F440968

General Info

Members Datasets Scaffolds Average Seq Length
425 200 850 145

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_12329389|Ga0105243_123293891
Length 171
Sequence MQRSMRRGLRNLRRRSEFTDFLARYQMKGHLFVTGALTLGLMMVGASVSAHHGNAAYADDVTEFKQATVTKVNWANPHALIFFDAKDAKGNLVHMVVESAAPQALRLIGWEKTSLVPGDIITVRMYVSKNDNPAGRLQKIVLADGSELRDTQLGGDAPKTRYDPDAESGKK

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.76
Stem 0
Stem Tuber 0
Unclassified 33.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_12329389 3300009148 Unclassified 573
2 JGI25406J46586_10001882 3300003203 Bacteria 9868
3 Ga0058859_10043612 3300004798 Bacteria 1597
4 Ga0058862_11339726 3300004803 Bacteria 694
5 Ga0065704_10002050 3300005289 Bacteria 9174
6 Ga0065704_10277582 3300005289 Archaea 929
7 Ga0065712_10385862 3300005290 Unclassified 747
8 Ga0065715_10091952 3300005293 Bacteria 5437
9 Ga0065715_10119183 3300005293 Bacteria 2293
10 Ga0065715_10129310 3300005293 Unclassified 2047
11 Ga0065715_10442982 3300005293 Bacteria 834
12 Ga0065707_10107912 3300005295 Unclassified 2532
13 Ga0065707_10241359 3300005295 Bacteria 1154
14 Ga0065707_10274886 3300005295 Bacteria 1062
15 Ga0065707_10515006 3300005295 Unclassified 746
16 Ga0070676_10022265 3300005328 Bacteria 3553
17 Ga0070683_100394593 3300005329 Unclassified 1319
18 Ga0070690_100015779 3300005330 Bacteria 4513
19 Ga0070670_100028770 3300005331 Bacteria 4784
20 Ga0070670_100194535 3300005331 Bacteria 1762
21 Ga0070677_10063061 3300005333 Unclassified 1535
22 Ga0068869_100225290 3300005334 Unclassified 1488
23 Ga0070680_100090529 3300005336 Unclassified 2533
24 Ga0070680_100588599 3300005336 Bacteria 955
25 Ga0070680_100667292 3300005336 Bacteria 894
26 Ga0068868_100368982 3300005338 Bacteria 1233
27 Ga0070689_100054035 3300005340 Bacteria 3109
28 Ga0070689_100119097 3300005340 Unclassified 2108
29 Ga0070689_100287678 3300005340 Bacteria 1365
30 Ga0070687_100010693 3300005343 Unclassified 3983
31 Ga0070687_100194785 3300005343 Unclassified 1224
32 Ga0070692_10106019 3300005345 Bacteria 1548
33 Ga0070692_10207097 3300005345 Bacteria 1152
34 Ga0070692_10592275 3300005345 Unclassified 732
35 Ga0070692_11117652 3300005345 Unclassified 557
36 Ga0070668_100237082 3300005347 Unclassified 1510
37 Ga0070669_100003423 3300005353 Bacteria 11427
38 Ga0070669_100144078 3300005353 Unclassified 1839
39 Ga0070669_100520702 3300005353 Unclassified 989
40 Ga0070669_101823065 3300005353 Unclassified 531
41 Ga0070675_100000119 3300005354 Bacteria 46621
42 Ga0070675_100042270 3300005354 Bacteria 3724
43 Ga0070675_100088614 3300005354 Unclassified 2590
44 Ga0070675_100271540 3300005354 Bacteria 1488
45 Ga0070671_100141074 3300005355 Unclassified 2033
46 Ga0070671_100520091 3300005355 Unclassified 1025
47 Ga0070673_100042537 3300005364 Bacteria 3504
48 Ga0070673_100239244 3300005364 Bacteria 1578
49 Ga0070673_100512778 3300005364 Archaea 1086
50 Ga0070688_100004905 3300005365 Bacteria 7001
51 Ga0070688_100048181 3300005365 Unclassified 2647
52 Ga0070659_100118608 3300005366 Bacteria 2141
53 Ga0070703_10088135 3300005406 Bacteria 1071
54 Ga0070701_10009768 3300005438 Unclassified 4215
55 Ga0070705_100000684 3300005440 Bacteria 19432
56 Ga0070705_100297423 3300005440 Bacteria 1155
57 Ga0070700_100004007 3300005441 Bacteria 7656
58 Ga0070700_100377184 3300005441 Unclassified 1059
59 Ga0070700_101272807 3300005441 Unclassified 617
60 Ga0070694_100089045 3300005444 Bacteria 2162
61 Ga0070694_101132612 3300005444 Bacteria 654
62 Ga0070708_100283306 3300005445 Bacteria 1560
63 Ga0070708_102110607 3300005445 Bacteria 521
64 Ga0070678_100737625 3300005456 Bacteria 890
65 Ga0070662_100009791 3300005457 Bacteria 6278
66 Ga0070681_10175551 3300005458 Bacteria 2064
67 Ga0070681_10790262 3300005458 Unclassified 866
68 Ga0068867_100004226 3300005459 Bacteria 10107
69 Ga0068867_100176737 3300005459 Bacteria 1694
70 Ga0068867_101759450 3300005459 Unclassified 582
71 Ga0070685_10069420 3300005466 Unclassified 2084
72 Ga0070706_100122051 3300005467 Bacteria 2429
73 Ga0070706_100349645 3300005467 Unclassified 1378
74 Ga0070706_101589064 3300005467 Unclassified 597
75 Ga0070707_100108046 3300005468 Bacteria 2699
76 Ga0070707_100530915 3300005468 Unclassified 1139
77 Ga0070707_101656962 3300005468 Bacteria 607
78 Ga0070698_100062160 3300005471 Bacteria 3767
79 Ga0070698_100063813 3300005471 Bacteria 3713
80 Ga0070698_100066787 3300005471 Unclassified 3618
81 Ga0070698_100185866 3300005471 Bacteria 2016
82 Ga0070698_100504696 3300005471 Bacteria 1147
83 Ga0070698_100961241 3300005471 Bacteria 801
84 Ga0070699_100000268 3300005518 Bacteria 49871
85 Ga0070699_100017209 3300005518 Bacteria 6208
86 Ga0070699_100673096 3300005518 Bacteria 945
87 Ga0070699_102030352 3300005518 Unclassified 525
88 Ga0070699_102228655 3300005518 Bacteria 500
89 Ga0070679_100066931 3300005530 Unclassified 3582
90 Ga0070684_100030313 3300005535 Bacteria 4594
91 Ga0070684_100626289 3300005535 Unclassified 1001
92 Ga0070684_100778707 3300005535 Bacteria 894
93 Ga0070697_100095989 3300005536 Bacteria 2459
94 Ga0070697_101031211 3300005536 Bacteria 731
95 Ga0070672_100103081 3300005543 Bacteria 2317
96 Ga0070672_100114481 3300005543 Bacteria 2202
97 Ga0070686_100064016 3300005544 Bacteria 2384
98 Ga0070686_100762670 3300005544 Unclassified 777
99 Ga0070695_100000565 3300005545 Bacteria 19525
100 Ga0070695_100949310 3300005545 Unclassified 697
101 Ga0070696_100000299 3300005546 Bacteria 29928
102 Ga0070696_100012708 3300005546 Bacteria 5654
103 Ga0070696_100830078 3300005546 Unclassified 762
104 Ga0070696_100891623 3300005546 Unclassified 737
105 Ga0070693_100293380 3300005547 Bacteria 1093
106 Ga0070704_100102718 3300005549 Bacteria 2158
107 Ga0070704_100108251 3300005549 Bacteria 2110
108 Ga0070704_100579747 3300005549 Unclassified 983
109 Ga0070704_101315389 3300005549 Unclassified 661
110 Ga0070664_100012670 3300005564 Bacteria 6866
111 Ga0070664_100016441 3300005564 Bacteria 6066
112 Ga0070664_100040409 3300005564 Bacteria 3932
113 Ga0070664_101630577 3300005564 Unclassified 611
114 Ga0068857_100008754 3300005577 Bacteria 8766
115 Ga0068857_100157944 3300005577 Unclassified 2057
116 Ga0068857_100528772 3300005577 Bacteria 1109
117 Ga0068854_100690674 3300005578 Bacteria 880
118 Ga0068856_101196937 3300005614 Bacteria 776
119 Ga0070702_100019545 3300005615 Unclassified 3536
120 Ga0068852_100150739 3300005616 Bacteria 2162
121 Ga0068859_100005376 3300005617 Bacteria 13024
122 Ga0068859_100018455 3300005617 Bacteria 7011
123 Ga0068859_101882924 3300005617 Bacteria 660
124 Ga0068864_100049009 3300005618 Bacteria 3633
125 Ga0068864_100301643 3300005618 Archaea 1500
126 Ga0068861_100001273 3300005719 Bacteria 15747
127 Ga0068870_10013789 3300005840 Bacteria 3805
128 Ga0068870_10018246 3300005840 Bacteria 3385
129 Ga0068870_10673832 3300005840 Unclassified 711
130 Ga0068858_100023832 3300005842 Bacteria 5703
131 Ga0068860_100014254 3300005843 Bacteria 7795
132 Ga0068860_100274810 3300005843 Unclassified 1645
133 Ga0068862_100004775 3300005844 Bacteria 11406
134 Ga0081455_10142437 3300005937 Bacteria 1860
135 Ga0081539_10000025 3300005985 Bacteria 340255
136 Ga0081539_10003725 3300005985 Bacteria 18161
137 Ga0081539_10316161 3300005985 Unclassified 666
138 Ga0097621_100045848 3300006237 Bacteria 3533
139 Ga0097621_100806315 3300006237 Unclassified 870
140 Ga0068871_100250510 3300006358 Unclassified 1542
141 Ga0075428_100003266 3300006844 Bacteria 17744
142 Ga0075428_100044640 3300006844 Bacteria 4869
143 Ga0075428_100103355 3300006844 Unclassified 3107
144 Ga0075428_100585849 3300006844 Unclassified 1192
145 Ga0075428_100601980 3300006844 Unclassified 1174
146 Ga0075430_100018424 3300006846 Bacteria 5940
147 Ga0075430_100091736 3300006846 Bacteria 2540
148 Ga0075430_100200453 3300006846 Bacteria 1657
149 Ga0075431_100042763 3300006847 Bacteria 4674
150 Ga0075431_100159623 3300006847 Unclassified 2319
151 Ga0075431_100160293 3300006847 Bacteria 2313
152 Ga0075431_100229610 3300006847 Unclassified 1891
153 Ga0075431_101240881 3300006847 Unclassified 707
154 Ga0075433_10063729 3300006852 Bacteria 3230
155 Ga0075433_10088127 3300006852 Bacteria 2742
156 Ga0075433_10103083 3300006852 Unclassified 2527
157 Ga0075433_10457026 3300006852 Bacteria 1125
158 Ga0075434_100005230 3300006871 Bacteria 11789
159 Ga0075434_100018968 3300006871 Bacteria 6648
160 Ga0075434_100040603 3300006871 Bacteria 4607
161 Ga0075434_100072530 3300006871 Bacteria 3435
162 Ga0075434_100098366 3300006871 Unclassified 2931
163 Ga0075434_100405294 3300006871 Unclassified 1385
164 Ga0075434_101315449 3300006871 Unclassified 733
165 Ga0075429_100006153 3300006880 Bacteria 10374
166 Ga0075429_100032096 3300006880 Unclassified 4565
167 Ga0075429_100059661 3300006880 Unclassified 3323
168 Ga0075429_100093171 3300006880 Bacteria 2627
169 Ga0075429_100158373 3300006880 Bacteria 1983
170 Ga0075429_100242800 3300006880 Bacteria 1577
171 Ga0097620_100005376 3300006931 Bacteria 13024
172 Ga0097620_100018454 3300006931 Bacteria 7011
173 Ga0097620_101882889 3300006931 Bacteria 660
174 Ga0075435_100007095 3300007076 Bacteria 7956
175 Ga0075435_100100427 3300007076 Unclassified 2397
176 Ga0075435_100144365 3300007076 Bacteria 1998
177 Ga0111539_10025985 3300009094 Bacteria 7166
178 Ga0111539_10037188 3300009094 Bacteria 5880
179 Ga0111539_10180315 3300009094 Bacteria 2467
180 Ga0111539_10182322 3300009094 Unclassified 2452
181 Ga0111539_10509577 3300009094 Unclassified 1401
182 Ga0114129_10002458 3300009147 Bacteria 25718
183 Ga0114129_10007358 3300009147 Bacteria 15672
184 Ga0114129_10022237 3300009147 Bacteria 9002
185 Ga0114129_10029686 3300009147 Bacteria 7742
186 Ga0114129_10308212 3300009147 Bacteria 2108
187 Ga0114129_10653124 3300009147 Bacteria 1357
188 Ga0114129_10756848 3300009147 Bacteria 1243
189 Ga0114129_11001183 3300009147 Bacteria 1052
190 Ga0105243_10084917 3300009148 Bacteria 2594
191 Ga0105243_11800127 3300009148 Unclassified 643
192 Ga0105242_11270584 3300009176 Unclassified 758
193 Ga0105249_10006243 3300009553 Bacteria 10351
194 Ga0105249_11608806 3300009553 Unclassified 722
195 Ga0105239_11922378 3300010375 Unclassified 686
196 Ga0105246_10266845 3300011119 Unclassified 1366
197 Ga0157371_10876577 3300013102 Unclassified 680
198 Ga0157378_10190687 3300013297 Bacteria 1933
199 Ga0157378_11079462 3300013297 Bacteria 839
200 Ga0157375_10002540 3300013308 Bacteria 15836
201 Ga0157375_10628577 3300013308 Unclassified 1231
202 Ga0157380_10151531 3300014326 Bacteria 2005
203 Ga0157380_10176617 3300014326 Unclassified 1872
204 Ga0157376_10806524 3300014969 Unclassified 952
205 Ga0207697_10381924 3300025315 Unclassified 626
206 Ga0207682_10082543 3300025893 Unclassified 1380
207 Ga0207688_10032607 3300025901 Bacteria 2880
208 Ga0207645_10044273 3300025907 Bacteria 2849
209 Ga0207643_10051996 3300025908 Bacteria 2326
210 Ga0207643_10069452 3300025908 Unclassified 2025
211 Ga0207643_10193914 3300025908 Bacteria 1234
212 Ga0207684_10429145 3300025910 Unclassified 1135
213 Ga0207684_11607410 3300025910 Unclassified 526
214 Ga0207707_10434308 3300025912 Bacteria 1124
215 Ga0207660_10226840 3300025917 Archaea 1468
216 Ga0207660_10291826 3300025917 Bacteria 1297
217 Ga0207660_10562179 3300025917 Bacteria 928
218 Ga0207662_10022811 3300025918 Unclassified 3592
219 Ga0207662_10214729 3300025918 Unclassified 1250
220 Ga0207652_11304776 3300025921 Bacteria 628
221 Ga0207652_11376266 3300025921 Unclassified 609
222 Ga0207646_10148287 3300025922 Bacteria 2115
223 Ga0207646_10275998 3300025922 Unclassified 1519
224 Ga0207646_10848451 3300025922 Unclassified 812
225 Ga0207681_10024997 3300025923 Bacteria 3837
226 Ga0207681_10075577 3300025923 Unclassified 2363
227 Ga0207681_10555534 3300025923 Bacteria 945
228 Ga0207650_10013786 3300025925 Bacteria 5605
229 Ga0207659_10001007 3300025926 Bacteria 16762
230 Ga0207659_10016635 3300025926 Bacteria 4791
231 Ga0207659_10383132 3300025926 Unclassified 1173
232 Ga0207644_10099461 3300025931 Unclassified 2182
233 Ga0207644_10413666 3300025931 Bacteria 1104
234 Ga0207706_10009430 3300025933 Bacteria 8961
235 Ga0207706_10136936 3300025933 Unclassified 2154
236 Ga0207706_10383420 3300025933 Unclassified 1220
237 Ga0207686_11056345 3300025934 Bacteria 661
238 Ga0207709_10018127 3300025935 Bacteria 3938
239 Ga0207709_10835438 3300025935 Unclassified 745
240 Ga0207670_10006051 3300025936 Bacteria 6688
241 Ga0207670_10041953 3300025936 Bacteria 3012
242 Ga0207670_10221617 3300025936 Bacteria 1448
243 Ga0207669_10901099 3300025937 Unclassified 739
244 Ga0207669_11365656 3300025937 Bacteria 603
245 Ga0207704_10167384 3300025938 Bacteria 1572
246 Ga0207691_10041887 3300025940 Bacteria 4224
247 Ga0207691_10153464 3300025940 Bacteria 2024
248 Ga0207689_10393433 3300025942 Bacteria 1155
249 Ga0207689_11007329 3300025942 Bacteria 703
250 Ga0207661_10162110 3300025944 Bacteria 1941
251 Ga0207661_10187437 3300025944 Bacteria 1812
252 Ga0207679_10040870 3300025945 Bacteria 3322
253 Ga0207679_10052714 3300025945 Unclassified 2985
254 Ga0207679_10057966 3300025945 Bacteria 2867
255 Ga0207679_10135876 3300025945 Unclassified 1980
256 Ga0207651_10211247 3300025960 Unclassified 1562
257 Ga0207651_10375634 3300025960 Unclassified 1203
258 Ga0207651_10416896 3300025960 Bacteria 1145
259 Ga0207712_10459775 3300025961 Unclassified 1081
260 Ga0207668_10117422 3300025972 Bacteria 2008
261 Ga0207677_10131680 3300026023 Bacteria 1900
262 Ga0207677_11722296 3300026023 Unclassified 581
263 Ga0207703_11623249 3300026035 Unclassified 622
264 Ga0207708_10012023 3300026075 Bacteria 6449
265 Ga0207708_10042254 3300026075 Bacteria 3475
266 Ga0207708_10080831 3300026075 Bacteria 2497
267 Ga0207708_10359664 3300026075 Bacteria 1196
268 Ga0207702_10321157 3300026078 Bacteria 1474
269 Ga0207641_10022018 3300026088 Bacteria 5242
270 Ga0207641_10384488 3300026088 Unclassified 1345
271 Ga0207648_10001806 3300026089 Bacteria 23448
272 Ga0207648_10306652 3300026089 Bacteria 1425
273 Ga0207648_10731056 3300026089 Bacteria 918
274 Ga0207648_11421220 3300026089 Unclassified 652
275 Ga0207676_10620427 3300026095 Unclassified 1041
276 Ga0207676_11481851 3300026095 Bacteria 675
277 Ga0207674_10030931 3300026116 Bacteria 5627
278 Ga0207674_10060907 3300026116 Unclassified 3815
279 Ga0207675_100006716 3300026118 Bacteria 10879
280 Ga0207675_100312588 3300026118 Unclassified 1532
281 Ga0207683_10431551 3300026121 Unclassified 1214
282 Ga0207683_10437595 3300026121 Bacteria 1205
283 Ga0207698_10151660 3300026142 Bacteria 2013
284 Ga0209982_1086832 3300027552 Bacteria 517
285 Ga0207428_10004294 3300027907 Bacteria 13628
286 Ga0207428_10382893 3300027907 Bacteria 1032
287 Ga0268265_10000430 3300028380 Bacteria 44554
288 Ga0268264_10013155 3300028381 Bacteria 6806
289 Ga0268264_10357615 3300028381 Archaea 1392
290 Ga0265760_10205138 3300031090 Unclassified 667
291 Ga0307408_100876266 3300031548 Unclassified 820
292 Ga0307412_11552835 3300031911 Unclassified 603
293 Ga0307416_100640966 3300032002 Unclassified 1146
294 Ga0307416_101085213 3300032002 Bacteria 905
295 Ga0373948_0108967 3300034817 Bacteria 659
296 Ga0373934_0061577 3300035086 Bacteria 1495
297 Ga0373934_0504303 3300035086 Unclassified 509
298 Ga0373952_0013003 3300035092 Bacteria 1646
299 Ga0373945_0376011 3300035116 Bacteria 620
300 Ga0373955_0229019 3300035172 Bacteria 1111
301 Ga0373955_0359048 3300035172 Unclassified 883
302 Ga0373942_0292159 3300035207 Unclassified 564
303 Ga0373924_0093964 3300035410 Unclassified 1285
304 Ga0373931_0205781 3300035691 Bacteria 1178
305 Ga0373935_1017512 3300035692 Unclassified 616
306 Ga0373947_0557913 3300035725 Unclassified 780
307 Ga0373937_0034773 3300036401 Bacteria 4583
308 Ga0373925_0172932 3300037068 Bacteria 1706
309 Ga0373925_0438193 3300037068 Unclassified 1069
310 Ga0373925_1064409 3300037068 Unclassified 666
311 Ga0451577_0479421 3300042876 Bacteria 1129
312 Ga0451577_0735002 3300042876 Bacteria 893
313 Ga0439440_0048164 3300042993 Unclassified 1058
314 Ga0451576_0016905 3300045051 Bacteria 8035
315 Ga0451576_0052120 3300045051 Bacteria 4288
316 Ga0451576_0054389 3300045051 Bacteria 4191
317 Ga0451576_0059047 3300045051 Bacteria 4005
318 Ga0451576_0065700 3300045051 Unclassified 3776
319 Ga0451576_0097263 3300045051 Bacteria 3061
320 Ga0495603_0030590 3300046455 Bacteria 3242
321 Ga0495603_0032004 3300046455 Unclassified 3166
322 Ga0495629_0008030 3300046459 Bacteria 7767
323 Ga0495629_0129489 3300046459 Bacteria 1758
324 Ga0495580_0222373 3300046472 Bacteria 1297
325 Ga0495639_0591609 3300046475 Bacteria 570
326 Ga0495584_0619358 3300046491 Bacteria 552
327 Ga0495594_0346228 3300046499 Bacteria 846
328 Ga0495594_0563522 3300046499 Bacteria 646
329 Ga0495663_0033646 3300046525 Bacteria 1531
330 Ga0495666_0271267 3300046526 Unclassified 770
331 Ga0495642_0235397 3300046528 Unclassified 800
332 Ga0495652_0446762 3300046529 Bacteria 906
333 Ga0495598_0028431 3300046537 Bacteria 1551
334 Ga0495609_0042343 3300046538 Bacteria 2045
335 Ga0495621_0003876 3300046539 Unclassified 4154
336 Ga0495621_0033860 3300046539 Unclassified 1763
337 Ga0495645_0047354 3300046543 Bacteria 3133
338 Ga0495645_0343374 3300046543 Bacteria 964
339 Ga0495633_0349979 3300046558 Unclassified 669
340 Ga0495656_0364606 3300046615 Unclassified 751
341 Ga0495656_0385788 3300046615 Bacteria 731
342 Ga0495659_0001752 3300046664 Bacteria 7215
343 Ga0495659_0003332 3300046664 Bacteria 5153
344 Ga0495659_0007627 3300046664 Bacteria 3429
345 Ga0495659_0008716 3300046664 Bacteria 3229
346 Ga0495659_0023772 3300046664 Bacteria 2085
347 Ga0495659_0029902 3300046664 Bacteria 1893
348 Ga0495659_0050276 3300046664 Bacteria 1516
349 Ga0495659_0085757 3300046664 Bacteria 1202
350 Ga0495659_0088807 3300046664 Unclassified 1184
351 Ga0495588_0008588 3300046674 Bacteria 4693
352 Ga0495588_0028435 3300046674 Bacteria 2797
353 Ga0495658_0082054 3300046683 Bacteria 1894
354 Ga0495658_0833932 3300046683 Unclassified 590
355 Ga0495669_0150653 3300046684 Bacteria 1101
356 Ga0495669_0150793 3300046684 Bacteria 1100
357 Ga0495669_0198098 3300046684 Unclassified 959
358 Ga0495670_0737246 3300046691 Unclassified 537
359 Ga0495581_0298292 3300047315 Unclassified 942
360 Ga0495636_0073731 3300047318 Bacteria 1461
361 Ga0495636_0087018 3300047318 Bacteria 1352
362 Ga0495636_0239595 3300047318 Unclassified 836
363 Ga0495676_0079131 3300047321 Bacteria 2500
364 Ga0495677_0081559 3300047445 Bacteria 1213
365 Ga0501036_0682572 3300049572 Bacteria 849
366 Ga0501040_0088867 3300049576 Bacteria 2146
367 Ga0501040_0590610 3300049576 Unclassified 802
368 Ga0501041_0195034 3300049577 Bacteria 1269
369 Ga0501041_0233296 3300049577 Bacteria 1156
370 Ga0501042_0015075 3300049578 Bacteria 5286
371 Ga0501048_0039610 3300049582 Bacteria 3380
372 Ga0501068_0380114 3300049584 Bacteria 909
373 Ga0501069_0144645 3300049585 Bacteria 1365
374 Ga0501070_0188106 3300049586 Bacteria 1698
375 Ga0501071_0267460 3300049587 Bacteria 1292
376 Ga0501072_0019568 3300049588 Bacteria 5235
377 Ga0501074_0171774 3300049590 Bacteria 1547
378 Ga0501077_0055849 3300049593 Bacteria 2507
379 Ga0501080_0048962 3300049742 Bacteria 3933
380 Ga0501081_0123471 3300049743 Unclassified 1846
381 Ga0501045_0012962 3300049824 Bacteria 5876
382 nmdc:mga05p37_123824_c1 3300050507 Bacteria 3176
383 nmdc:mga05p37_1802_c1 3300050507 Bacteria 24981
384 nmdc:mga05p37_280597_c1 3300050507 Bacteria 1987
385 nmdc:mga05p37_333202_c1 3300050507 Unclassified 1792
386 nmdc:mga05p37_525649_c1 3300050507 Bacteria 1352
387 nmdc:mga05p37_7721_c1 3300050507 Bacteria 12697
388 nmdc:mga05p37_927582_c1 3300050507 Bacteria 935
389 nmdc:mga09592_152513_c1 3300050508 Bacteria 1994
390 nmdc:mga09592_153419_c1 3300050508 Bacteria 1988
391 nmdc:mga09592_22170_c1 3300050508 Bacteria 5241
392 nmdc:mga09592_31437_c1 3300050508 Unclassified 4424
393 nmdc:mga09592_38446_c1 3300050508 Unclassified 4017
394 nmdc:mga09592_56473_c1 3300050508 Bacteria 3317
395 nmdc:mga0qj67_11926_c1 3300050509 Bacteria 6530
396 nmdc:mga0qj67_6121_c1 3300050509 Bacteria 8821
397 nmdc:mga0qj67_67709_c1 3300050509 Bacteria 2845
398 nmdc:mga06r32_115675_c1 3300050510 Bacteria 2642
399 nmdc:mga06r32_128795_c1 3300050510 Bacteria 2501
400 nmdc:mga06r32_1495063_c1 3300050510 Bacteria 616
401 nmdc:mga06r32_553819_c1 3300050510 Unclassified 1124
402 nmdc:mga06r32_589899_c1 3300050510 Bacteria 1083
403 nmdc:mga06r32_9006_c1 3300050510 Bacteria 8993
404 nmdc:mga06r32_939377_c1 3300050510 Bacteria 820
405 nmdc:mga06r32_94777_c1 3300050510 Unclassified 2921
406 nmdc:mga08y16_115604_c1 3300050511 Unclassified 2793
407 nmdc:mga08y16_121495_c1 3300050511 Unclassified 2718
408 nmdc:mga08y16_7153_c1 3300050511 Bacteria 11713
409 nmdc:mga0n895_13653_c1 3300050512 Bacteria 7341
410 nmdc:mga0n895_13662_c1 3300050512 Bacteria 7340
411 nmdc:mga0n895_314928_c1 3300050512 Bacteria 1586
412 nmdc:mga0n895_66380_c1 3300050512 Bacteria 3573
413 nmdc:mga0n895_683166_c1 3300050512 Unclassified 1024
414 nmdc:mga0rr50_121571_c1 3300050513 Bacteria 2079
415 nmdc:mga0rr50_304874_c1 3300050513 Unclassified 1333
416 nmdc:mga0rr50_323257_c1 3300050513 Bacteria 1294
417 nmdc:mga0rr50_66769_c1 3300050513 Unclassified 2730
418 nmdc:mga08x19_116386_c1 3300050514 Bacteria 1787
419 nmdc:mga08x19_1165502_c1 3300050514 Unclassified 546
420 nmdc:mga0a205_199160_c1 3300050515 Bacteria 1893
421 nmdc:mga0a205_379144_c1 3300050515 Unclassified 831
422 nmdc:mga0a205_86698_c1 3300050515 Bacteria 3024
423 Ga0495601_0914160 3300053077 Bacteria 554
424 Ga0501082_0030862 3300060353 Bacteria 4620
425 Ga0530510_0004580 3300061734 Bacteria 9568
426 Ga0105243_12329389
427 JGI25406J46586_10001882
428 Ga0058859_10043612
429 Ga0058862_11339726
430 Ga0065704_10002050
431 Ga0065704_10277582
432 Ga0065712_10385862
433 Ga0065715_10091952
434 Ga0065715_10119183
435 Ga0065715_10129310
436 Ga0065715_10442982
437 Ga0065707_10107912
438 Ga0065707_10241359
439 Ga0065707_10274886
440 Ga0065707_10515006
441 Ga0070676_10022265
442 Ga0070683_100394593
443 Ga0070690_100015779
444 Ga0070670_100028770
445 Ga0070670_100194535
446 Ga0070677_10063061
447 Ga0068869_100225290
448 Ga0070680_100090529
449 Ga0070680_100588599
450 Ga0070680_100667292
451 Ga0068868_100368982
452 Ga0070689_100054035
453 Ga0070689_100119097
454 Ga0070689_100287678
455 Ga0070687_100010693
456 Ga0070687_100194785
457 Ga0070692_10106019
458 Ga0070692_10207097
459 Ga0070692_10592275
460 Ga0070692_11117652
461 Ga0070668_100237082
462 Ga0070669_100003423
463 Ga0070669_100144078
464 Ga0070669_100520702
465 Ga0070669_101823065
466 Ga0070675_100000119
467 Ga0070675_100042270
468 Ga0070675_100088614
469 Ga0070675_100271540
470 Ga0070671_100141074
471 Ga0070671_100520091
472 Ga0070673_100042537
473 Ga0070673_100239244
474 Ga0070673_100512778
475 Ga0070688_100004905
476 Ga0070688_100048181
477 Ga0070659_100118608
478 Ga0070703_10088135
479 Ga0070701_10009768
480 Ga0070705_100000684
481 Ga0070705_100297423
482 Ga0070700_100004007
483 Ga0070700_100377184
484 Ga0070700_101272807
485 Ga0070694_100089045
486 Ga0070694_101132612
487 Ga0070708_100283306
488 Ga0070708_102110607
489 Ga0070678_100737625
490 Ga0070662_100009791
491 Ga0070681_10175551
492 Ga0070681_10790262
493 Ga0068867_100004226
494 Ga0068867_100176737
495 Ga0068867_101759450
496 Ga0070685_10069420
497 Ga0070706_100122051
498 Ga0070706_100349645
499 Ga0070706_101589064
500 Ga0070707_100108046
501 Ga0070707_100530915
502 Ga0070707_101656962
503 Ga0070698_100062160
504 Ga0070698_100063813
505 Ga0070698_100066787
506 Ga0070698_100185866
507 Ga0070698_100504696
508 Ga0070698_100961241
509 Ga0070699_100000268
510 Ga0070699_100017209
511 Ga0070699_100673096
512 Ga0070699_102030352
513 Ga0070699_102228655
514 Ga0070679_100066931
515 Ga0070684_100030313
516 Ga0070684_100626289
517 Ga0070684_100778707
518 Ga0070697_100095989
519 Ga0070697_101031211
520 Ga0070672_100103081
521 Ga0070672_100114481
522 Ga0070686_100064016
523 Ga0070686_100762670
524 Ga0070695_100000565
525 Ga0070695_100949310
526 Ga0070696_100000299
527 Ga0070696_100012708
528 Ga0070696_100830078
529 Ga0070696_100891623
530 Ga0070693_100293380
531 Ga0070704_100102718
532 Ga0070704_100108251
533 Ga0070704_100579747
534 Ga0070704_101315389
535 Ga0070664_100012670
536 Ga0070664_100016441
537 Ga0070664_100040409
538 Ga0070664_101630577
539 Ga0068857_100008754
540 Ga0068857_100157944
541 Ga0068857_100528772
542 Ga0068854_100690674
543 Ga0068856_101196937
544 Ga0070702_100019545
545 Ga0068852_100150739
546 Ga0068859_100005376
547 Ga0068859_100018455
548 Ga0068859_101882924
549 Ga0068864_100049009
550 Ga0068864_100301643
551 Ga0068861_100001273
552 Ga0068870_10013789
553 Ga0068870_10018246
554 Ga0068870_10673832
555 Ga0068858_100023832
556 Ga0068860_100014254
557 Ga0068860_100274810
558 Ga0068862_100004775
559 Ga0081455_10142437
560 Ga0081539_10000025
561 Ga0081539_10003725
562 Ga0081539_10316161
563 Ga0097621_100045848
564 Ga0097621_100806315
565 Ga0068871_100250510
566 Ga0075428_100003266
567 Ga0075428_100044640
568 Ga0075428_100103355
569 Ga0075428_100585849
570 Ga0075428_100601980
571 Ga0075430_100018424
572 Ga0075430_100091736
573 Ga0075430_100200453
574 Ga0075431_100042763
575 Ga0075431_100159623
576 Ga0075431_100160293
577 Ga0075431_100229610
578 Ga0075431_101240881
579 Ga0075433_10063729
580 Ga0075433_10088127
581 Ga0075433_10103083
582 Ga0075433_10457026
583 Ga0075434_100005230
584 Ga0075434_100018968
585 Ga0075434_100040603
586 Ga0075434_100072530
587 Ga0075434_100098366
588 Ga0075434_100405294
589 Ga0075434_101315449
590 Ga0075429_100006153
591 Ga0075429_100032096
592 Ga0075429_100059661
593 Ga0075429_100093171
594 Ga0075429_100158373
595 Ga0075429_100242800
596 Ga0097620_100005376
597 Ga0097620_100018454
598 Ga0097620_101882889
599 Ga0075435_100007095
600 Ga0075435_100100427
601 Ga0075435_100144365
602 Ga0111539_10025985
603 Ga0111539_10037188
604 Ga0111539_10180315
605 Ga0111539_10182322
606 Ga0111539_10509577
607 Ga0114129_10002458
608 Ga0114129_10007358
609 Ga0114129_10022237
610 Ga0114129_10029686
611 Ga0114129_10308212
612 Ga0114129_10653124
613 Ga0114129_10756848
614 Ga0114129_11001183
615 Ga0105243_10084917
616 Ga0105243_11800127
617 Ga0105242_11270584
618 Ga0105249_10006243
619 Ga0105249_11608806
620 Ga0105239_11922378
621 Ga0105246_10266845
622 Ga0157371_10876577
623 Ga0157378_10190687
624 Ga0157378_11079462
625 Ga0157375_10002540
626 Ga0157375_10628577
627 Ga0157380_10151531
628 Ga0157380_10176617
629 Ga0157376_10806524
630 Ga0207697_10381924
631 Ga0207682_10082543
632 Ga0207688_10032607
633 Ga0207645_10044273
634 Ga0207643_10051996
635 Ga0207643_10069452
636 Ga0207643_10193914
637 Ga0207684_10429145
638 Ga0207684_11607410
639 Ga0207707_10434308
640 Ga0207660_10226840
641 Ga0207660_10291826
642 Ga0207660_10562179
643 Ga0207662_10022811
644 Ga0207662_10214729
645 Ga0207652_11304776
646 Ga0207652_11376266
647 Ga0207646_10148287
648 Ga0207646_10275998
649 Ga0207646_10848451
650 Ga0207681_10024997
651 Ga0207681_10075577
652 Ga0207681_10555534
653 Ga0207650_10013786
654 Ga0207659_10001007
655 Ga0207659_10016635
656 Ga0207659_10383132
657 Ga0207644_10099461
658 Ga0207644_10413666
659 Ga0207706_10009430
660 Ga0207706_10136936
661 Ga0207706_10383420
662 Ga0207686_11056345
663 Ga0207709_10018127
664 Ga0207709_10835438
665 Ga0207670_10006051
666 Ga0207670_10041953
667 Ga0207670_10221617
668 Ga0207669_10901099
669 Ga0207669_11365656
670 Ga0207704_10167384
671 Ga0207691_10041887
672 Ga0207691_10153464
673 Ga0207689_10393433
674 Ga0207689_11007329
675 Ga0207661_10162110
676 Ga0207661_10187437
677 Ga0207679_10040870
678 Ga0207679_10052714
679 Ga0207679_10057966
680 Ga0207679_10135876
681 Ga0207651_10211247
682 Ga0207651_10375634
683 Ga0207651_10416896
684 Ga0207712_10459775
685 Ga0207668_10117422
686 Ga0207677_10131680
687 Ga0207677_11722296
688 Ga0207703_11623249
689 Ga0207708_10012023
690 Ga0207708_10042254
691 Ga0207708_10080831
692 Ga0207708_10359664
693 Ga0207702_10321157
694 Ga0207641_10022018
695 Ga0207641_10384488
696 Ga0207648_10001806
697 Ga0207648_10306652
698 Ga0207648_10731056
699 Ga0207648_11421220
700 Ga0207676_10620427
701 Ga0207676_11481851
702 Ga0207674_10030931
703 Ga0207674_10060907
704 Ga0207675_100006716
705 Ga0207675_100312588
706 Ga0207683_10431551
707 Ga0207683_10437595
708 Ga0207698_10151660
709 Ga0209982_1086832
710 Ga0207428_10004294
711 Ga0207428_10382893
712 Ga0268265_10000430
713 Ga0268264_10013155
714 Ga0268264_10357615
715 Ga0265760_10205138
716 Ga0307408_100876266
717 Ga0307412_11552835
718 Ga0307416_100640966
719 Ga0307416_101085213
720 Ga0373948_0108967
721 Ga0373934_0061577
722 Ga0373934_0504303
723 Ga0373952_0013003
724 Ga0373945_0376011
725 Ga0373955_0229019
726 Ga0373955_0359048
727 Ga0373942_0292159
728 Ga0373924_0093964
729 Ga0373931_0205781
730 Ga0373935_1017512
731 Ga0373947_0557913
732 Ga0373937_0034773
733 Ga0373925_0172932
734 Ga0373925_0438193
735 Ga0373925_1064409
736 Ga0451577_0479421
737 Ga0451577_0735002
738 Ga0439440_0048164
739 Ga0451576_0016905
740 Ga0451576_0052120
741 Ga0451576_0054389
742 Ga0451576_0059047
743 Ga0451576_0065700
744 Ga0451576_0097263
745 Ga0495603_0030590
746 Ga0495603_0032004
747 Ga0495629_0008030
748 Ga0495629_0129489
749 Ga0495580_0222373
750 Ga0495639_0591609
751 Ga0495584_0619358
752 Ga0495594_0346228
753 Ga0495594_0563522
754 Ga0495663_0033646
755 Ga0495666_0271267
756 Ga0495642_0235397
757 Ga0495652_0446762
758 Ga0495598_0028431
759 Ga0495609_0042343
760 Ga0495621_0003876
761 Ga0495621_0033860
762 Ga0495645_0047354
763 Ga0495645_0343374
764 Ga0495633_0349979
765 Ga0495656_0364606
766 Ga0495656_0385788
767 Ga0495659_0001752
768 Ga0495659_0003332
769 Ga0495659_0007627
770 Ga0495659_0008716
771 Ga0495659_0023772
772 Ga0495659_0029902
773 Ga0495659_0050276
774 Ga0495659_0085757
775 Ga0495659_0088807
776 Ga0495588_0008588
777 Ga0495588_0028435
778 Ga0495658_0082054
779 Ga0495658_0833932
780 Ga0495669_0150653
781 Ga0495669_0150793
782 Ga0495669_0198098
783 Ga0495670_0737246
784 Ga0495581_0298292
785 Ga0495636_0073731
786 Ga0495636_0087018
787 Ga0495636_0239595
788 Ga0495676_0079131
789 Ga0495677_0081559
790 Ga0501036_0682572
791 Ga0501040_0088867
792 Ga0501040_0590610
793 Ga0501041_0195034
794 Ga0501041_0233296
795 Ga0501042_0015075
796 Ga0501048_0039610
797 Ga0501068_0380114
798 Ga0501069_0144645
799 Ga0501070_0188106
800 Ga0501071_0267460
801 Ga0501072_0019568
802 Ga0501074_0171774
803 Ga0501077_0055849
804 Ga0501080_0048962
805 Ga0501081_0123471
806 Ga0501045_0012962
807 nmdc:mga05p37_123824_c1
808 nmdc:mga05p37_1802_c1
809 nmdc:mga05p37_280597_c1
810 nmdc:mga05p37_333202_c1
811 nmdc:mga05p37_525649_c1
812 nmdc:mga05p37_7721_c1
813 nmdc:mga05p37_927582_c1
814 nmdc:mga09592_152513_c1
815 nmdc:mga09592_153419_c1
816 nmdc:mga09592_22170_c1
817 nmdc:mga09592_31437_c1
818 nmdc:mga09592_38446_c1
819 nmdc:mga09592_56473_c1
820 nmdc:mga0qj67_11926_c1
821 nmdc:mga0qj67_6121_c1
822 nmdc:mga0qj67_67709_c1
823 nmdc:mga06r32_115675_c1
824 nmdc:mga06r32_128795_c1
825 nmdc:mga06r32_1495063_c1
826 nmdc:mga06r32_553819_c1
827 nmdc:mga06r32_589899_c1
828 nmdc:mga06r32_9006_c1
829 nmdc:mga06r32_939377_c1
830 nmdc:mga06r32_94777_c1
831 nmdc:mga08y16_115604_c1
832 nmdc:mga08y16_121495_c1
833 nmdc:mga08y16_7153_c1
834 nmdc:mga0n895_13653_c1
835 nmdc:mga0n895_13662_c1
836 nmdc:mga0n895_314928_c1
837 nmdc:mga0n895_66380_c1
838 nmdc:mga0n895_683166_c1
839 nmdc:mga0rr50_121571_c1
840 nmdc:mga0rr50_304874_c1
841 nmdc:mga0rr50_323257_c1
842 nmdc:mga0rr50_66769_c1
843 nmdc:mga08x19_116386_c1
844 nmdc:mga08x19_1165502_c1
845 nmdc:mga0a205_199160_c1
846 nmdc:mga0a205_379144_c1
847 nmdc:mga0a205_86698_c1
848 Ga0495601_0914160
849 Ga0501082_0030862
850 Ga0530510_0004580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

39

138

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jjd-assembly1.cif.gz_A protein tyrosine phosphatase, receptor type, e isoform 0.7324 42 87
2jjd-assembly5.cif.gz_E protein tyrosine phosphatase, receptor type, e isoform 0.7286 42 87
4hzb-assembly1.cif.gz_C crystal structure of the type vi semet effector-immunity complex tae3-tai3 from ralstonia pickettii 0.7118 41 75
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7002 39 73
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.6999 39 73
ID Description Score Start End Superfamily
af_O06311_169_271_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7722 43 75 3.40.630.10
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7717 42 75 2.130.10.10
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7568 35 119 2.40.50.140
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7381 43 77 2.30.29.30
af_Q9BL78_923_1123_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7254 42 76 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A2V9CP64-F1-model_v4 LTD domain-containing protein 0.9605 32 124
AF-A0A2V9CMM4-F1-model_v4 Uncharacterized protein 0.9559 33 125
AF-A0A7W6EUK5-F1-model_v4 Uncharacterized protein 0.9425 35 125
AF-A0A2T5GGJ4-F1-model_v4 Uncharacterized protein 0.9375 33 125
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9306 32 124

Map