194
237 Ga0207679_10032762 3300025945 Bacteria 3652
238 Ga0207667_10653109 3300025949 Bacteria 1057
239 Ga0207651_10181061 3300025960 Bacteria 1672
240 Ga0207712_10016007 3300025961 Bacteria 4848
241 Ga0207668_10259438 3300025972 Bacteria 1415
242 Ga0207640_10303116 3300025981 Bacteria 1265
243 Ga0207640_10370102 3300025981 Bacteria 1158
244 Ga0207658_10248031 3300025986 Bacteria 1512
245 Ga0207639_10159613 3300026041 Bacteria 1899
246 Ga0207678_10288737 3300026067 Bacteria 1409
247 Ga0207674_10000960 3300026116 Bacteria 37672
248 Ga0207674_10006572 3300026116 Bacteria 13668
249 Ga0207674_10019360 3300026116 Bacteria 7374
250 Ga0207674_10023727 3300026116 Bacteria 6565
251 Ga0207675_100002308 3300026118 Bacteria 18953
252 Ga0207698_10365901 3300026142 Bacteria 1367
253 Ga0209281_1000195 3300027111 Bacteria 139144
254 Ga0209282_1000088 3300027666 Bacteria 66037
255 Ga0209974_10008312 3300027876 Bacteria 3551
256 Ga0268266_10014844 3300028379 Bacteria 6691
257 Ga0268265_10111613 3300028380 Bacteria 2233
258 Ga0307515_10307680 3300028794 Bacteria 1263
259 Ga0316177_1195665 3300030731 Bacteria 3542
260 Ga0316176_1204520 3300030732 Bacteria 2195
261 Ga0314311_1124740 3300030733 Bacteria 2094
262 Ga0316180_1097591 3300030736 Bacteria 2594
263 Ga0316183_1032638 3300030742 Bacteria 1148
264 Ga0316181_1051519 3300030744 Bacteria 3050
265 Ga0316181_1089574 3300030744 Bacteria 1652
266 Ga0316182_1061760 3300030745 Bacteria 2520
267 Ga0316182_1145333 3300030745 Bacteria 2192
268 Ga0307408_100000599 3300031548 Bacteria 30998
269 Ga0307408_100002321 3300031548 Bacteria 13477
270 Ga0307408_100663742 3300031548 Bacteria 933
271 Ga0307405_10011321 3300031731 Bacteria 4668
272 Ga0307405_10021484 3300031731 Bacteria 3629
273 Ga0307405_10027863 3300031731 Bacteria 3282
274 Ga0307406_10000353 3300031901 Bacteria 26800
275 Ga0307406_10001141 3300031901 Bacteria 14860
276 Ga0307412_10029935 3300031911 Bacteria 3421
277 Ga0307412_10369522 3300031911 Bacteria 1157
278 Ga0307416_100661187 3300032002 Bacteria 1130
279 Ga0307414_10021035 3300032004 Bacteria 4082
280 Ga0307414_10050501 3300032004 Bacteria 2881
281 Ga0307414_10059388 3300032004 Bacteria 2700
282 Ga0307414_10133666 3300032004 Bacteria 1930
283 Ga0307411_10054131 3300032005 Bacteria 2633
284 Ga0307415_100113063 3300032126 Bacteria 2019
285 Ga0373935_0207905 3300035692 Bacteria 1355
286 Ga0436365_1781462 3300039437 Bacteria 6113
287 Ga0439436_0002354 3300041404 Bacteria 5660
288 Ga0439466_0004302 3300041411 Bacteria 5498
289 Ga0439465_0037578 3300041413 Bacteria 1557
290 Ga0439431_0002934 3300041997 Bacteria 3749
291 Ga0439433_0001267 3300041999 Bacteria 5219
292 Ga0439445_0002895 3300042004 Bacteria 3832
293 Ga0439432_017015 3300042006 Bacteria 2442
294 Ga0439449_0058187 3300042007 Bacteria 1427
295 Ga0439452_006085 3300042010 Bacteria 3811
296 Ga0439455_0006039 3300042012 Bacteria 2491
297 Ga0439457_005166 3300042014 Bacteria 3314
298 Ga0439462_0001753 3300042015 Bacteria 4907
299 Ga0450911_001043 3300042115 Bacteria 7064
300 Ga0439446_0002492 3300042156 Bacteria 4425
301 Ga0439434_0001200 3300042435 Bacteria 7465
302 Ga0495638_0013133 3300046460 Bacteria 5654
303 Ga0495610_0015480 3300046512 Bacteria 4429
304 Ga0495616_0006928 3300046513 Bacteria 6823
305 Ga0495631_0000757 3300046518 Bacteria 20736
306 Ga0495654_0005594 3300046530 Bacteria 7273
307 Ga0495622_0066075 3300046557 Bacteria 1672
308 Ga0495581_0274509 3300047315 Bacteria 985
309 Ga0495676_0136463 3300047321 Bacteria 1763
310 Ga0495593_0072115 3300047673 Bacteria 1793
311 Ga0495614_0043631 3300048089 Bacteria 1923
312 Ga0496101_0402751 3300048904 Bacteria 1078
313 Ga0496102_0124822 3300048905 Bacteria 2406
314 Ga0496102_0227431 3300048905 Bacteria 1759
315 Ga0496102_0714620 3300048905 Bacteria 925
316 Ga0496116_0005411 3300048919 Bacteria 11873
317 Ga0496116_0016488 3300048919 Bacteria 5777
318 Ga0496117_0021099 3300048920 Bacteria 5286
319 Ga0496117_0071572 3300048920 Bacteria 2323
320 Ga0496118_0009572 3300048921 Bacteria 9756
321 Ga0496118_0009755 3300048921 Bacteria 9631
322 Ga0496118_0207318 3300048921 Bacteria 1154
323 Ga0496121_0014004 3300048924 Bacteria 8562
324 Ga0496121_0050112 3300048924 Bacteria 3531
325 Ga0496121_0109301 3300048924 Bacteria 2113
326 Ga0496122_0187281 3300048925 Bacteria 1226
327 Ga0496123_0024284 3300048926 Bacteria 4612
328 Ga0496123_0064758 3300048926 Bacteria 2328
329 Ga0496124_0031681 3300048927 Bacteria 4678
330 Ga0496124_0034265 3300048927 Bacteria 4458
331 Ga0496125_0024998 3300048928 Bacteria 5480
332 Ga0496125_0074398 3300048928 Bacteria 2634
333 Ga0496125_0085982 3300048928 Bacteria 2380
334 Ga0496125_0088824 3300048928 Bacteria 2327
335 Ga0496125_0143266 3300048928 Bacteria 1657
336 Ga0496126_0423288 3300048929 Bacteria 1076
337 Ga0501300_004498 3300049523 Bacteria 2065
338 Ga0501036_0144173 3300049572 Bacteria 2009
339 Ga0501039_0515966 3300049575 Bacteria 938
340 Ga0501040_0118956 3300049576 Bacteria 1853
341 Ga0501072_0027513 3300049588 Bacteria 4436
342 Ga0501074_0034685 3300049590 Bacteria 3658
343 Ga0501076_0144773 3300049592 Bacteria 1932
344 Ga0501249_000834 3300049679 Bacteria 6812
345 Ga0501225_0004746 3300049705 Bacteria 4030
346 Ga0501282_001239 3300049778 Bacteria 2864
347 Ga0501045_0024863 3300049824 Bacteria 4302
348 nmdc:mga03n38_134498_c1 3300050490 Bacteria 1229
349 nmdc:mga00v17_65256_c1 3300050491 Bacteria 2245
350 nmdc:mga06z11_29853_c1 3300050494 Bacteria 2631
351 nmdc:mga06z11_40125_c1 3300050494 Bacteria 2334
352 nmdc:mga07m45_10459_c1 3300050496 Bacteria 4847
353 nmdc:mga07m45_241478_c1 3300050496 Bacteria 1051
354 nmdc:mga07m45_2577_c1 3300050496 Bacteria 8541
355 nmdc:mga07m45_46558_c1 3300050496 Bacteria 2437
356 nmdc:mga05p37_441242_c1 3300050507 Unclassified 1509
357 nmdc:mga09592_112088_c1 3300050508 Bacteria 2340
358 nmdc:mga08y16_411987_c1 3300050511 Bacteria 1382
359 nmdc:mga08y16_706710_c1 3300050511 Bacteria 1007
360 nmdc:mga0n895_77272_c1 3300050512 Bacteria 3311
361 nmdc:mga0a205_61271_c1 3300050515 Bacteria 3634
362 Ga0500578_0000039 3300053086 Bacteria 134602
363 Ga0500643_013301 3300053087 Bacteria 2912
364 Ga0500651_0000064 3300053093 Bacteria 70497
365 Ga0500566_0151769 3300053094 Bacteria 1217
366 Ga0500571_000147 3300053110 Bacteria 24353
367 Ga0500572_085273 3300053111 Bacteria 994
368 Ga0500594_0000997 3300053118 Bacteria 6067
369 Ga0500607_010480 3300053121 Bacteria 5510
370 Ga0500608_000150 3300053122 Bacteria 29081
371 Ga0500608_073203 3300053122 Bacteria 1627
372 Ga0500655_003477 3300053133 Bacteria 2845
373 Ga0500658_0000353 3300053134 Bacteria 20359
374 Ga0500658_0000482 3300053134 Bacteria 17073
375 Ga0500564_000616 3300053138 Bacteria 10840
376 Ga0500564_026436 3300053138 Bacteria 2668
377 Ga0500568_0000491 3300053139 Bacteria 29108
378 Ga0500616_0075447 3300053153 Bacteria 1706
379 Ga0500624_000618 3300053157 Bacteria 9681
380 Ga0500634_0024349 3300053161 Bacteria 3292
381 Ga0500637_0001682 3300053178 Bacteria 9517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100034595 Ga0070697_1000345957 222
2 3300014325 Ga0163163_10378501 Ga0163163_103785012 239
3 3300048905 Ga0496102_0714620 Ga0496102_0714620_34_771 242
4 3300025981 Ga0207640_10303116 Ga0207640_103031163 244
5 3300053111 Ga0500572_085273 Ga0500572_085273_133_981 268
6 3300006844 Ga0075428_100068398 Ga0075428_1000683982 273
7 3300006847 Ga0075431_100226882 Ga0075431_1002268822 273
8 3300048929 Ga0496126_0423288 Ga0496126_0423288_176_1057 276
9 3300053087 Ga0500643_013301 Ga0500643_013301_125_1027 281
10 3300006178 Ga0075367_10020286 Ga0075367_100202864 282
11 3300050494 nmdc:mga06z11_29853_c1 nmdc:mga06z11_29853_c1_1770_2618 282
12 3300050494 nmdc:mga06z11_40125_c1 nmdc:mga06z11_40125_c1_550_1455 282
13 3300017792 Ga0163161_10153769 Ga0163161_101537693 283
14 3300025986 Ga0207658_10248031 Ga0207658_102480311 283
15 3300046460 Ga0495638_0013133 Ga0495638_0013133_4695_5597 283
16 3300046512 Ga0495610_0015480 Ga0495610_0015480_3344_4246 283
17 3300046513 Ga0495616_0006928 Ga0495616_0006928_5766_6668 283
18 3300046518 Ga0495631_0000757 Ga0495631_0000757_6130_7032 283
19 3300046557 Ga0495622_0066075 Ga0495622_0066075_646_1548 283
20 3300047321 Ga0495676_0136463 Ga0495676_0136463_182_1084 283
21 3300047673 Ga0495593_0072115 Ga0495593_0072115_62_964 283
22 3300048089 Ga0495614_0043631 Ga0495614_0043631_192_1094 283
23 3300048924 Ga0496121_0050112 Ga0496121_0050112_2328_3230 283
24 3300053093 Ga0500651_0000064 Ga0500651_0000064_5315_6217 283
25 3300053094 Ga0500566_0151769 Ga0500566_0151769_165_1067 283
26 3300053110 Ga0500571_000147 Ga0500571_000147_17529_18431 283
27 3300053118 Ga0500594_0000997 Ga0500594_0000997_565_1467 283
28 3300053122 Ga0500608_073203 Ga0500608_073203_678_1580 283
29 3300053133 Ga0500655_003477 Ga0500655_003477_174_1076 283
30 3300053134 Ga0500658_0000353 Ga0500658_0000353_16471_17373 283
31 3300053138 Ga0500564_026436 Ga0500564_026436_140_1042 283
32 3300053153 Ga0500616_0075447 Ga0500616_0075447_125_1027 283
33 3300053161 Ga0500634_0024349 Ga0500634_0024349_173_1075 283
34 3300009036 Ga0105244_10081567 Ga0105244_100815673 284
35 3300046530 Ga0495654_0005594 Ga0495654_0005594_2068_2970 284
36 3300053134 Ga0500658_0000482 Ga0500658_0000482_13198_14100 284
37 3300053139 Ga0500568_0000491 Ga0500568_0000491_13965_14867 284
38 3300028794 Ga0307515_10307680 Ga0307515_103076802 286
39 3300050496 nmdc:mga07m45_241478_c1 nmdc:mga07m45_241478_c1_12_914 286
40 iso_pu_bacteria 2643221550 2643770883 293
41 iso_pu_bacteria 2882806704 2882807325 293
42 iso_pu_bacteria 2894414249 2894417693 294
43 iso_pu_bacteria 2902405164 2902409983 294
44 iso_pu_bacteria 3003665799 3003669209 294
45 iso_pu_bacteria 8045864390 8045865826 294
46 3300042115 Ga0450911_001043 Ga0450911_001043_5253_6140 295
47 3300048924 Ga0496121_0014004 Ga0496121_0014004_3792_4679 295
48 3300048928 Ga0496125_0024998 Ga0496125_0024998_4082_4969 295
49 iso_pu_bacteria 2739367756 2739792619 295
50 iso_pu_bacteria 2834641062 2834645226 295
51 iso_pu_bacteria 2857542790 2857544961 295
52 iso_pu_bacteria 2861691609 2861694262 295
53 iso_pu_bacteria 8003400568 8003403569 295
54 3300005331 Ga0070670_100034638 Ga0070670_1000346383 296
55 3300005338 Ga0068868_100244081 Ga0068868_1002440811 296
56 3300005344 Ga0070661_100012211 Ga0070661_1000122112 296
57 3300005347 Ga0070668_100014658 Ga0070668_1000146583 296
58 3300005353 Ga0070669_100034014 Ga0070669_1000340142 296
59 3300005354 Ga0070675_100020962 Ga0070675_1000209623 296
60 3300005367 Ga0070667_100077595 Ga0070667_1000775952 296
61 3300005539 Ga0068853_100576224 Ga0068853_1005762241 296
62 3300005543 Ga0070672_100005227 Ga0070672_1000052278 296
63 3300005544 Ga0070686_100142317 Ga0070686_1001423171 296
64 3300005563 Ga0068855_100395372 Ga0068855_1003953722 296
65 3300005564 Ga0070664_100021022 Ga0070664_1000210223 296
66 3300005615 Ga0070702_100294939 Ga0070702_1002949391 296
67 3300005616 Ga0068852_100057433 Ga0068852_1000574333 296
68 3300005618 Ga0068864_100295307 Ga0068864_1002953072 296
69 3300005719 Ga0068861_100029795 Ga0068861_1000297953 296
70 3300005841 Ga0068863_100276724 Ga0068863_1002767243 296
71 3300005843 Ga0068860_100077425 Ga0068860_1000774253 296
72 3300006237 Ga0097621_100584634 Ga0097621_1005846341 296
73 3300006852 Ga0075433_10059122 Ga0075433_100591224 296
74 3300006871 Ga0075434_100293937 Ga0075434_1002939371 296
75 3300009094 Ga0111539_10589531 Ga0111539_105895311 296
76 3300009147 Ga0114129_10461408 Ga0114129_104614082 296
77 3300009177 Ga0105248_10127732 Ga0105248_101277323 296
78 3300009553 Ga0105249_10004213 Ga0105249_100042136 296
79 3300010375 Ga0105239_10481474 Ga0105239_104814741 296
80 3300013306 Ga0163162_10001822 Ga0163162_100018223 296
81 3300013308 Ga0157375_10071390 Ga0157375_100713903 296
82 3300014326 Ga0157380_10274555 Ga0157380_102745552 296
83 3300017792 Ga0163161_10038402 Ga0163161_100384023 296
84 3300025904 Ga0207647_10207968 Ga0207647_102079681 296
85 3300025920 Ga0207649_10198021 Ga0207649_101980211 296
86 3300025923 Ga0207681_10021449 Ga0207681_100214493 296
87 3300025933 Ga0207706_10002015 Ga0207706_1000201511 296
88 3300025940 Ga0207691_10003037 Ga0207691_1000303714 296
89 3300025942 Ga0207689_10318428 Ga0207689_103184282 296
90 3300025944 Ga0207661_10464707 Ga0207661_104647071 296
91 3300025945 Ga0207679_10032762 Ga0207679_100327622 296
92 3300025949 Ga0207667_10653109 Ga0207667_106531091 296
93 3300025960 Ga0207651_10181061 Ga0207651_101810612 296
94 3300025961 Ga0207712_10016007 Ga0207712_100160075 296
95 3300025972 Ga0207668_10259438 Ga0207668_102594382 296
96 3300025981 Ga0207640_10370102 Ga0207640_103701021 296
97 3300026041 Ga0207639_10159613 Ga0207639_101596133 296
98 3300026118 Ga0207675_100002308 Ga0207675_1000023082 296
99 3300026142 Ga0207698_10365901 Ga0207698_103659011 296
100 3300028380 Ga0268265_10111613 Ga0268265_101116131 296
101 3300048928 Ga0496125_0085982 Ga0496125_0085982_299_1189 296
102 3300048928 Ga0496125_0143266 Ga0496125_0143266_386_1276 296
103 3300050507 nmdc:mga05p37_441242_c1 nmdc:mga05p37_441242_c1_261_1151 296
104 3300050511 nmdc:mga08y16_706710_c1 nmdc:mga08y16_706710_c1_17_907 296
105 3300050512 nmdc:mga0n895_77272_c1 nmdc:mga0n895_77272_c1_163_1053 296
106 3300050515 nmdc:mga0a205_61271_c1 nmdc:mga0a205_61271_c1_334_1224 296
107 iso_pu_bacteria 2643221658 2644327351 296
108 iso_pu_bacteria 2643221672 2644401957 296
109 iso_pu_bacteria 2643221683 2644465619 296
110 iso_pu_bacteria 2738541277 2738722755 296
111 iso_pu_bacteria 2738543019 2739283326 296
112 iso_pu_bacteria 2842677519 2842681674 296
113 iso_pu_bacteria 2885192300 2885195722 296
114 iso_pu_bacteria 2919462493 2919466577 296
115 iso_pu_bacteria 2928084124 2928085277 296
116 iso_pu_bacteria 2945945610 2945950635 296
117 3300001990 JGI24737J22298_10001096 JGI24737J22298_1000109610 297
118 3300002067 JGI24735J21928_10000741 JGI24735J21928_1000074112 297
119 3300005327 Ga0070658_10019169 Ga0070658_100191692 297
120 3300005329 Ga0070683_100011787 Ga0070683_1000117877 297
121 3300005336 Ga0070680_100082430 Ga0070680_1000824305 297
122 3300005339 Ga0070660_100040845 Ga0070660_1000408452 297
123 3300005344 Ga0070661_100001154 Ga0070661_10000115412 297
124 3300005356 Ga0070674_100341080 Ga0070674_1003410802 297
125 3300005364 Ga0070673_100263531 Ga0070673_1002635312 297
126 3300005366 Ga0070659_100019634 Ga0070659_1000196342 297
127 3300005458 Ga0070681_10004263 Ga0070681_100042639 297
128 3300005530 Ga0070679_100013215 Ga0070679_1000132157 297
129 3300005535 Ga0070684_100023179 Ga0070684_1000231792 297
130 3300005539 Ga0068853_100521791 Ga0068853_1005217911 297
131 3300005564 Ga0070664_100002304 Ga0070664_10000230412 297
132 3300005564 Ga0070664_100005110 Ga0070664_10000511010 297
133 3300005564 Ga0070664_100414252 Ga0070664_1004142522 297
134 3300005577 Ga0068857_100000324 Ga0068857_10000032422 297
135 3300005577 Ga0068857_100001499 Ga0068857_1000014997 297
136 3300005616 Ga0068852_100090875 Ga0068852_1000908754 297
137 3300005616 Ga0068852_100154586 Ga0068852_1001545862 297
138 3300005617 Ga0068859_100117906 Ga0068859_1001179062 297
139 3300005834 Ga0068851_10270284 Ga0068851_102702841 297
140 3300006931 Ga0097620_100117912 Ga0097620_1001179122 297
141 3300009094 Ga0111539_10161217 Ga0111539_101612172 297
142 3300009551 Ga0105238_10000040 Ga0105238_100000409 297
143 3300013105 Ga0157369_10032484 Ga0157369_100324843 297
144 3300015262 Ga0182007_10041064 Ga0182007_100410642 297
145 3300025909 Ga0207705_10055338 Ga0207705_100553383 297
146 3300025912 Ga0207707_10005391 Ga0207707_100053915 297
147 3300025917 Ga0207660_10076795 Ga0207660_100767954 297
148 3300025919 Ga0207657_10054753 Ga0207657_100547533 297
149 3300025920 Ga0207649_10018601 Ga0207649_100186013 297
150 3300025920 Ga0207649_10042299 Ga0207649_100422993 297
151 3300025921 Ga0207652_10004196 Ga0207652_1000419612 297
152 3300025924 Ga0207694_10000048 Ga0207694_100000489 297
153 3300025932 Ga0207690_10021860 Ga0207690_100218604 297
154 3300025944 Ga0207661_10574990 Ga0207661_105749901 297
155 3300025945 Ga0207679_10003141 Ga0207679_100031416 297
156 3300025945 Ga0207679_10023787 Ga0207679_100237873 297
157 3300026067 Ga0207678_10288737 Ga0207678_102887372 297
158 3300026116 Ga0207674_10000960 Ga0207674_1000096026 297
159 3300026116 Ga0207674_10006572 Ga0207674_100065725 297
160 3300026116 Ga0207674_10023727 Ga0207674_100237277 297
161 3300028379 Ga0268266_10014844 Ga0268266_100148444 297
162 3300031548 Ga0307408_100002321 Ga0307408_1000023214 297
163 3300031901 Ga0307406_10001141 Ga0307406_1000114110 297
164 3300031911 Ga0307412_10029935 Ga0307412_100299354 297
165 3300032004 Ga0307414_10133666 Ga0307414_101336662 297
166 3300035692 Ga0373935_0207905 Ga0373935_0207905_299_1192 297
167 3300047315 Ga0495581_0274509 Ga0495581_0274509_16_909 297
168 3300049572 Ga0501036_0144173 Ga0501036_0144173_353_1246 297
169 3300049575 Ga0501039_0515966 Ga0501039_0515966_13_906 297
170 3300049576 Ga0501040_0118956 Ga0501040_0118956_838_1731 297
171 3300049588 Ga0501072_0027513 Ga0501072_0027513_1521_2414 297
172 3300049590 Ga0501074_0034685 Ga0501074_0034685_2729_3622 297
173 3300049592 Ga0501076_0144773 Ga0501076_0144773_754_1647 297
174 3300049824 Ga0501045_0024863 Ga0501045_0024863_2041_2934 297
175 3300050508 nmdc:mga09592_112088_c1 nmdc:mga09592_112088_c1_225_1118 297
176 3300050511 nmdc:mga08y16_411987_c1 nmdc:mga08y16_411987_c1_340_1233 297
177 iso_pu_bacteria 2599185214 2599621402 297
178 iso_pu_bacteria 2599185226 2599670914 297
179 iso_pu_bacteria 2599185227 2599679404 297
180 iso_pu_bacteria 2599185229 2599690913 297
181 iso_pu_bacteria 2818991446 2819597577 297
182 iso_pu_bacteria 2831265667 2831268568 297
183 iso_pu_bacteria 2838054893 2838057993 297
184 iso_pu_bacteria 2885198086 2885200144 297
185 iso_pu_bacteria 2885211737 2885213796 297
186 iso_pu_bacteria 2899924645 2899929000 297
187 iso_pu_bacteria 2928037797 2928040568 297
188 iso_pu_bacteria 2928044640 2928046683 297
189 iso_pu_bacteria 2928051484 2928058132 297
190 iso_pu_bacteria 2928064002 2928067533 297
191 iso_pu_bacteria 2928070936 2928072061 297
192 3300032004 Ga0307414_10050501 Ga0307414_100505012 298
193 3300032004 Ga0307414_10059388 Ga0307414_100593883 298
194 3300002773 JGI25152J39213_1002636 JGI25152J39213_10026364 299
195 3300003215 JGI25153J46596_10001688 JGI25153J46596_1000168813 299
196 3300003771 Ga0055526_1026557 Ga0055526_10265573 299
197 3300003775 Ga0055524_1000125 Ga0055524_100012513 299
198 3300003791 Ga0055530_10000470 Ga0055530_100004704 299
199 3300003791 Ga0055530_10006040 Ga0055530_100060406 299
200 3300003792 Ga0055540_1000011 Ga0055540_100001167 299
201 3300003794 Ga0055531_10004006 Ga0055531_100040065 299
202 3300005262 Ga0065165_1002512 Ga0065165_10025129 299
203 3300009093 Ga0105240_10294655 Ga0105240_102946552 299
204 3300021384 Ga0213876_10044919 Ga0213876_100449192 299
205 3300025258 Ga0209129_1000043 Ga0209129_100004354 299
206 3300025273 Ga0209673_1022506 Ga0209673_10225063 299
207 3300025291 Ga0209675_1015925 Ga0209675_10159253 299
208 3300025295 Ga0209564_1000014 Ga0209564_1000014161 299
209 3300025297 Ga0209758_1000093 Ga0209758_1000093164 299
210 3300025298 Ga0209050_1000179 Ga0209050_100017966 299
211 3300025298 Ga0209050_1000532 Ga0209050_100053214 299
212 3300025298 Ga0209050_1002916 Ga0209050_10029166 299
213 3300025299 Ga0209256_1000113 Ga0209256_100011385 299
214 3300025299 Ga0209256_1040707 Ga0209256_10407072 299
215 3300025303 Ga0209051_1000020 Ga0209051_100002066 299
216 3300025304 Ga0209257_1000085 Ga0209257_100008566 299
217 3300025913 Ga0207695_10428914 Ga0207695_104289141 299
218 3300032004 Ga0307414_10021035 Ga0307414_100210353 299
219 3300039437 Ga0436365_1781462 Ga0436365_1781462_4143_5051 299
220 3300048904 Ga0496101_0402751 Ga0496101_0402751_114_1022 299
221 3300048905 Ga0496102_0124822 Ga0496102_0124822_237_1145 299
222 3300053086 Ga0500578_0000039 Ga0500578_0000039_63468_64400 299
223 3300053122 Ga0500608_000150 Ga0500608_000150_829_1737 299
224 3300053138 Ga0500564_000616 Ga0500564_000616_1367_2275 299
225 3300053157 Ga0500624_000618 Ga0500624_000618_975_1883 299
226 3300053178 Ga0500637_0001682 Ga0500637_0001682_784_1692 299
227 iso_pu_bacteria 2547132374 2548498557 299
228 iso_pu_bacteria 2643221592 2643972689 299
229 iso_pu_bacteria 2643221625 2644143464 299
230 iso_pu_bacteria 2643221648 2644276099 299
231 iso_pu_bacteria 2643221717 2644649293 299
232 3300003187 JGI25151J46595_10001235 JGI25151J46595_1000123517 300
233 3300003781 Ga0055536_1003492 Ga0055536_10034928 300
234 3300003781 Ga0055536_1006452 Ga0055536_10064526 300
235 3300003784 Ga0055534_1000211 Ga0055534_10002117 300
236 3300003790 Ga0055528_1009264 Ga0055528_10092644 300
237 3300003791 Ga0055530_10011304 Ga0055530_100113042 300
238 3300003792 Ga0055540_1000816 Ga0055540_10008168 300
239 3300003792 Ga0055540_1004703 Ga0055540_10047033 300
240 3300003794 Ga0055531_10000408 Ga0055531_1000040838 300
241 3300005339 Ga0070660_100117649 Ga0070660_1001176492 300
242 3300005457 Ga0070662_100002942 Ga0070662_1000029427 300
243 3300005564 Ga0070664_100006588 Ga0070664_1000065884 300
244 3300005577 Ga0068857_100014686 Ga0068857_1000146864 300
245 3300006048 Ga0075363_100125300 Ga0075363_1001253002 300
246 3300006178 Ga0075367_10119575 Ga0075367_101195753 300
247 3300006195 Ga0075366_10057013 Ga0075366_100570133 300
248 3300006353 Ga0075370_10005814 Ga0075370_100058145 300
249 3300006353 Ga0075370_10085475 Ga0075370_100854753 300
250 3300006358 Ga0068871_100114654 Ga0068871_1001146543 300
251 3300006881 Ga0068865_100465376 Ga0068865_1004653761 300
252 3300006946 Ga0079104_1000465 Ga0079104_100046512 300
253 3300006948 Ga0099826_10001011 Ga0099826_1000101113 300
254 3300006948 Ga0099826_10154337 Ga0099826_101543372 300
255 3300009036 Ga0105244_10001299 Ga0105244_100012998 300
256 3300009148 Ga0105243_10001670 Ga0105243_1000167018 300
257 3300009148 Ga0105243_10002062 Ga0105243_1000206211 300
258 3300009148 Ga0105243_10032280 Ga0105243_100322802 300
259 3300009148 Ga0105243_10363652 Ga0105243_103636522 300
260 3300009545 Ga0105237_10094672 Ga0105237_100946725 300
261 3300009551 Ga0105238_10164912 Ga0105238_101649123 300
262 3300010375 Ga0105239_10061561 Ga0105239_100615615 300
263 3300013100 Ga0157373_10078252 Ga0157373_100782522 300
264 3300014969 Ga0157376_10120622 Ga0157376_101206223 300
265 3300025258 Ga0209129_1002697 Ga0209129_10026978 300
266 3300025263 Ga0209565_1000302 Ga0209565_100030239 300
267 3300025273 Ga0209673_1003165 Ga0209673_10031659 300
268 3300025291 Ga0209675_1000294 Ga0209675_100029439 300
269 3300025292 Ga0209676_1000432 Ga0209676_10004326 300
270 3300025292 Ga0209676_1001522 Ga0209676_100152216 300
271 3300025294 Ga0209025_1000736 Ga0209025_10007368 300
272 3300025294 Ga0209025_1028489 Ga0209025_10284891 300
273 3300025294 Ga0209025_1052548 Ga0209025_10525482 300
274 3300025295 Ga0209564_1029237 Ga0209564_10292372 300
275 3300025298 Ga0209050_1000788 Ga0209050_100078840 300
276 3300025298 Ga0209050_1012085 Ga0209050_10120854 300
277 3300025303 Ga0209051_1001360 Ga0209051_100136016 300
278 3300025303 Ga0209051_1003816 Ga0209051_10038166 300
279 3300025304 Ga0209257_1000607 Ga0209257_100060747 300
280 3300025919 Ga0207657_10214835 Ga0207657_102148352 300
281 3300025924 Ga0207694_10251765 Ga0207694_102517652 300
282 3300025933 Ga0207706_10011169 Ga0207706_100111695 300
283 3300025935 Ga0207709_10000234 Ga0207709_100002346 300
284 3300025935 Ga0207709_10000680 Ga0207709_1000068013 300
285 3300025945 Ga0207679_10021674 Ga0207679_100216742 300
286 3300026116 Ga0207674_10019360 Ga0207674_100193604 300
287 3300027111 Ga0209281_1000195 Ga0209281_100019537 300
288 3300027666 Ga0209282_1000088 Ga0209282_10000883 300
289 3300027876 Ga0209974_10008312 Ga0209974_100083124 300
290 3300030731 Ga0316177_1195665 Ga0316177_11956653 300
291 3300030732 Ga0316176_1204520 Ga0316176_12045203 300
292 3300030733 Ga0314311_1124740 Ga0314311_11247403 300
293 3300030736 Ga0316180_1097591 Ga0316180_10975911 300
294 3300030742 Ga0316183_1032638 Ga0316183_10326382 300
295 3300030744 Ga0316181_1051519 Ga0316181_10515192 300
296 3300030744 Ga0316181_1089574 Ga0316181_10895743 300
297 3300030745 Ga0316182_1061760 Ga0316182_10617602 300
298 3300030745 Ga0316182_1145333 Ga0316182_11453333 300
299 3300031548 Ga0307408_100000599 Ga0307408_1000005999 300
300 3300031548 Ga0307408_100663742 Ga0307408_1006637421 300
301 3300031731 Ga0307405_10011321 Ga0307405_100113216 300
302 3300031731 Ga0307405_10021484 Ga0307405_100214845 300
303 3300031731 Ga0307405_10027863 Ga0307405_100278635 300
304 3300031901 Ga0307406_10000353 Ga0307406_1000035322 300
305 3300031911 Ga0307412_10369522 Ga0307412_103695222 300
306 3300032002 Ga0307416_100661187 Ga0307416_1006611872 300
307 3300032005 Ga0307411_10054131 Ga0307411_100541313 300
308 3300032126 Ga0307415_100113063 Ga0307415_1001130633 300
309 3300041404 Ga0439436_0002354 Ga0439436_0002354_2363_3274 300
310 3300041411 Ga0439466_0004302 Ga0439466_0004302_2920_3831 300
311 3300041413 Ga0439465_0037578 Ga0439465_0037578_203_1114 300
312 3300041997 Ga0439431_0002934 Ga0439431_0002934_1120_2031 300
313 3300041999 Ga0439433_0001267 Ga0439433_0001267_675_1586 300
314 3300042004 Ga0439445_0002895 Ga0439445_0002895_318_1229 300
315 3300042006 Ga0439432_017015 Ga0439432_017015_490_1401 300
316 3300042007 Ga0439449_0058187 Ga0439449_0058187_402_1304 300
317 3300042010 Ga0439452_006085 Ga0439452_006085_269_1180 300
318 3300042014 Ga0439457_005166 Ga0439457_005166_495_1406 300
319 3300042015 Ga0439462_0001753 Ga0439462_0001753_2842_3753 300
320 3300042156 Ga0439446_0002492 Ga0439446_0002492_1391_2302 300
321 3300042435 Ga0439434_0001200 Ga0439434_0001200_1391_2302 300
322 3300048905 Ga0496102_0227431 Ga0496102_0227431_262_1164 300
323 3300048919 Ga0496116_0005411 Ga0496116_0005411_5288_6190 300
324 3300048919 Ga0496116_0016488 Ga0496116_0016488_4097_4999 300
325 3300048920 Ga0496117_0071572 Ga0496117_0071572_1349_2251 300
326 3300048921 Ga0496118_0009755 Ga0496118_0009755_3378_4280 300
327 3300048921 Ga0496118_0207318 Ga0496118_0207318_159_1061 300
328 3300048924 Ga0496121_0109301 Ga0496121_0109301_735_1637 300
329 3300048925 Ga0496122_0187281 Ga0496122_0187281_155_1057 300
330 3300048926 Ga0496123_0024284 Ga0496123_0024284_1050_1952 300
331 3300048926 Ga0496123_0064758 Ga0496123_0064758_1369_2271 300
332 3300048927 Ga0496124_0034265 Ga0496124_0034265_2868_3770 300
333 3300048928 Ga0496125_0074398 Ga0496125_0074398_1676_2578 300
334 3300049523 Ga0501300_004498 Ga0501300_004498_518_1486 300
335 3300049679 Ga0501249_000834 Ga0501249_000834_5621_6526 300
336 3300049705 Ga0501225_0004746 Ga0501225_0004746_1930_2835 300
337 3300049778 Ga0501282_001239 Ga0501282_001239_1107_2183 300
338 3300050490 nmdc:mga03n38_134498_c1 nmdc:mga03n38_134498_c1_282_1184 300
339 3300050491 nmdc:mga00v17_65256_c1 nmdc:mga00v17_65256_c1_54_956 300
340 3300050496 nmdc:mga07m45_10459_c1 nmdc:mga07m45_10459_c1_3104_4006 300
341 3300050496 nmdc:mga07m45_2577_c1 nmdc:mga07m45_2577_c1_3795_4697 300
342 3300053121 Ga0500607_010480 Ga0500607_010480_143_1045 300
343 iso_pu_bacteria 2643221570 2643866929 300
344 iso_pu_bacteria 2643221596 2643993656 300
345 iso_pu_bacteria 2990710928 2990712880 300
346 3300001979 JGI24740J21852_10015956 JGI24740J21852_100159563 301
347 3300002773 JGI25152J39213_1002395 JGI25152J39213_10023956 301
348 3300002773 JGI25152J39213_1014138 JGI25152J39213_10141382 301
349 3300002774 JGI25150J39212_1005132 JGI25150J39212_10051323 301
350 3300002774 JGI25150J39212_1015371 JGI25150J39212_10153712 301
351 3300002987 JGI25159J45721_1004150 JGI25159J45721_10041504 301
352 3300003187 JGI25151J46595_10004704 JGI25151J46595_100047046 301
353 3300003215 JGI25153J46596_10005453 JGI25153J46596_100054539 301
354 3300003215 JGI25153J46596_10005503 JGI25153J46596_100055034 301
355 3300003316 rootH1_10000730 rootH1_100007303 301
356 3300003320 rootH2_10009632 rootH2_100096322 301
357 3300003320 rootH2_10009634 rootH2_100096346 301
358 3300003354 JGI25160J50197_1005394 JGI25160J50197_10053945 301
359 3300003354 JGI25160J50197_1006129 JGI25160J50197_10061294 301
360 3300003374 JGI25161J50226_1001811 JGI25161J50226_10018117 301
361 3300003374 JGI25161J50226_1003240 JGI25161J50226_10032403 301
362 3300003578 Ga0006562J51391_1133847 Ga0006562J51391_11338472 301
363 3300003578 Ga0006562J51391_1133848 Ga0006562J51391_11338483 301
364 3300003758 Ga0055532_1005166 Ga0055532_10051662 301
365 3300003761 Ga0055535_1000214 Ga0055535_100021421 301
366 3300003762 Ga0055542_1000003 Ga0055542_1000003471 301
367 3300003771 Ga0055526_1008953 Ga0055526_10089534 301
368 3300003773 Ga0055537_1002031 Ga0055537_10020316 301
369 3300003775 Ga0055524_1004174 Ga0055524_10041746 301
370 3300003781 Ga0055536_1001902 Ga0055536_10019028 301
371 3300003784 Ga0055534_1003512 Ga0055534_10035124 301
372 3300003790 Ga0055528_1004037 Ga0055528_10040376 301
373 3300003791 Ga0055530_10002453 Ga0055530_1000245311 301
374 3300003792 Ga0055540_1002194 Ga0055540_10021949 301
375 3300003794 Ga0055531_10002420 Ga0055531_1000242010 301
376 3300003794 Ga0055531_10006515 Ga0055531_100065156 301
377 3300004625 Ga0055543_1002067 Ga0055543_10020675 301
378 3300004625 Ga0055543_1002159 Ga0055543_10021595 301
379 3300005262 Ga0065165_1008985 Ga0065165_10089856 301
380 3300005262 Ga0065165_1028372 Ga0065165_10283723 301
381 3300006353 Ga0075370_10054626 Ga0075370_100546263 301
382 3300009093 Ga0105240_10372366 Ga0105240_103723662 301
383 3300013102 Ga0157371_10008992 Ga0157371_100089923 301
384 3300013104 Ga0157370_10302188 Ga0157370_103021882 301
385 3300013307 Ga0157372_10027095 Ga0157372_100270954 301
386 3300025208 Ga0209436_102317 Ga0209436_1023174 301
387 3300025208 Ga0209436_104669 Ga0209436_1046692 301
388 3300025228 Ga0209672_100703 Ga0209672_1007037 301
389 3300025229 Ga0209147_101828 Ga0209147_1018286 301
390 3300025242 Ga0209258_100015 Ga0209258_100015591 301
391 3300025245 Ga0207425_1001226 Ga0207425_10012267 301
392 3300025245 Ga0207425_1001941 Ga0207425_10019415 301
393 3300025254 Ga0209148_1000028 Ga0209148_100002878 301
394 3300025258 Ga0209129_1001448 Ga0209129_10014486 301
395 3300025263 Ga0209565_1000766 Ga0209565_10007666 301
396 3300025263 Ga0209565_1006277 Ga0209565_10062773 301
397 3300025273 Ga0209673_1000293 Ga0209673_100029372 301
398 3300025273 Ga0209673_1000400 Ga0209673_100040024 301
399 3300025284 Ga0209130_1000881 Ga0209130_10008817 301
400 3300025284 Ga0209130_1001173 Ga0209130_10011736 301
401 3300025284 Ga0209130_1035745 Ga0209130_10357451 301
402 3300025291 Ga0209675_1002416 Ga0209675_10024167 301
403 3300025291 Ga0209675_1004467 Ga0209675_10044675 301
404 3300025292 Ga0209676_1000575 Ga0209676_100057546 301
405 3300025294 Ga0209025_1000305 Ga0209025_100030567 301
406 3300025294 Ga0209025_1009673 Ga0209025_10096732 301
407 3300025295 Ga0209564_1000110 Ga0209564_100011077 301
408 3300025295 Ga0209564_1000123 Ga0209564_100012346 301
409 3300025297 Ga0209758_1000039 Ga0209758_100003977 301
410 3300025297 Ga0209758_1048591 Ga0209758_10485912 301
411 3300025298 Ga0209050_1000015 Ga0209050_1000015643 301
412 3300025299 Ga0209256_1000074 Ga0209256_100007477 301
413 3300025299 Ga0209256_1000082 Ga0209256_100008264 301
414 3300025302 Ga0207426_1000112 Ga0207426_1000112137 301
415 3300025302 Ga0207426_1000121 Ga0207426_100012176 301
416 3300025303 Ga0209051_1000081 Ga0209051_100008179 301
417 3300025304 Ga0209257_1000026 Ga0209257_100002634 301
418 3300025304 Ga0209257_1001634 Ga0209257_100163421 301
419 3300025321 Ga0207656_10036733 Ga0207656_100367333 301
420 3300042012 Ga0439455_0006039 Ga0439455_0006039_1370_2275 301
421 3300048920 Ga0496117_0021099 Ga0496117_0021099_569_1474 301
422 3300048921 Ga0496118_0009572 Ga0496118_0009572_5186_6091 301
423 3300048927 Ga0496124_0031681 Ga0496124_0031681_1770_2675 301
424 3300048928 Ga0496125_0088824 Ga0496125_0088824_24_929 301
425 3300050496 nmdc:mga07m45_46558_c1 nmdc:mga07m45_46558_c1_47_952 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01134

GIDA

Glucose inhibited division protein A

4

114

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

172

285

0.87

PF00890

FAD_binding_2

FAD binding domain

4

69

0.85

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

3

152

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nte-assembly1.cif.gz_B crystal structure of deph 0.9755 1 299
4nte-assembly1.cif.gz_A crystal structure of deph 0.9628 1 299
4jna-assembly2.cif.gz_B crystal structure of the deph complex with dimethyl-fk228 0.96 3 299
4nte-assembly1.cif.gz_B crystal structure of deph 0.9593 1 299
4nte-assembly1.cif.gz_A crystal structure of deph 0.9563 1 299
ID Description Score Start End Superfamily
4jnaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9597 1 299 3.50.50.60
af_O60112_6_422_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9467 3 33 3.30.300.30
4jn9A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9425 116 226 3.50.50.60
4jnaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9399 1 299 3.50.50.60
af_K7K8P2_5_195_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9312 3 33 3.80.10.10
ID Description Score Start End GO Terms
AF-H8H2W4-F1-model_v4 FAD-dependent pyridine nucleotide-disulfide oxidoreductase 0.9779 2 300 GO:0016491
AF-A0A258LVP3-F1-model_v4 Thioredoxin reductase 0.9765 1 299 GO:0016491
AF-A0A7X1AZZ6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.973 1 299 GO:0016020
GO:0016491
AF-C4APT1-F1-model_v4 deleted 0.9716 1 274
AF-A0A7X1AZZ6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9698 1 299 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.65 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map