F440906

General Info

Members Datasets Scaffolds Average Seq Length
425 185 850 152

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100088157|Ga0070683_1000881575
Length 172
Sequence VSGVGSTEPPRSEGAGLHGAGAGRVAIGKVGRPHGIDGAFFVEQPSEDPRWWKTGARFLAGGVPVEVVAHRTSSGRPVIKVEPAVERGVLLEVDRVELPPTAEDEYYAFELVGLQVVEETGRSLGTVESVTPGVANDVLELDSGVLLPMVEDCIRVVDVAGGRIEVAEGFAG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 1.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.12
Rhizosphere 92.71
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100088157 3300005329 Bacteria 2911
2 Ga0070658_10006990 3300005327 Bacteria 9115
3 Ga0070658_10529785 3300005327 Bacteria 1019
4 Ga0070683_100014510 3300005329 Bacteria 6894
5 Ga0070683_100133528 3300005329 Bacteria 2349
6 Ga0070680_100005886 3300005336 Bacteria 9310
7 Ga0070680_100073967 3300005336 Bacteria 2803
8 Ga0070680_100093345 3300005336 Bacteria 2493
9 Ga0070680_100110112 3300005336 Bacteria 2292
10 Ga0070680_100258462 3300005336 Bacteria 1473
11 Ga0070680_101256290 3300005336 Bacteria 641
12 Ga0070682_100099081 3300005337 Bacteria 1921
13 Ga0070682_100586837 3300005337 Bacteria 878
14 Ga0070660_100000845 3300005339 Bacteria 20392
15 Ga0070660_100008455 3300005339 Bacteria 7198
16 Ga0070660_100144156 3300005339 Bacteria 1912
17 Ga0070660_100148091 3300005339 Bacteria 1886
18 Ga0070660_100207572 3300005339 Bacteria 1590
19 Ga0070691_10722029 3300005341 Bacteria 600
20 Ga0070661_100042039 3300005344 Bacteria 3335
21 Ga0070661_100115721 3300005344 Bacteria 2005
22 Ga0070661_100168564 3300005344 Bacteria 1662
23 Ga0070661_100772929 3300005344 Bacteria 787
24 Ga0070671_100482281 3300005355 Bacteria 1065
25 Ga0070674_100459649 3300005356 Bacteria 1052
26 Ga0070659_100062240 3300005366 Bacteria 2949
27 Ga0070659_100069281 3300005366 Bacteria 2799
28 Ga0070709_10134302 3300005434 Bacteria 1693
29 Ga0070709_10302228 3300005434 Bacteria 1169
30 Ga0070714_100136614 3300005435 Bacteria 2196
31 Ga0070714_100281283 3300005435 Bacteria 1546
32 Ga0070714_100285401 3300005435 Bacteria 1535
33 Ga0070714_100427925 3300005435 Bacteria 1255
34 Ga0070711_100101845 3300005439 Bacteria 2091
35 Ga0070711_100106264 3300005439 Bacteria 2052
36 Ga0070694_100429792 3300005444 Bacteria 1039
37 Ga0070708_100063789 3300005445 Bacteria 3299
38 Ga0070681_10003958 3300005458 Bacteria 13966
39 Ga0070681_10005605 3300005458 Bacteria 12129
40 Ga0070681_10086099 3300005458 Bacteria 3095
41 Ga0070681_10222257 3300005458 Bacteria 1804
42 Ga0070681_10259064 3300005458 Bacteria 1651
43 Ga0070681_10294890 3300005458 Bacteria 1531
44 Ga0070681_10394120 3300005458 Bacteria 1296
45 Ga0070706_101026369 3300005467 Unclassified 760
46 Ga0070707_100655702 3300005468 Unclassified 1012
47 Ga0070699_100152099 3300005518 Bacteria 2047
48 Ga0070699_100198591 3300005518 Bacteria 1783
49 Ga0070679_100016149 3300005530 Bacteria 7194
50 Ga0070679_100046035 3300005530 Bacteria 4347
51 Ga0070679_100065993 3300005530 Bacteria 3607
52 Ga0070679_100144586 3300005530 Bacteria 2356
53 Ga0070679_100241940 3300005530 Bacteria 1762
54 Ga0070679_100252147 3300005530 Bacteria 1721
55 Ga0070684_100171184 3300005535 Bacteria 1972
56 Ga0070684_100466559 3300005535 Bacteria 1168
57 Ga0070684_100788985 3300005535 Bacteria 888
58 Ga0070684_101078232 3300005535 Bacteria 755
59 Ga0068853_100142085 3300005539 Bacteria 2155
60 Ga0068853_100680301 3300005539 Bacteria 980
61 Ga0068853_101225357 3300005539 Bacteria 725
62 Ga0070696_100982244 3300005546 Unclassified 704
63 Ga0070665_100029758 3300005548 Bacteria 5495
64 Ga0068855_100008598 3300005563 Bacteria 12338
65 Ga0068855_100049709 3300005563 Bacteria 4944
66 Ga0068855_100095652 3300005563 Bacteria 3423
67 Ga0068855_100633970 3300005563 Bacteria 1149
68 Ga0068855_100812759 3300005563 Bacteria 993
69 Ga0068857_100449224 3300005577 Bacteria 1205
70 Ga0068857_101300123 3300005577 Bacteria 706
71 Ga0068854_100601406 3300005578 Bacteria 939
72 Ga0068856_100259689 3300005614 Bacteria 1752
73 Ga0068856_101602150 3300005614 Bacteria 664
74 Ga0070702_100259559 3300005615 Bacteria 1182
75 Ga0068852_100034174 3300005616 Bacteria 4228
76 Ga0068852_100531372 3300005616 Bacteria 1174
77 Ga0068852_100648528 3300005616 Bacteria 1063
78 Ga0070715_10554570 3300006163 Bacteria 667
79 Ga0068871_101037843 3300006358 Bacteria 765
80 Ga0075433_10320942 3300006852 Bacteria 1370
81 Ga0075434_100403430 3300006871 Bacteria 1388
82 Ga0075436_100225623 3300006914 Bacteria 1330
83 Ga0075435_100073705 3300007076 Bacteria 2791
84 Ga0105240_10142186 3300009093 Bacteria 2868
85 Ga0105240_10509075 3300009093 Bacteria 1338
86 Ga0105240_10913081 3300009093 Bacteria 944
87 Ga0105240_11737613 3300009093 Bacteria 651
88 Ga0111539_10181445 3300009094 Bacteria 2458
89 Ga0105243_10812611 3300009148 Bacteria 922
90 Ga0105241_10089448 3300009174 Bacteria 2426
91 Ga0105242_10196483 3300009176 Bacteria 1789
92 Ga0105237_10010559 3300009545 Bacteria 9813
93 Ga0105237_10119283 3300009545 Bacteria 2632
94 Ga0105237_10210349 3300009545 Bacteria 1945
95 Ga0105238_10010847 3300009551 Bacteria 9158
96 Ga0105238_10873353 3300009551 Bacteria 917
97 Ga0105238_10996563 3300009551 Bacteria 859
98 Ga0105239_10468676 3300010375 Bacteria 1430
99 Ga0157370_10016392 3300013104 Bacteria 7501
100 Ga0157370_10018813 3300013104 Bacteria 6946
101 Ga0157370_10724765 3300013104 Bacteria 907
102 Ga0157370_11016064 3300013104 Bacteria 750
103 Ga0157369_10030900 3300013105 Bacteria 5903
104 Ga0157369_10429440 3300013105 Bacteria 1369
105 Ga0157369_10680755 3300013105 Bacteria 1060
106 Ga0157369_11037253 3300013105 Bacteria 839
107 Ga0157374_11672993 3300013296 Unclassified 661
108 Ga0157372_10052333 3300013307 Bacteria 4546
109 Ga0157372_10091743 3300013307 Bacteria 3454
110 Ga0157372_10137086 3300013307 Bacteria 2819
111 Ga0157372_10347841 3300013307 Bacteria 1727
112 Ga0157372_11451996 3300013307 Bacteria 790
113 Ga0157372_11592027 3300013307 Bacteria 752
114 Ga0157372_12102651 3300013307 Bacteria 649
115 Ga0182008_10167790 3300014497 Unclassified 1107
116 Ga0197907_10734091 3300020069 Bacteria 3996
117 Ga0206356_10843480 3300020070 Bacteria 2420
118 Ga0206354_10739395 3300020081 Bacteria 3652
119 Ga0206354_11119917 3300020081 Bacteria 1073
120 Ga0206353_10260550 3300020082 Bacteria 7963
121 Ga0206353_10322902 3300020082 Bacteria 1586
122 Ga0206353_10737253 3300020082 Bacteria 2748
123 Ga0213873_10014112 3300021358 Bacteria 1766
124 Ga0207685_10064056 3300025905 Bacteria 1467
125 Ga0207685_10230783 3300025905 Bacteria 885
126 Ga0207705_10027011 3300025909 Bacteria 4092
127 Ga0207705_10057789 3300025909 Bacteria 2798
128 Ga0207705_10242913 3300025909 Bacteria 1372
129 Ga0207654_10238578 3300025911 Bacteria 1214
130 Ga0207707_10010397 3300025912 Bacteria 8075
131 Ga0207707_10043930 3300025912 Bacteria 3896
132 Ga0207707_10057821 3300025912 Bacteria 3374
133 Ga0207707_10166653 3300025912 Bacteria 1925
134 Ga0207707_10253857 3300025912 Bacteria 1527
135 Ga0207707_10928152 3300025912 Bacteria 718
136 Ga0207695_10389889 3300025913 Bacteria 1278
137 Ga0207660_10041562 3300025917 Bacteria 3222
138 Ga0207660_10043163 3300025917 Bacteria 3168
139 Ga0207660_10084205 3300025917 Bacteria 2344
140 Ga0207660_10154702 3300025917 Bacteria 1764
141 Ga0207660_10268077 3300025917 Bacteria 1352
142 Ga0207657_10000500 3300025919 Bacteria 41333
143 Ga0207657_10000718 3300025919 Bacteria 35150
144 Ga0207657_10060717 3300025919 Bacteria 3243
145 Ga0207657_10063631 3300025919 Bacteria 3153
146 Ga0207657_10083923 3300025919 Bacteria 2671
147 Ga0207657_10241180 3300025919 Bacteria 1443
148 Ga0207657_10312973 3300025919 Unclassified 1242
149 Ga0207657_10396189 3300025919 Bacteria 1086
150 Ga0207657_10568072 3300025919 Bacteria 886
151 Ga0207649_10027364 3300025920 Bacteria 3345
152 Ga0207649_10084891 3300025920 Bacteria 2059
153 Ga0207649_10202009 3300025920 Bacteria 1405
154 Ga0207652_10029141 3300025921 Bacteria 4612
155 Ga0207652_10051810 3300025921 Bacteria 3520
156 Ga0207652_10055243 3300025921 Bacteria 3414
157 Ga0207652_10111763 3300025921 Bacteria 2423
158 Ga0207652_10224170 3300025921 Bacteria 1694
159 Ga0207652_10479166 3300025921 Bacteria 1121
160 Ga0207646_10312907 3300025922 Bacteria 1419
161 Ga0207694_10512223 3300025924 Bacteria 1005
162 Ga0207694_11026220 3300025924 Unclassified 698
163 Ga0207664_10155281 3300025929 Bacteria 1948
164 Ga0207664_10259730 3300025929 Bacteria 1519
165 Ga0207664_10480235 3300025929 Bacteria 1112
166 Ga0207664_11349558 3300025929 Unclassified 633
167 Ga0207644_10111850 3300025931 Bacteria 2066
168 Ga0207690_10064954 3300025932 Bacteria 2494
169 Ga0207690_10073249 3300025932 Bacteria 2368
170 Ga0207690_10643296 3300025932 Unclassified 868
171 Ga0207686_10422211 3300025934 Bacteria 1020
172 Ga0207709_10089941 3300025935 Bacteria 2003
173 Ga0207661_10114955 3300025944 Bacteria 2282
174 Ga0207661_10173909 3300025944 Bacteria 1876
175 Ga0207661_10350547 3300025944 Bacteria 1332
176 Ga0207661_11073398 3300025944 Bacteria 741
177 Ga0207661_11726377 3300025944 Bacteria 571
178 Ga0207679_10627412 3300025945 Bacteria 971
179 Ga0207667_10037329 3300025949 Bacteria 5194
180 Ga0207667_10667383 3300025949 Bacteria 1044
181 Ga0207667_10747627 3300025949 Bacteria 977
182 Ga0207640_10255961 3300025981 Bacteria 1361
183 Ga0207640_10781073 3300025981 Bacteria 826
184 Ga0207639_10033538 3300026041 Bacteria 3788
185 Ga0207639_10391402 3300026041 Bacteria 1250
186 Ga0207678_10126640 3300026067 Bacteria 2178
187 Ga0207702_10209251 3300026078 Bacteria 1812
188 Ga0207702_10568159 3300026078 Bacteria 1111
189 Ga0207674_10333409 3300026116 Bacteria 1467
190 Ga0207674_10376443 3300026116 Bacteria 1372
191 Ga0207675_101516490 3300026118 Unclassified 691
192 Ga0207683_10398022 3300026121 Bacteria 1267
193 Ga0207683_10854267 3300026121 Unclassified 845
194 Ga0207698_10077224 3300026142 Bacteria 2670
195 Ga0207698_10192776 3300026142 Bacteria 1817
196 Ga0207698_10579120 3300026142 Bacteria 1104
197 Ga0207428_10145187 3300027907 Bacteria 1809
198 Ga0265336_10039877 3300028666 Bacteria 1439
199 Ga0307415_100332835 3300032126 Bacteria 1271
200 Ga0373934_0114050 3300035086 Bacteria 1097
201 Ga0373944_0003275 3300035089 Bacteria 4167
202 Ga0373936_0002779 3300035113 Bacteria 6525
203 Ga0373945_0000921 3300035116 Bacteria 8735
204 Ga0373945_0004373 3300035116 Bacteria 4488
205 Ga0373954_0116575 3300035118 Bacteria 1295
206 Ga0373943_0003623 3300035170 Bacteria 7024
207 Ga0373943_0046145 3300035170 Bacteria 2125
208 Ga0373946_0001497 3300035171 Bacteria 8110
209 Ga0373946_0071931 3300035171 Bacteria 1496
210 Ga0373955_0015890 3300035172 Bacteria 3694
211 Ga0373935_0124245 3300035692 Bacteria 1727
212 Ga0373927_0031884 3300035695 Bacteria 3433
213 Ga0373927_0056214 3300035695 Bacteria 2544
214 Ga0373947_0000420 3300035725 Bacteria 24142
215 Ga0373947_0007893 3300035725 Bacteria 6140
216 Ga0373937_0036702 3300036401 Bacteria 4466
217 Ga0373925_0006404 3300037068 Bacteria 8669
218 Ga0373925_0827738 3300037068 Bacteria 763
219 Ga0395899_0010531 3300037312 Bacteria 7084
220 Ga0395899_0092178 3300037312 Bacteria 2194
221 Ga0395899_0208479 3300037312 Bacteria 1359
222 Ga0395900_0062445 3300037418 Bacteria 3829
223 Ga0395900_0100151 3300037418 Bacteria 2976
224 Ga0395900_0118508 3300037418 Bacteria 2716
225 Ga0395900_0245729 3300037418 Bacteria 1793
226 Ga0395900_0307976 3300037418 Bacteria 1568
227 Ga0395900_0784376 3300037418 Bacteria 882
228 Ga0395898_0000926 3300037466 Bacteria 46928
229 Ga0395898_0009223 3300037466 Bacteria 10379
230 Ga0395898_0073610 3300037466 Bacteria 3300
231 Ga0395898_0110877 3300037466 Bacteria 2630
232 Ga0395898_0276289 3300037466 Bacteria 1602
233 Ga0395898_0281856 3300037466 Bacteria 1585
234 Ga0395898_0370961 3300037466 Bacteria 1365
235 Ga0395898_0625409 3300037466 Bacteria 1019
236 Ga0395898_0889584 3300037466 Bacteria 829
237 Ga0395905_0036917 3300037471 Bacteria 4590
238 Ga0395905_0079386 3300037471 Bacteria 3076
239 Ga0395905_0266293 3300037471 Bacteria 1599
240 Ga0395905_0338444 3300037471 Bacteria 1396
241 Ga0395905_0954566 3300037471 Bacteria 760
242 Ga0395905_1735300 3300037471 Bacteria 530
243 Ga0436364_1158613 3300037853 Bacteria 1929
244 Ga0395901_0012850 3300038443 Bacteria 8494
245 Ga0395901_0081934 3300038443 Bacteria 3370
246 Ga0395901_0160478 3300038443 Bacteria 2361
247 Ga0395901_0325684 3300038443 Bacteria 1589
248 Ga0395901_0584441 3300038443 Bacteria 1128
249 Ga0395901_1109370 3300038443 Unclassified 761
250 Ga0395901_1346775 3300038443 Bacteria 674
251 Ga0436365_1226843 3300039437 Bacteria 905
252 Ga0436365_1405983 3300039437 Bacteria 4656
253 Ga0436360_0975120 3300039438 Bacteria 7075
254 Ga0436363_1515745 3300039450 Bacteria 1370
255 Ga0436362_0097300 3300039453 Bacteria 2757
256 Ga0451839_0053228 3300041496 Unclassified 563
257 Ga0466965_0312107 3300044683 Bacteria 855
258 Ga0466966_0000305 3300044684 Bacteria 32089
259 Ga0466966_0016526 3300044684 Bacteria 4873
260 Ga0466966_0200098 3300044684 Bacteria 1209
261 Ga0466961_0054978 3300044693 Bacteria 2539
262 Ga0466961_0109213 3300044693 Bacteria 1741
263 Ga0466961_0138232 3300044693 Bacteria 1526
264 Ga0466963_0001910 3300044694 Bacteria 11404
265 Ga0466963_0011657 3300044694 Bacteria 5356
266 Ga0466963_0059807 3300044694 Bacteria 2544
267 Ga0466963_0067878 3300044694 Bacteria 2394
268 Ga0466963_0075686 3300044694 Bacteria 2272
269 Ga0466963_0087510 3300044694 Bacteria 2118
270 Ga0466963_0268570 3300044694 Bacteria 1198
271 Ga0466963_0313626 3300044694 Bacteria 1103
272 Ga0466963_0877405 3300044694 Unclassified 632
273 Ga0466964_0007714 3300044706 Bacteria 4028
274 Ga0466964_0035477 3300044706 Bacteria 1994
275 Ga0466964_0051023 3300044706 Bacteria 1698
276 Ga0466971_0000262 3300044719 Bacteria 20142
277 Ga0466968_0278081 3300044735 Unclassified 800
278 Ga0466970_0017467 3300044765 Bacteria 3708
279 Ga0466957_0000120 3300044842 Bacteria 32792
280 Ga0466957_0023966 3300044842 Bacteria 3611
281 Ga0466957_0122207 3300044842 Bacteria 1661
282 Ga0466957_0221303 3300044842 Bacteria 1250
283 Ga0466960_0338061 3300044901 Bacteria 856
284 Ga0466959_0002778 3300045049 Bacteria 11261
285 Ga0466959_0006905 3300045049 Bacteria 7926
286 Ga0466959_0010616 3300045049 Bacteria 6594
287 Ga0466959_0196316 3300045049 Bacteria 1406
288 Ga0466959_0515101 3300045049 Bacteria 808
289 Ga0466958_0003088 3300045836 Bacteria 8545
290 Ga0466958_0004789 3300045836 Bacteria 7199
291 Ga0466958_0243368 3300045836 Bacteria 1150
292 Ga0466967_0002685 3300045976 Bacteria 11235
293 Ga0466967_0009462 3300045976 Bacteria 7231
294 Ga0466967_0011301 3300045976 Bacteria 6751
295 Ga0466967_0014780 3300045976 Bacteria 6098
296 Ga0466967_0018549 3300045976 Bacteria 5565
297 Ga0466967_0040981 3300045976 Bacteria 3989
298 Ga0466967_0108404 3300045976 Bacteria 2548
299 Ga0466967_0149451 3300045976 Bacteria 2182
300 Ga0466967_0152929 3300045976 Bacteria 2158
301 Ga0466967_0195952 3300045976 Bacteria 1911
302 Ga0466967_0211172 3300045976 Bacteria 1841
303 Ga0466967_0232397 3300045976 Bacteria 1756
304 Ga0466967_0507027 3300045976 Unclassified 1185
305 Ga0466967_0516089 3300045976 Bacteria 1174
306 Ga0466967_0937359 3300045976 Unclassified 861
307 Ga0495592_0210881 3300046454 Bacteria 1304
308 Ga0495629_0002147 3300046459 Bacteria 15270
309 Ga0495629_0049138 3300046459 Bacteria 2957
310 Ga0495629_0056197 3300046459 Bacteria 2753
311 Ga0495629_0131961 3300046459 Bacteria 1740
312 Ga0495641_0002183 3300046461 Bacteria 15658
313 Ga0495641_0046321 3300046461 Bacteria 2000
314 Ga0495641_0331385 3300046461 Bacteria 687
315 Ga0495651_0006163 3300046462 Bacteria 9162
316 Ga0495653_0030321 3300046463 Bacteria 4309
317 Ga0495653_0090592 3300046463 Bacteria 2237
318 Ga0495653_0145680 3300046463 Bacteria 1660
319 Ga0495582_0006489 3300046473 Bacteria 6492
320 Ga0495582_0388740 3300046473 Bacteria 804
321 Ga0495639_0089337 3300046475 Unclassified 1443
322 Ga0495662_0030485 3300046476 Bacteria 2603
323 Ga0495664_0047432 3300046477 Bacteria 2549
324 Ga0495664_0067226 3300046477 Bacteria 2138
325 Ga0495594_0022673 3300046499 Bacteria 3359
326 Ga0495608_0040027 3300046511 Bacteria 3140
327 Ga0495628_0080264 3300046516 Bacteria 2536
328 Ga0495628_0085969 3300046516 Bacteria 2439
329 Ga0495630_0005687 3300046517 Bacteria 8813
330 Ga0495630_0006246 3300046517 Bacteria 8454
331 Ga0495630_0078896 3300046517 Bacteria 2483
332 Ga0495630_0167163 3300046517 Bacteria 1675
333 Ga0495630_0259555 3300046517 Bacteria 1327
334 Ga0495652_0025581 3300046529 Bacteria 5218
335 Ga0495652_0141696 3300046529 Bacteria 1890
336 Ga0495652_0216110 3300046529 Bacteria 1443
337 Ga0495665_0558591 3300046531 Bacteria 574
338 Ga0495640_0071436 3300046533 Bacteria 2329
339 Ga0495587_0031517 3300046536 Bacteria 3209
340 Ga0495587_0067794 3300046536 Bacteria 2079
341 Ga0495587_0381658 3300046536 Unclassified 784
342 Ga0495587_0650394 3300046536 Bacteria 579
343 Ga0495645_0140476 3300046543 Bacteria 1685
344 Ga0495645_0145640 3300046543 Bacteria 1650
345 Ga0495645_0647303 3300046543 Bacteria 646
346 Ga0495667_0005342 3300046559 Bacteria 8681
347 Ga0495667_0033058 3300046559 Bacteria 3461
348 Ga0495634_0054100 3300046642 Bacteria 2687
349 Ga0495634_0184601 3300046642 Bacteria 1304
350 Ga0495635_0024297 3300046663 Bacteria 4225
351 Ga0495635_0157675 3300046663 Unclassified 1545
352 Ga0495657_0018158 3300046675 Bacteria 5096
353 Ga0495657_0096898 3300046675 Bacteria 1884
354 Ga0495657_0151264 3300046675 Unclassified 1441
355 Ga0495599_0009581 3300046678 Bacteria 5924
356 Ga0495623_0020320 3300046679 Bacteria 4292
357 Ga0495646_0067454 3300046680 Bacteria 2114
358 Ga0495647_0031685 3300046681 Bacteria 1967
359 Ga0495658_0000345 3300046683 Bacteria 26040
360 Ga0495658_0048298 3300046683 Bacteria 2399
361 Ga0495658_0084794 3300046683 Bacteria 1866
362 Ga0495658_0144147 3300046683 Bacteria 1458
363 Ga0495613_0013011 3300046689 Bacteria 6184
364 Ga0495613_0013684 3300046689 Bacteria 6019
365 Ga0495613_0109833 3300046689 Bacteria 1988
366 Ga0495613_0869141 3300046689 Bacteria 585
367 Ga0495624_0032485 3300046690 Bacteria 3384
368 Ga0495600_0055905 3300046809 Bacteria 2577
369 Ga0495581_0006092 3300047315 Bacteria 6991
370 Ga0495604_0015468 3300047317 Bacteria 6090
371 Ga0495674_0026518 3300047319 Bacteria 5302
372 Ga0495674_0120078 3300047319 Bacteria 2221
373 Ga0495676_0017774 3300047321 Bacteria 6280
374 Ga0495676_0100090 3300047321 Bacteria 2147
375 Ga0495680_0011298 3300047322 Bacteria 7913
376 Ga0495680_0036812 3300047322 Bacteria 3924
377 Ga0495675_0009235 3300047444 Bacteria 6133
378 Ga0495684_0068736 3300047471 Bacteria 2693
379 Ga0495602_0053639 3300048088 Bacteria 3568
380 Ga0495614_0004925 3300048089 Bacteria 6024
381 Ga0496100_0021846 3300048903 Bacteria 3861
382 Ga0496100_0037992 3300048903 Bacteria 3048
383 Ga0496101_0051559 3300048904 Bacteria 2965
384 Ga0496101_0061011 3300048904 Bacteria 2737
385 Ga0496101_0516167 3300048904 Unclassified 944
386 Ga0496102_0021938 3300048905 Bacteria 5654
387 Ga0496102_0261086 3300048905 Bacteria 1633
388 Ga0496102_0530616 3300048905 Bacteria 1100
389 Ga0496103_0017512 3300048906 Bacteria 4289
390 Ga0496103_0019613 3300048906 Bacteria 4059
391 Ga0496104_0131190 3300048907 Bacteria 2407
392 Ga0496106_0008152 3300048909 Bacteria 7740
393 Ga0496107_0139699 3300048910 Bacteria 1790
394 Ga0496109_0411292 3300048912 Bacteria 1278
395 Ga0496112_0004705 3300048915 Bacteria 11625
396 Ga0496112_0011636 3300048915 Bacteria 8047
397 Ga0496112_0109155 3300048915 Bacteria 2737
398 Ga0496113_1137766 3300048916 Unclassified 611
399 Ga0496114_0018835 3300048917 Bacteria 5589
400 Ga0496114_0391657 3300048917 Bacteria 1230
401 Ga0496114_0651736 3300048917 Bacteria 926
402 Ga0496115_0010662 3300048918 Bacteria 6872
403 Ga0496115_0104566 3300048918 Bacteria 2324
404 Ga0496115_0137733 3300048918 Bacteria 2013
405 Ga0496115_0266433 3300048918 Bacteria 1408
406 Ga0496115_0277287 3300048918 Bacteria 1377
407 Ga0501067_0053664 3300049583 Bacteria 2233
408 Ga0501069_0018513 3300049585 Bacteria 3759
409 Ga0501070_0145246 3300049586 Bacteria 1958
410 Ga0501080_0185791 3300049742 Bacteria 1911
411 nmdc:mga08y16_1634899_c1 3300050511 Bacteria 601
412 nmdc:mga08y16_305313_c1 3300050511 Bacteria 1640
413 nmdc:mga0n895_384550_c1 3300050512 Bacteria 1420
414 nmdc:mga0a205_79130_c2 3300050515 Bacteria 1379
415 Ga0495601_0039016 3300053077 Bacteria 2972
416 Ga0495601_0403250 3300053077 Bacteria 886
417 Ga0495612_0124712 3300053078 Bacteria 1110
418 Ga0495655_0031481 3300053083 Bacteria 1291
419 Ga0495619_0078854 3300053085 Bacteria 2214
420 Ga0495619_0101136 3300053085 Bacteria 1962
421 Ga0466962_0000315 3300061719 Bacteria 20758
422 Ga0466962_0040103 3300061719 Bacteria 2242
423 Ga0530510_0020999 3300061734 Bacteria 4644
424 Ga0530510_0550030 3300061734 Bacteria 877
425 Ga0530510_0954614 3300061734 Bacteria 656
426 Ga0070683_100088157
427 Ga0070658_10006990
428 Ga0070658_10529785
429 Ga0070683_100014510
430 Ga0070683_100133528
431 Ga0070680_100005886
432 Ga0070680_100073967
433 Ga0070680_100093345
434 Ga0070680_100110112
435 Ga0070680_100258462
436 Ga0070680_101256290
437 Ga0070682_100099081
438 Ga0070682_100586837
439 Ga0070660_100000845
440 Ga0070660_100008455
441 Ga0070660_100144156
442 Ga0070660_100148091
443 Ga0070660_100207572
444 Ga0070691_10722029
445 Ga0070661_100042039
446 Ga0070661_100115721
447 Ga0070661_100168564
448 Ga0070661_100772929
449 Ga0070671_100482281
450 Ga0070674_100459649
451 Ga0070659_100062240
452 Ga0070659_100069281
453 Ga0070709_10134302
454 Ga0070709_10302228
455 Ga0070714_100136614
456 Ga0070714_100281283
457 Ga0070714_100285401
458 Ga0070714_100427925
459 Ga0070711_100101845
460 Ga0070711_100106264
461 Ga0070694_100429792
462 Ga0070708_100063789
463 Ga0070681_10003958
464 Ga0070681_10005605
465 Ga0070681_10086099
466 Ga0070681_10222257
467 Ga0070681_10259064
468 Ga0070681_10294890
469 Ga0070681_10394120
470 Ga0070706_101026369
471 Ga0070707_100655702
472 Ga0070699_100152099
473 Ga0070699_100198591
474 Ga0070679_100016149
475 Ga0070679_100046035
476 Ga0070679_100065993
477 Ga0070679_100144586
478 Ga0070679_100241940
479 Ga0070679_100252147
480 Ga0070684_100171184
481 Ga0070684_100466559
482 Ga0070684_100788985
483 Ga0070684_101078232
484 Ga0068853_100142085
485 Ga0068853_100680301
486 Ga0068853_101225357
487 Ga0070696_100982244
488 Ga0070665_100029758
489 Ga0068855_100008598
490 Ga0068855_100049709
491 Ga0068855_100095652
492 Ga0068855_100633970
493 Ga0068855_100812759
494 Ga0068857_100449224
495 Ga0068857_101300123
496 Ga0068854_100601406
497 Ga0068856_100259689
498 Ga0068856_101602150
499 Ga0070702_100259559
500 Ga0068852_100034174
501 Ga0068852_100531372
502 Ga0068852_100648528
503 Ga0070715_10554570
504 Ga0068871_101037843
505 Ga0075433_10320942
506 Ga0075434_100403430
507 Ga0075436_100225623
508 Ga0075435_100073705
509 Ga0105240_10142186
510 Ga0105240_10509075
511 Ga0105240_10913081
512 Ga0105240_11737613
513 Ga0111539_10181445
514 Ga0105243_10812611
515 Ga0105241_10089448
516 Ga0105242_10196483
517 Ga0105237_10010559
518 Ga0105237_10119283
519 Ga0105237_10210349
520 Ga0105238_10010847
521 Ga0105238_10873353
522 Ga0105238_10996563
523 Ga0105239_10468676
524 Ga0157370_10016392
525 Ga0157370_10018813
526 Ga0157370_10724765
527 Ga0157370_11016064
528 Ga0157369_10030900
529 Ga0157369_10429440
530 Ga0157369_10680755
531 Ga0157369_11037253
532 Ga0157374_11672993
533 Ga0157372_10052333
534 Ga0157372_10091743
535 Ga0157372_10137086
536 Ga0157372_10347841
537 Ga0157372_11451996
538 Ga0157372_11592027
539 Ga0157372_12102651
540 Ga0182008_10167790
541 Ga0197907_10734091
542 Ga0206356_10843480
543 Ga0206354_10739395
544 Ga0206354_11119917
545 Ga0206353_10260550
546 Ga0206353_10322902
547 Ga0206353_10737253
548 Ga0213873_10014112
549 Ga0207685_10064056
550 Ga0207685_10230783
551 Ga0207705_10027011
552 Ga0207705_10057789
553 Ga0207705_10242913
554 Ga0207654_10238578
555 Ga0207707_10010397
556 Ga0207707_10043930
557 Ga0207707_10057821
558 Ga0207707_10166653
559 Ga0207707_10253857
560 Ga0207707_10928152
561 Ga0207695_10389889
562 Ga0207660_10041562
563 Ga0207660_10043163
564 Ga0207660_10084205
565 Ga0207660_10154702
566 Ga0207660_10268077
567 Ga0207657_10000500
568 Ga0207657_10000718
569 Ga0207657_10060717
570 Ga0207657_10063631
571 Ga0207657_10083923
572 Ga0207657_10241180
573 Ga0207657_10312973
574 Ga0207657_10396189
575 Ga0207657_10568072
576 Ga0207649_10027364
577 Ga0207649_10084891
578 Ga0207649_10202009
579 Ga0207652_10029141
580 Ga0207652_10051810
581 Ga0207652_10055243
582 Ga0207652_10111763
583 Ga0207652_10224170
584 Ga0207652_10479166
585 Ga0207646_10312907
586 Ga0207694_10512223
587 Ga0207694_11026220
588 Ga0207664_10155281
589 Ga0207664_10259730
590 Ga0207664_10480235
591 Ga0207664_11349558
592 Ga0207644_10111850
593 Ga0207690_10064954
594 Ga0207690_10073249
595 Ga0207690_10643296
596 Ga0207686_10422211
597 Ga0207709_10089941
598 Ga0207661_10114955
599 Ga0207661_10173909
600 Ga0207661_10350547
601 Ga0207661_11073398
602 Ga0207661_11726377
603 Ga0207679_10627412
604 Ga0207667_10037329
605 Ga0207667_10667383
606 Ga0207667_10747627
607 Ga0207640_10255961
608 Ga0207640_10781073
609 Ga0207639_10033538
610 Ga0207639_10391402
611 Ga0207678_10126640
612 Ga0207702_10209251
613 Ga0207702_10568159
614 Ga0207674_10333409
615 Ga0207674_10376443
616 Ga0207675_101516490
617 Ga0207683_10398022
618 Ga0207683_10854267
619 Ga0207698_10077224
620 Ga0207698_10192776
621 Ga0207698_10579120
622 Ga0207428_10145187
623 Ga0265336_10039877
624 Ga0307415_100332835
625 Ga0373934_0114050
626 Ga0373944_0003275
627 Ga0373936_0002779
628 Ga0373945_0000921
629 Ga0373945_0004373
630 Ga0373954_0116575
631 Ga0373943_0003623
632 Ga0373943_0046145
633 Ga0373946_0001497
634 Ga0373946_0071931
635 Ga0373955_0015890
636 Ga0373935_0124245
637 Ga0373927_0031884
638 Ga0373927_0056214
639 Ga0373947_0000420
640 Ga0373947_0007893
641 Ga0373937_0036702
642 Ga0373925_0006404
643 Ga0373925_0827738
644 Ga0395899_0010531
645 Ga0395899_0092178
646 Ga0395899_0208479
647 Ga0395900_0062445
648 Ga0395900_0100151
649 Ga0395900_0118508
650 Ga0395900_0245729
651 Ga0395900_0307976
652 Ga0395900_0784376
653 Ga0395898_0000926
654 Ga0395898_0009223
655 Ga0395898_0073610
656 Ga0395898_0110877
657 Ga0395898_0276289
658 Ga0395898_0281856
659 Ga0395898_0370961
660 Ga0395898_0625409
661 Ga0395898_0889584
662 Ga0395905_0036917
663 Ga0395905_0079386
664 Ga0395905_0266293
665 Ga0395905_0338444
666 Ga0395905_0954566
667 Ga0395905_1735300
668 Ga0436364_1158613
669 Ga0395901_0012850
670 Ga0395901_0081934
671 Ga0395901_0160478
672 Ga0395901_0325684
673 Ga0395901_0584441
674 Ga0395901_1109370
675 Ga0395901_1346775
676 Ga0436365_1226843
677 Ga0436365_1405983
678 Ga0436360_0975120
679 Ga0436363_1515745
680 Ga0436362_0097300
681 Ga0451839_0053228
682 Ga0466965_0312107
683 Ga0466966_0000305
684 Ga0466966_0016526
685 Ga0466966_0200098
686 Ga0466961_0054978
687 Ga0466961_0109213
688 Ga0466961_0138232
689 Ga0466963_0001910
690 Ga0466963_0011657
691 Ga0466963_0059807
692 Ga0466963_0067878
693 Ga0466963_0075686
694 Ga0466963_0087510
695 Ga0466963_0268570
696 Ga0466963_0313626
697 Ga0466963_0877405
698 Ga0466964_0007714
699 Ga0466964_0035477
700 Ga0466964_0051023
701 Ga0466971_0000262
702 Ga0466968_0278081
703 Ga0466970_0017467
704 Ga0466957_0000120
705 Ga0466957_0023966
706 Ga0466957_0122207
707 Ga0466957_0221303
708 Ga0466960_0338061
709 Ga0466959_0002778
710 Ga0466959_0006905
711 Ga0466959_0010616
712 Ga0466959_0196316
713 Ga0466959_0515101
714 Ga0466958_0003088
715 Ga0466958_0004789
716 Ga0466958_0243368
717 Ga0466967_0002685
718 Ga0466967_0009462
719 Ga0466967_0011301
720 Ga0466967_0014780
721 Ga0466967_0018549
722 Ga0466967_0040981
723 Ga0466967_0108404
724 Ga0466967_0149451
725 Ga0466967_0152929
726 Ga0466967_0195952
727 Ga0466967_0211172
728 Ga0466967_0232397
729 Ga0466967_0507027
730 Ga0466967_0516089
731 Ga0466967_0937359
732 Ga0495592_0210881
733 Ga0495629_0002147
734 Ga0495629_0049138
735 Ga0495629_0056197
736 Ga0495629_0131961
737 Ga0495641_0002183
738 Ga0495641_0046321
739 Ga0495641_0331385
740 Ga0495651_0006163
741 Ga0495653_0030321
742 Ga0495653_0090592
743 Ga0495653_0145680
744 Ga0495582_0006489
745 Ga0495582_0388740
746 Ga0495639_0089337
747 Ga0495662_0030485
748 Ga0495664_0047432
749 Ga0495664_0067226
750 Ga0495594_0022673
751 Ga0495608_0040027
752 Ga0495628_0080264
753 Ga0495628_0085969
754 Ga0495630_0005687
755 Ga0495630_0006246
756 Ga0495630_0078896
757 Ga0495630_0167163
758 Ga0495630_0259555
759 Ga0495652_0025581
760 Ga0495652_0141696
761 Ga0495652_0216110
762 Ga0495665_0558591
763 Ga0495640_0071436
764 Ga0495587_0031517
765 Ga0495587_0067794
766 Ga0495587_0381658
767 Ga0495587_0650394
768 Ga0495645_0140476
769 Ga0495645_0145640
770 Ga0495645_0647303
771 Ga0495667_0005342
772 Ga0495667_0033058
773 Ga0495634_0054100
774 Ga0495634_0184601
775 Ga0495635_0024297
776 Ga0495635_0157675
777 Ga0495657_0018158
778 Ga0495657_0096898
779 Ga0495657_0151264
780 Ga0495599_0009581
781 Ga0495623_0020320
782 Ga0495646_0067454
783 Ga0495647_0031685
784 Ga0495658_0000345
785 Ga0495658_0048298
786 Ga0495658_0084794
787 Ga0495658_0144147
788 Ga0495613_0013011
789 Ga0495613_0013684
790 Ga0495613_0109833
791 Ga0495613_0869141
792 Ga0495624_0032485
793 Ga0495600_0055905
794 Ga0495581_0006092
795 Ga0495604_0015468
796 Ga0495674_0026518
797 Ga0495674_0120078
798 Ga0495676_0017774
799 Ga0495676_0100090
800 Ga0495680_0011298
801 Ga0495680_0036812
802 Ga0495675_0009235
803 Ga0495684_0068736
804 Ga0495602_0053639
805 Ga0495614_0004925
806 Ga0496100_0021846
807 Ga0496100_0037992
808 Ga0496101_0051559
809 Ga0496101_0061011
810 Ga0496101_0516167
811 Ga0496102_0021938
812 Ga0496102_0261086
813 Ga0496102_0530616
814 Ga0496103_0017512
815 Ga0496103_0019613
816 Ga0496104_0131190
817 Ga0496106_0008152
818 Ga0496107_0139699
819 Ga0496109_0411292
820 Ga0496112_0004705
821 Ga0496112_0011636
822 Ga0496112_0109155
823 Ga0496113_1137766
824 Ga0496114_0018835
825 Ga0496114_0391657
826 Ga0496114_0651736
827 Ga0496115_0010662
828 Ga0496115_0104566
829 Ga0496115_0137733
830 Ga0496115_0266433
831 Ga0496115_0277287
832 Ga0501067_0053664
833 Ga0501069_0018513
834 Ga0501070_0145246
835 Ga0501080_0185791
836 nmdc:mga08y16_1634899_c1
837 nmdc:mga08y16_305313_c1
838 nmdc:mga0n895_384550_c1
839 nmdc:mga0a205_79130_c2
840 Ga0495601_0039016
841 Ga0495601_0403250
842 Ga0495612_0124712
843 Ga0495655_0031481
844 Ga0495619_0078854
845 Ga0495619_0101136
846 Ga0466962_0000315
847 Ga0466962_0040103
848 Ga0530510_0020999
849 Ga0530510_0550030
850 Ga0530510_0954614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05239

PRC

PRC-barrel domain

103

169

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i6d-assembly1.cif.gz_A crystal structure of ppo from bacillus subtilis with af 0.8573 104 126
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.81 1 150
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.8051 1 150
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.8049 83 150
7xjw-assembly3.cif.gz_F crystal structure of canine coronavirus main protease in complex with gc376 0.7484 37 61
ID Description Score Start End Superfamily
af_P9WH19_99_175_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9329 80 149 2.30.30.240
af_Q2FZ44_92_167_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9212 79 150 2.30.30.240
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9049 79 150 2.30.30.240
2f1lA02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8766 84 145 2.30.30.240
af_P9WH19_2_95_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8708 3 77 2.40.30.60
ID Description Score Start End GO Terms
AF-A0A2V2SF03-F1-model_v4 deleted 0.978 1 150
AF-A0A537TK18-F1-model_v4 Ribosome maturation factor RimM 0.9758 2 150 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A2V2SF03-F1-model_v4 deleted 0.9716 1 150
AF-A0A538M9A1-F1-model_v4 Ribosome maturation factor RimM 0.9664 2 150 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A3R8NDC9-F1-model_v4 16S rRNA processing protein RimM 0.966 71 145 GO:0005840
GO:0006364
GO:0043022

Map