F440861

General Info

Members Datasets Scaffolds Average Seq Length
424 225 848 228

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_174764_c1|nmdc:mga05p37_174764_c1_925_1704
Length 259
Sequence MTSPITNNRTALITGASRGLGLALARQLAERGWSLIIDARGAKVLKAAQKELAQRTPVTAIVGDVTDQAHRRALVVAARAAGGLDAVVNNASILGPSPQPPLLDYPLDILEQVYRTNVIAPLALLQAVRGELKPDACIINVTSDAGVEAYPGWGGYGSSKAALEQLSAILAEENPQWRVYWVDPGDMRTQMHQDAFPDEDISDRPLPEESVPGLLELLEGNRPSGRYAARALSAVETSEGVQELRVAFTVENLDQSEGG

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 7.55
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_174764_c1 3300050507 Bacteria 2617
2 JGI25406J46586_10006018 3300003203 Bacteria 5611
3 JGI25406J46586_10047294 3300003203 Bacteria 1467
4 rootH2_10259996 3300003320 Bacteria 1795
5 rootH1_10186035 3300003323 Bacteria 3634
6 rootH1_10221954 3300003323 Unclassified 2167
7 JGI25405J52794_10012509 3300003911 Bacteria 1635
8 Ga0070676_10212052 3300005328 Bacteria 1275
9 Ga0070683_100039835 3300005329 Bacteria 4316
10 Ga0070683_100080202 3300005329 Bacteria 3055
11 Ga0070683_100683646 3300005329 Bacteria 983
12 Ga0070683_100723103 3300005329 Bacteria 954
13 Ga0070670_100539346 3300005331 Bacteria 1040
14 Ga0070680_100053059 3300005336 Bacteria 3309
15 Ga0070661_100024931 3300005344 Bacteria 4293
16 Ga0070661_100282224 3300005344 Bacteria 1289
17 Ga0070661_100535488 3300005344 Bacteria 941
18 Ga0070668_100032513 3300005347 Bacteria 3970
19 Ga0070668_100458672 3300005347 Bacteria 1097
20 Ga0070675_100598268 3300005354 Bacteria 1000
21 Ga0070674_100638634 3300005356 Bacteria 904
22 Ga0070688_100332804 3300005365 Bacteria 1107
23 Ga0070659_100003406 3300005366 Bacteria 11330
24 Ga0070659_100348529 3300005366 Bacteria 1242
25 Ga0070709_10029586 3300005434 Bacteria 3278
26 Ga0070709_10393480 3300005434 Bacteria 1033
27 Ga0070714_100258976 3300005435 Unclassified 1610
28 Ga0070713_100064574 3300005436 Bacteria 3073
29 Ga0070713_100180808 3300005436 Bacteria 1895
30 Ga0070710_10083644 3300005437 Bacteria 1868
31 Ga0070710_10259547 3300005437 Bacteria 1120
32 Ga0070694_100239428 3300005444 Bacteria 1368
33 Ga0070708_100000213 3300005445 Bacteria 43046
34 Ga0070708_100037516 3300005445 Bacteria 4229
35 Ga0070708_100121262 3300005445 Bacteria 2412
36 Ga0070708_100331412 3300005445 Unclassified 1434
37 Ga0070678_100203248 3300005456 Bacteria 1636
38 Ga0070681_10033980 3300005458 Bacteria 5120
39 Ga0068867_100260928 3300005459 Bacteria 1412
40 Ga0070685_10292316 3300005466 Bacteria 1095
41 Ga0070706_100001125 3300005467 Bacteria 28902
42 Ga0070706_100019963 3300005467 Bacteria 6178
43 Ga0070707_100000227 3300005468 Bacteria 56258
44 Ga0070698_100017233 3300005471 Bacteria 7610
45 Ga0070698_100028028 3300005471 Bacteria 5853
46 Ga0070698_100035986 3300005471 Bacteria 5118
47 Ga0070699_100001869 3300005518 Bacteria 19052
48 Ga0070699_100004357 3300005518 Bacteria 12508
49 Ga0070679_100021015 3300005530 Bacteria 6369
50 Ga0070679_100026194 3300005530 Bacteria 5725
51 Ga0070684_100077099 3300005535 Bacteria 2943
52 Ga0070697_100007292 3300005536 Bacteria 8601
53 Ga0068853_100679591 3300005539 Bacteria 981
54 Ga0070665_100247859 3300005548 Bacteria 1782
55 Ga0070665_100575992 3300005548 Bacteria 1138
56 Ga0070664_100612959 3300005564 Bacteria 1010
57 Ga0068857_100018199 3300005577 Bacteria 6161
58 Ga0068857_100101938 3300005577 Bacteria 2576
59 Ga0068857_100727538 3300005577 Bacteria 944
60 Ga0068852_100111765 3300005616 Bacteria 2485
61 Ga0068852_100555530 3300005616 Bacteria 1149
62 Ga0068852_100805235 3300005616 Bacteria 954
63 Ga0068859_100453860 3300005617 Bacteria 1378
64 Ga0068851_10009912 3300005834 Bacteria 4437
65 Ga0068870_10147360 3300005840 Bacteria 1383
66 Ga0068863_100112010 3300005841 Bacteria 2599
67 Ga0068863_100266223 3300005841 Bacteria 1658
68 Ga0068858_100018848 3300005842 Bacteria 6457
69 Ga0068858_100480483 3300005842 Bacteria 1199
70 Ga0068860_100088429 3300005843 Bacteria 2949
71 Ga0068862_100532035 3300005844 Bacteria 1120
72 Ga0068862_100550139 3300005844 Bacteria 1102
73 Ga0081455_10000157 3300005937 Bacteria 82320
74 Ga0081455_10001972 3300005937 Bacteria 24552
75 Ga0081455_10259296 3300005937 Bacteria 1267
76 Ga0081455_10380058 3300005937 Bacteria 987
77 Ga0081538_10004187 3300005981 Bacteria 13390
78 Ga0081538_10016510 3300005981 Bacteria 5657
79 Ga0081538_10158741 3300005981 Bacteria 1009
80 Ga0081540_1001536 3300005983 Bacteria 19829
81 Ga0081540_1001943 3300005983 Bacteria 17301
82 Ga0081540_1016649 3300005983 Bacteria 4589
83 Ga0081539_10001009 3300005985 Bacteria 52009
84 Ga0081539_10001045 3300005985 Bacteria 50690
85 Ga0081539_10008201 3300005985 Bacteria 9199
86 Ga0081539_10008357 3300005985 Bacteria 9045
87 Ga0081539_10008433 3300005985 Bacteria 8988
88 Ga0081539_10038616 3300005985 Bacteria 2827
89 Ga0081539_10040999 3300005985 Bacteria 2712
90 Ga0070717_10013443 3300006028 Bacteria 6274
91 Ga0070717_10056699 3300006028 Bacteria 3238
92 Ga0070717_10411712 3300006028 Bacteria 1215
93 Ga0068871_100557032 3300006358 Bacteria 1039
94 Ga0075428_100163716 3300006844 Bacteria 2413
95 Ga0075428_100977188 3300006844 Bacteria 897
96 Ga0075431_100893829 3300006847 Unclassified 858
97 Ga0075433_10000155 3300006852 Bacteria 36857
98 Ga0075433_10023577 3300006852 Bacteria 5182
99 Ga0075433_10325257 3300006852 Bacteria 1360
100 Ga0075434_100003337 3300006871 Bacteria 14365
101 Ga0097620_100453847 3300006931 Bacteria 1378
102 Ga0099794_10080366 3300007265 Bacteria 1607
103 Ga0111539_10036113 3300009094 Bacteria 5978
104 Ga0111539_10532777 3300009094 Bacteria 1368
105 Ga0105245_10021498 3300009098 Bacteria 5661
106 Ga0105245_10115307 3300009098 Bacteria 2503
107 Ga0105245_10492544 3300009098 Bacteria 1241
108 Ga0114129_10053451 3300009147 Bacteria 5664
109 Ga0105243_10061945 3300009148 Bacteria 2994
110 Ga0105243_10196990 3300009148 Bacteria 1764
111 Ga0105243_10466566 3300009148 Bacteria 1188
112 Ga0105237_10000077 3300009545 Bacteria 130791
113 Ga0105238_10027861 3300009551 Bacteria 5758
114 Ga0105249_10968908 3300009553 Bacteria 919
115 Ga0105246_10191096 3300011119 Bacteria 1585
116 Ga0157369_10081298 3300013105 Bacteria 3467
117 Ga0157378_10525847 3300013297 Unclassified 1185
118 Ga0157372_10207698 3300013307 Bacteria 2269
119 Ga0157372_10467893 3300013307 Bacteria 1469
120 Ga0163163_10229792 3300014325 Bacteria 1904
121 Ga0163163_10356885 3300014325 Bacteria 1518
122 Ga0157380_10181075 3300014326 Bacteria 1851
123 Ga0157376_11172827 3300014969 Bacteria 796
124 Ga0197907_10810437 3300020069 Bacteria 1146
125 Ga0206349_1199341 3300020075 Bacteria 863
126 Ga0213876_10062720 3300021384 Bacteria 1962
127 Ga0224712_10006217 3300022467 Bacteria 3386
128 Ga0224712_10079499 3300022467 Bacteria 1350
129 Ga0207426_1016798 3300025302 Bacteria 2616
130 Ga0207656_10024131 3300025321 Bacteria 2456
131 Ga0207692_10165412 3300025898 Bacteria 1278
132 Ga0207699_10040269 3300025906 Bacteria 2691
133 Ga0207699_10232269 3300025906 Bacteria 1264
134 Ga0207643_10190024 3300025908 Bacteria 1246
135 Ga0207684_10005971 3300025910 Bacteria 11139
136 Ga0207684_10018316 3300025910 Bacteria 5994
137 Ga0207684_10035246 3300025910 Bacteria 4249
138 Ga0207707_10038990 3300025912 Bacteria 4153
139 Ga0207671_10000114 3300025914 Bacteria 124057
140 Ga0207693_10017758 3300025915 Bacteria 5673
141 Ga0207663_10021677 3300025916 Bacteria 3661
142 Ga0207660_10874549 3300025917 Bacteria 733
143 Ga0207662_10459253 3300025918 Bacteria 872
144 Ga0207649_10024073 3300025920 Bacteria 3534
145 Ga0207649_10344217 3300025920 Bacteria 1102
146 Ga0207652_10003534 3300025921 Bacteria 12895
147 Ga0207652_10035774 3300025921 Bacteria 4194
148 Ga0207646_10000372 3300025922 Bacteria 59957
149 Ga0207646_10006005 3300025922 Bacteria 12649
150 Ga0207694_10015553 3300025924 Bacteria 5738
151 Ga0207659_10598440 3300025926 Bacteria 940
152 Ga0207687_10011871 3300025927 Bacteria 5699
153 Ga0207700_10070042 3300025928 Bacteria 2695
154 Ga0207700_10310943 3300025928 Bacteria 1363
155 Ga0207664_10031304 3300025929 Bacteria 4069
156 Ga0207690_10047185 3300025932 Bacteria 2857
157 Ga0207690_10085442 3300025932 Bacteria 2215
158 Ga0207690_10254547 3300025932 Bacteria 1358
159 Ga0207690_10574643 3300025932 Bacteria 918
160 Ga0207690_10632275 3300025932 Bacteria 876
161 Ga0207669_10143016 3300025937 Bacteria 1664
162 Ga0207704_10113212 3300025938 Bacteria 1839
163 Ga0207704_10486915 3300025938 Bacteria 991
164 Ga0207661_10177199 3300025944 Bacteria 1860
165 Ga0207661_10230612 3300025944 Bacteria 1639
166 Ga0207661_10291398 3300025944 Bacteria 1461
167 Ga0207679_10195432 3300025945 Bacteria 1686
168 Ga0207651_10847078 3300025960 Bacteria 812
169 Ga0207712_10504233 3300025961 Bacteria 1035
170 Ga0207703_10818932 3300026035 Bacteria 889
171 Ga0207639_10194132 3300026041 Bacteria 1736
172 Ga0207678_10774261 3300026067 Bacteria 847
173 Ga0207708_10022988 3300026075 Bacteria 4709
174 Ga0207641_10574324 3300026088 Bacteria 1102
175 Ga0207648_10040611 3300026089 Bacteria 4088
176 Ga0207648_10377662 3300026089 Bacteria 1281
177 Ga0207674_10000353 3300026116 Bacteria 59263
178 Ga0207674_10016429 3300026116 Bacteria 8103
179 Ga0207674_10418409 3300026116 Bacteria 1295
180 Ga0207675_100047246 3300026118 Bacteria 4019
181 Ga0207683_10597504 3300026121 Bacteria 1021
182 Ga0207698_10191045 3300026142 Bacteria 1824
183 Ga0207698_10244422 3300026142 Bacteria 1638
184 Ga0307408_100003870 3300031548 Bacteria 10191
185 Ga0307408_100174720 3300031548 Bacteria 1718
186 Ga0307408_100416982 3300031548 Unclassified 1157
187 Ga0307405_10027172 3300031731 Bacteria 3314
188 Ga0307405_10750365 3300031731 Bacteria 813
189 Ga0307413_10026793 3300031824 Bacteria 3183
190 Ga0307413_10079740 3300031824 Bacteria 2094
191 Ga0307413_10304900 3300031824 Bacteria 1209
192 Ga0307410_10013874 3300031852 Bacteria 4719
193 Ga0307410_10123265 3300031852 Bacteria 1893
194 Ga0307410_10145439 3300031852 Bacteria 1759
195 Ga0307410_10246353 3300031852 Bacteria 1387
196 Ga0307406_10044199 3300031901 Bacteria 2791
197 Ga0307406_10097213 3300031901 Bacteria 1996
198 Ga0307406_10163518 3300031901 Bacteria 1603
199 Ga0307407_10007422 3300031903 Bacteria 4966
200 Ga0307407_10022349 3300031903 Bacteria 3280
201 Ga0307407_10376335 3300031903 Bacteria 1013
202 Ga0307412_10268580 3300031911 Bacteria 1334
203 Ga0307409_100060761 3300031995 Bacteria 2949
204 Ga0307409_100065774 3300031995 Bacteria 2855
205 Ga0307409_100093928 3300031995 Bacteria 2466
206 Ga0307409_100113313 3300031995 Bacteria 2279
207 Ga0307409_100157965 3300031995 Bacteria 1979
208 Ga0307409_100517048 3300031995 Bacteria 1165
209 Ga0307416_100006015 3300032002 Bacteria 7549
210 Ga0307416_100009359 3300032002 Bacteria 6408
211 Ga0307416_100240778 3300032002 Bacteria 1753
212 Ga0307416_100401347 3300032002 Bacteria 1408
213 Ga0307416_100796480 3300032002 Bacteria 1040
214 Ga0307416_101246854 3300032002 Bacteria 849
215 Ga0307411_10227574 3300032005 Bacteria 1451
216 Ga0307411_10249758 3300032005 Bacteria 1394
217 Ga0307411_10278095 3300032005 Bacteria 1331
218 Ga0307411_10293621 3300032005 Bacteria 1300
219 Ga0307415_100009605 3300032126 Bacteria 5435
220 Ga0307415_100031480 3300032126 Bacteria 3418
221 Ga0307415_100037398 3300032126 Bacteria 3190
222 Ga0373948_0000239 3300034817 Bacteria 6560
223 Ga0373956_0000009 3300035119 Bacteria 61439
224 Ga0373931_0000014 3300035691 Bacteria 251374
225 Ga0373931_0026492 3300035691 Bacteria 2951
226 Ga0373927_0000054 3300035695 Bacteria 81486
227 Ga0373933_0002465 3300035724 Bacteria 10412
228 Ga0373933_0002659 3300035724 Archaea 10013
229 Ga0373937_0220426 3300036401 Bacteria 1786
230 Ga0373937_0283632 3300036401 Unclassified 1564
231 Ga0316582_0366103 3300036647 Unclassified 992
232 Ga0395899_0040952 3300037312 Bacteria 3463
233 Ga0395899_0103230 3300037312 Bacteria 2056
234 Ga0395900_0001398 3300037418 Bacteria 28860
235 Ga0395900_0142924 3300037418 Bacteria 2449
236 Ga0395898_0003414 3300037466 Bacteria 17792
237 Ga0395898_0010225 3300037466 Bacteria 9822
238 Ga0395898_0013730 3300037466 Bacteria 8330
239 Ga0395898_0014595 3300037466 Bacteria 8067
240 Ga0395905_0008605 3300037471 Bacteria 10054
241 Ga0395905_0025828 3300037471 Bacteria 5537
242 Ga0436364_1209149 3300037853 Bacteria 1016
243 Ga0395901_0000739 3300038443 Bacteria 36910
244 Ga0395901_0001816 3300038443 Bacteria 22049
245 Ga0395901_0010631 3300038443 Bacteria 9326
246 Ga0395901_0035478 3300038443 Bacteria 5152
247 Ga0395901_0677041 3300038443 Bacteria 1032
248 Ga0395901_0853591 3300038443 Bacteria 896
249 Ga0400484_23481 3300038725 Bacteria 3509
250 Ga0436365_1130064 3300039437 Bacteria 16558
251 Ga0436362_0745944 3300039453 Bacteria 1641
252 Ga0451853_1781216 3300041512 Bacteria 4609
253 Ga0439441_021206 3300042001 Bacteria 1197
254 Ga0439455_0005361 3300042012 Bacteria 2601
255 Ga0450920_026394 3300042122 Bacteria 1134
256 Ga0439458_0033703 3300042157 Bacteria 1227
257 Ga0439464_0022275 3300042439 Bacteria 1744
258 Ga0439460_0031613 3300042461 Bacteria 1511
259 Ga0439440_0009708 3300042993 Bacteria 1997
260 Ga0466972_0003882 3300044658 Bacteria 7446
261 Ga0466965_0054976 3300044683 Bacteria 1980
262 Ga0466966_0029437 3300044684 Bacteria 3573
263 Ga0466966_0057856 3300044684 Bacteria 2451
264 Ga0466966_0211439 3300044684 Bacteria 1172
265 Ga0466961_0012429 3300044693 Bacteria 5446
266 Ga0466963_0030652 3300044694 Bacteria 3472
267 Ga0466963_0043752 3300044694 Bacteria 2946
268 Ga0466963_0124023 3300044694 Bacteria 1780
269 Ga0466963_0261795 3300044694 Bacteria 1214
270 Ga0466963_0585482 3300044694 Bacteria 788
271 Ga0466968_0004549 3300044735 Bacteria 5190
272 Ga0466970_0224499 3300044765 Bacteria 1049
273 Ga0466957_0037296 3300044842 Unclassified 2926
274 Ga0466960_0018362 3300044901 Bacteria 3063
275 Ga0466960_0034464 3300044901 Bacteria 2359
276 Ga0466959_0332631 3300045049 Bacteria 1037
277 Ga0466959_0387214 3300045049 Bacteria 951
278 Ga0466958_0034368 3300045836 Bacteria 3024
279 Ga0466967_0030337 3300045976 Bacteria 4537
280 Ga0466967_0119130 3300045976 Bacteria 2436
281 Ga0466967_0408810 3300045976 Bacteria 1321
282 Ga0466967_0613305 3300045976 Bacteria 1074
283 Ga0466967_0697941 3300045976 Bacteria 1005
284 Ga0466967_0947452 3300045976 Bacteria 856
285 Ga0495590_0086709 3300046457 Bacteria 1106
286 Ga0495629_0134023 3300046459 Bacteria 1725
287 Ga0495641_0079013 3300046461 Bacteria 1474
288 Ga0495582_0341385 3300046473 Bacteria 862
289 Ga0495620_0162415 3300046515 Bacteria 868
290 Ga0495630_0010982 3300046517 Bacteria 6547
291 Ga0495640_0129276 3300046533 Bacteria 1636
292 Ga0495587_0311755 3300046536 Bacteria 879
293 Ga0495656_0438819 3300046615 Bacteria 687
294 Ga0495658_0003644 3300046683 Bacteria 7625
295 Ga0495674_0059445 3300047319 Bacteria 3338
296 Ga0496100_0147461 3300048903 Bacteria 1675
297 Ga0496100_0211189 3300048903 Bacteria 1420
298 Ga0496101_0303442 3300048904 Bacteria 1251
299 Ga0496102_0374462 3300048905 Bacteria 1340
300 Ga0496102_0429874 3300048905 Bacteria 1240
301 Ga0496104_0032830 3300048907 Bacteria 4832
302 Ga0496104_0209848 3300048907 Bacteria 1859
303 Ga0496105_0240235 3300048908 Bacteria 1470
304 Ga0496107_0544542 3300048910 Bacteria 860
305 Ga0496108_0000087 3300048911 Bacteria 97626
306 Ga0496108_0007206 3300048911 Bacteria 9014
307 Ga0496108_0083297 3300048911 Bacteria 2713
308 Ga0496108_0088659 3300048911 Bacteria 2629
309 Ga0496109_0023541 3300048912 Bacteria 5467
310 Ga0496109_0053066 3300048912 Bacteria 3696
311 Ga0496109_0080760 3300048912 Bacteria 2996
312 Ga0496109_0359693 3300048912 Bacteria 1375
313 Ga0496110_0001268 3300048913 Bacteria 18064
314 Ga0496110_0060289 3300048913 Bacteria 3345
315 Ga0496111_0052266 3300048914 Bacteria 2950
316 Ga0496111_0063357 3300048914 Bacteria 2681
317 Ga0496111_0138891 3300048914 Bacteria 1800
318 Ga0496112_0003576 3300048915 Bacteria 12917
319 Ga0496112_0009272 3300048915 Bacteria 8849
320 Ga0496112_0254313 3300048915 Bacteria 1707
321 Ga0496112_0254825 3300048915 Bacteria 1705
322 Ga0496113_0004264 3300048916 Bacteria 8760
323 Ga0496113_0206989 3300048916 Bacteria 1561
324 Ga0496113_0227512 3300048916 Bacteria 1487
325 Ga0496114_0004757 3300048917 Bacteria 10572
326 Ga0496115_0089879 3300048918 Bacteria 2508
327 Ga0496115_0209214 3300048918 Bacteria 1611
328 Ga0501031_0324426 3300049568 Bacteria 997
329 Ga0501032_0164373 3300049569 Bacteria 1457
330 Ga0501032_0387668 3300049569 Bacteria 898
331 Ga0501034_0553378 3300049571 Bacteria 1060
332 Ga0501036_0240236 3300049572 Bacteria 1519
333 Ga0501036_0271957 3300049572 Bacteria 1418
334 Ga0501038_0113007 3300049574 Bacteria 2248
335 Ga0501038_0346938 3300049574 Bacteria 1157
336 Ga0501039_0042697 3300049575 Bacteria 3503
337 Ga0501039_0066657 3300049575 Bacteria 2795
338 Ga0501039_0415946 3300049575 Bacteria 1056
339 Ga0501040_0019133 3300049576 Bacteria 4553
340 Ga0501040_0072969 3300049576 Bacteria 2371
341 Ga0501041_0019929 3300049577 Bacteria 4007
342 Ga0501041_0155828 3300049577 Bacteria 1427
343 Ga0501041_0358389 3300049577 Bacteria 922
344 Ga0501042_0062453 3300049578 Bacteria 2662
345 Ga0501042_0091193 3300049578 Bacteria 2187
346 Ga0501042_0110970 3300049578 Bacteria 1975
347 Ga0501042_0468115 3300049578 Bacteria 914
348 Ga0501043_0217307 3300049579 Bacteria 1480
349 Ga0501046_0044657 3300049580 Bacteria 3524
350 Ga0501046_0523663 3300049580 Bacteria 847
351 Ga0501046_0564726 3300049580 Bacteria 810
352 Ga0501047_0000195 3300049581 Bacteria 73381
353 Ga0501048_0113086 3300049582 Unclassified 1918
354 Ga0501048_0145818 3300049582 Bacteria 1674
355 Ga0501067_0215578 3300049583 Bacteria 1069
356 Ga0501067_0326151 3300049583 Bacteria 855
357 Ga0501068_0036243 3300049584 Bacteria 2948
358 Ga0501068_0480851 3300049584 Bacteria 805
359 Ga0501069_0062699 3300049585 Bacteria 2076
360 Ga0501070_0380272 3300049586 Bacteria 1144
361 Ga0501071_0015244 3300049587 Bacteria 5275
362 Ga0501071_0076398 3300049587 Bacteria 2446
363 Ga0501071_0101523 3300049587 Unclassified 2121
364 Ga0501071_0132255 3300049587 Bacteria 1854
365 Ga0501071_0294689 3300049587 Bacteria 1229
366 Ga0501071_0410997 3300049587 Bacteria 1034
367 Ga0501072_0052398 3300049588 Bacteria 3213
368 Ga0501072_0183070 3300049588 Bacteria 1671
369 Ga0501072_0930432 3300049588 Bacteria 679
370 Ga0501073_0259728 3300049589 Bacteria 1199
371 Ga0501073_0265415 3300049589 Bacteria 1185
372 Ga0501075_0020095 3300049591 Bacteria 4851
373 Ga0501075_0040426 3300049591 Bacteria 3492
374 Ga0501075_0057109 3300049591 Bacteria 2939
375 Ga0501075_0195493 3300049591 Bacteria 1543
376 Ga0501075_0553789 3300049591 Bacteria 878
377 Ga0501076_0008844 3300049592 Bacteria 7404
378 Ga0501076_0069778 3300049592 Unclassified 2809
379 Ga0501076_0092581 3300049592 Bacteria 2432
380 Ga0501076_0136208 3300049592 Bacteria 1993
381 Ga0501076_0143571 3300049592 Bacteria 1940
382 Ga0501076_0364920 3300049592 Bacteria 1186
383 Ga0501077_0050994 3300049593 Bacteria 2630
384 Ga0501079_0269099 3300049741 Bacteria 1332
385 Ga0501079_0336557 3300049741 Bacteria 1182
386 Ga0501080_0726262 3300049742 Bacteria 875
387 Ga0501081_0243196 3300049743 Bacteria 1312
388 Ga0501081_0261628 3300049743 Bacteria 1264
389 Ga0501035_0785624 3300049822 Bacteria 762
390 Ga0501044_0000762 3300049823 Bacteria 38971
391 Ga0501045_0007639 3300049824 Bacteria 7517
392 nmdc:mga05p37_1003891_c1 3300050507 Bacteria 886
393 nmdc:mga05p37_114437_c1 3300050507 Bacteria 3316
394 nmdc:mga05p37_758437_c1 3300050507 Bacteria 1068
395 nmdc:mga08y16_170081_c1 3300050511 Bacteria 2263
396 nmdc:mga08y16_47470_c1 3300050511 Bacteria 4494
397 nmdc:mga0n895_224752_c1 3300050512 Bacteria 1905
398 nmdc:mga0n895_28950_c1 3300050512 Bacteria 5277
399 nmdc:mga0n895_7361_c1 3300050512 Bacteria 9440
400 nmdc:mga0rr50_4403_c1 3300050513 Bacteria 8277
401 nmdc:mga0a205_2441_c1 3300050515 Bacteria 16399
402 nmdc:mga0a205_30538_c1 3300050515 Bacteria 5160
403 nmdc:mga0a205_626499_c1 3300050515 Bacteria 928
404 Ga0495612_0000093 3300053078 Bacteria 38770
405 Ga0495612_0135274 3300053078 Bacteria 1067
406 Ga0495595_0211817 3300053084 Bacteria 966
407 Ga0495619_0139986 3300053085 Bacteria 1666
408 Ga0500637_0009489 3300053178 Bacteria 4956
409 Ga0501084_0088187 3300054114 Bacteria 2605
410 Ga0501084_0091002 3300054114 Bacteria 2561
411 Ga0501084_0164299 3300054114 Bacteria 1873
412 Ga0501084_0216942 3300054114 Bacteria 1614
413 Ga0501084_0219883 3300054114 Unclassified 1603
414 Ga0590071_004540 3300059421 Bacteria 3367
415 Ga0590071_060183 3300059421 Bacteria 928
416 Ga0590077_003396 3300059426 Bacteria 3301
417 Ga0501082_0100183 3300060353 Bacteria 2506
418 Ga0501082_0167919 3300060353 Unclassified 1907
419 Ga0501082_0257297 3300060353 Bacteria 1519
420 Ga0530510_0004930 3300061734 Bacteria 9217
421 Ga0530510_0049354 3300061734 Bacteria 3041
422 Ga0530510_0062624 3300061734 Unclassified 2693
423 Ga0530510_0132202 3300061734 Bacteria 1836
424 Ga0530510_0427283 3300061734 Bacteria 1000
425 nmdc:mga05p37_174764_c1
426 JGI25406J46586_10006018
427 JGI25406J46586_10047294
428 rootH2_10259996
429 rootH1_10186035
430 rootH1_10221954
431 JGI25405J52794_10012509
432 Ga0070676_10212052
433 Ga0070683_100039835
434 Ga0070683_100080202
435 Ga0070683_100683646
436 Ga0070683_100723103
437 Ga0070670_100539346
438 Ga0070680_100053059
439 Ga0070661_100024931
440 Ga0070661_100282224
441 Ga0070661_100535488
442 Ga0070668_100032513
443 Ga0070668_100458672
444 Ga0070675_100598268
445 Ga0070674_100638634
446 Ga0070688_100332804
447 Ga0070659_100003406
448 Ga0070659_100348529
449 Ga0070709_10029586
450 Ga0070709_10393480
451 Ga0070714_100258976
452 Ga0070713_100064574
453 Ga0070713_100180808
454 Ga0070710_10083644
455 Ga0070710_10259547
456 Ga0070694_100239428
457 Ga0070708_100000213
458 Ga0070708_100037516
459 Ga0070708_100121262
460 Ga0070708_100331412
461 Ga0070678_100203248
462 Ga0070681_10033980
463 Ga0068867_100260928
464 Ga0070685_10292316
465 Ga0070706_100001125
466 Ga0070706_100019963
467 Ga0070707_100000227
468 Ga0070698_100017233
469 Ga0070698_100028028
470 Ga0070698_100035986
471 Ga0070699_100001869
472 Ga0070699_100004357
473 Ga0070679_100021015
474 Ga0070679_100026194
475 Ga0070684_100077099
476 Ga0070697_100007292
477 Ga0068853_100679591
478 Ga0070665_100247859
479 Ga0070665_100575992
480 Ga0070664_100612959
481 Ga0068857_100018199
482 Ga0068857_100101938
483 Ga0068857_100727538
484 Ga0068852_100111765
485 Ga0068852_100555530
486 Ga0068852_100805235
487 Ga0068859_100453860
488 Ga0068851_10009912
489 Ga0068870_10147360
490 Ga0068863_100112010
491 Ga0068863_100266223
492 Ga0068858_100018848
493 Ga0068858_100480483
494 Ga0068860_100088429
495 Ga0068862_100532035
496 Ga0068862_100550139
497 Ga0081455_10000157
498 Ga0081455_10001972
499 Ga0081455_10259296
500 Ga0081455_10380058
501 Ga0081538_10004187
502 Ga0081538_10016510
503 Ga0081538_10158741
504 Ga0081540_1001536
505 Ga0081540_1001943
506 Ga0081540_1016649
507 Ga0081539_10001009
508 Ga0081539_10001045
509 Ga0081539_10008201
510 Ga0081539_10008357
511 Ga0081539_10008433
512 Ga0081539_10038616
513 Ga0081539_10040999
514 Ga0070717_10013443
515 Ga0070717_10056699
516 Ga0070717_10411712
517 Ga0068871_100557032
518 Ga0075428_100163716
519 Ga0075428_100977188
520 Ga0075431_100893829
521 Ga0075433_10000155
522 Ga0075433_10023577
523 Ga0075433_10325257
524 Ga0075434_100003337
525 Ga0097620_100453847
526 Ga0099794_10080366
527 Ga0111539_10036113
528 Ga0111539_10532777
529 Ga0105245_10021498
530 Ga0105245_10115307
531 Ga0105245_10492544
532 Ga0114129_10053451
533 Ga0105243_10061945
534 Ga0105243_10196990
535 Ga0105243_10466566
536 Ga0105237_10000077
537 Ga0105238_10027861
538 Ga0105249_10968908
539 Ga0105246_10191096
540 Ga0157369_10081298
541 Ga0157378_10525847
542 Ga0157372_10207698
543 Ga0157372_10467893
544 Ga0163163_10229792
545 Ga0163163_10356885
546 Ga0157380_10181075
547 Ga0157376_11172827
548 Ga0197907_10810437
549 Ga0206349_1199341
550 Ga0213876_10062720
551 Ga0224712_10006217
552 Ga0224712_10079499
553 Ga0207426_1016798
554 Ga0207656_10024131
555 Ga0207692_10165412
556 Ga0207699_10040269
557 Ga0207699_10232269
558 Ga0207643_10190024
559 Ga0207684_10005971
560 Ga0207684_10018316
561 Ga0207684_10035246
562 Ga0207707_10038990
563 Ga0207671_10000114
564 Ga0207693_10017758
565 Ga0207663_10021677
566 Ga0207660_10874549
567 Ga0207662_10459253
568 Ga0207649_10024073
569 Ga0207649_10344217
570 Ga0207652_10003534
571 Ga0207652_10035774
572 Ga0207646_10000372
573 Ga0207646_10006005
574 Ga0207694_10015553
575 Ga0207659_10598440
576 Ga0207687_10011871
577 Ga0207700_10070042
578 Ga0207700_10310943
579 Ga0207664_10031304
580 Ga0207690_10047185
581 Ga0207690_10085442
582 Ga0207690_10254547
583 Ga0207690_10574643
584 Ga0207690_10632275
585 Ga0207669_10143016
586 Ga0207704_10113212
587 Ga0207704_10486915
588 Ga0207661_10177199
589 Ga0207661_10230612
590 Ga0207661_10291398
591 Ga0207679_10195432
592 Ga0207651_10847078
593 Ga0207712_10504233
594 Ga0207703_10818932
595 Ga0207639_10194132
596 Ga0207678_10774261
597 Ga0207708_10022988
598 Ga0207641_10574324
599 Ga0207648_10040611
600 Ga0207648_10377662
601 Ga0207674_10000353
602 Ga0207674_10016429
603 Ga0207674_10418409
604 Ga0207675_100047246
605 Ga0207683_10597504
606 Ga0207698_10191045
607 Ga0207698_10244422
608 Ga0307408_100003870
609 Ga0307408_100174720
610 Ga0307408_100416982
611 Ga0307405_10027172
612 Ga0307405_10750365
613 Ga0307413_10026793
614 Ga0307413_10079740
615 Ga0307413_10304900
616 Ga0307410_10013874
617 Ga0307410_10123265
618 Ga0307410_10145439
619 Ga0307410_10246353
620 Ga0307406_10044199
621 Ga0307406_10097213
622 Ga0307406_10163518
623 Ga0307407_10007422
624 Ga0307407_10022349
625 Ga0307407_10376335
626 Ga0307412_10268580
627 Ga0307409_100060761
628 Ga0307409_100065774
629 Ga0307409_100093928
630 Ga0307409_100113313
631 Ga0307409_100157965
632 Ga0307409_100517048
633 Ga0307416_100006015
634 Ga0307416_100009359
635 Ga0307416_100240778
636 Ga0307416_100401347
637 Ga0307416_100796480
638 Ga0307416_101246854
639 Ga0307411_10227574
640 Ga0307411_10249758
641 Ga0307411_10278095
642 Ga0307411_10293621
643 Ga0307415_100009605
644 Ga0307415_100031480
645 Ga0307415_100037398
646 Ga0373948_0000239
647 Ga0373956_0000009
648 Ga0373931_0000014
649 Ga0373931_0026492
650 Ga0373927_0000054
651 Ga0373933_0002465
652 Ga0373933_0002659
653 Ga0373937_0220426
654 Ga0373937_0283632
655 Ga0316582_0366103
656 Ga0395899_0040952
657 Ga0395899_0103230
658 Ga0395900_0001398
659 Ga0395900_0142924
660 Ga0395898_0003414
661 Ga0395898_0010225
662 Ga0395898_0013730
663 Ga0395898_0014595
664 Ga0395905_0008605
665 Ga0395905_0025828
666 Ga0436364_1209149
667 Ga0395901_0000739
668 Ga0395901_0001816
669 Ga0395901_0010631
670 Ga0395901_0035478
671 Ga0395901_0677041
672 Ga0395901_0853591
673 Ga0400484_23481
674 Ga0436365_1130064
675 Ga0436362_0745944
676 Ga0451853_1781216
677 Ga0439441_021206
678 Ga0439455_0005361
679 Ga0450920_026394
680 Ga0439458_0033703
681 Ga0439464_0022275
682 Ga0439460_0031613
683 Ga0439440_0009708
684 Ga0466972_0003882
685 Ga0466965_0054976
686 Ga0466966_0029437
687 Ga0466966_0057856
688 Ga0466966_0211439
689 Ga0466961_0012429
690 Ga0466963_0030652
691 Ga0466963_0043752
692 Ga0466963_0124023
693 Ga0466963_0261795
694 Ga0466963_0585482
695 Ga0466968_0004549
696 Ga0466970_0224499
697 Ga0466957_0037296
698 Ga0466960_0018362
699 Ga0466960_0034464
700 Ga0466959_0332631
701 Ga0466959_0387214
702 Ga0466958_0034368
703 Ga0466967_0030337
704 Ga0466967_0119130
705 Ga0466967_0408810
706 Ga0466967_0613305
707 Ga0466967_0697941
708 Ga0466967_0947452
709 Ga0495590_0086709
710 Ga0495629_0134023
711 Ga0495641_0079013
712 Ga0495582_0341385
713 Ga0495620_0162415
714 Ga0495630_0010982
715 Ga0495640_0129276
716 Ga0495587_0311755
717 Ga0495656_0438819
718 Ga0495658_0003644
719 Ga0495674_0059445
720 Ga0496100_0147461
721 Ga0496100_0211189
722 Ga0496101_0303442
723 Ga0496102_0374462
724 Ga0496102_0429874
725 Ga0496104_0032830
726 Ga0496104_0209848
727 Ga0496105_0240235
728 Ga0496107_0544542
729 Ga0496108_0000087
730 Ga0496108_0007206
731 Ga0496108_0083297
732 Ga0496108_0088659
733 Ga0496109_0023541
734 Ga0496109_0053066
735 Ga0496109_0080760
736 Ga0496109_0359693
737 Ga0496110_0001268
738 Ga0496110_0060289
739 Ga0496111_0052266
740 Ga0496111_0063357
741 Ga0496111_0138891
742 Ga0496112_0003576
743 Ga0496112_0009272
744 Ga0496112_0254313
745 Ga0496112_0254825
746 Ga0496113_0004264
747 Ga0496113_0206989
748 Ga0496113_0227512
749 Ga0496114_0004757
750 Ga0496115_0089879
751 Ga0496115_0209214
752 Ga0501031_0324426
753 Ga0501032_0164373
754 Ga0501032_0387668
755 Ga0501034_0553378
756 Ga0501036_0240236
757 Ga0501036_0271957
758 Ga0501038_0113007
759 Ga0501038_0346938
760 Ga0501039_0042697
761 Ga0501039_0066657
762 Ga0501039_0415946
763 Ga0501040_0019133
764 Ga0501040_0072969
765 Ga0501041_0019929
766 Ga0501041_0155828
767 Ga0501041_0358389
768 Ga0501042_0062453
769 Ga0501042_0091193
770 Ga0501042_0110970
771 Ga0501042_0468115
772 Ga0501043_0217307
773 Ga0501046_0044657
774 Ga0501046_0523663
775 Ga0501046_0564726
776 Ga0501047_0000195
777 Ga0501048_0113086
778 Ga0501048_0145818
779 Ga0501067_0215578
780 Ga0501067_0326151
781 Ga0501068_0036243
782 Ga0501068_0480851
783 Ga0501069_0062699
784 Ga0501070_0380272
785 Ga0501071_0015244
786 Ga0501071_0076398
787 Ga0501071_0101523
788 Ga0501071_0132255
789 Ga0501071_0294689
790 Ga0501071_0410997
791 Ga0501072_0052398
792 Ga0501072_0183070
793 Ga0501072_0930432
794 Ga0501073_0259728
795 Ga0501073_0265415
796 Ga0501075_0020095
797 Ga0501075_0040426
798 Ga0501075_0057109
799 Ga0501075_0195493
800 Ga0501075_0553789
801 Ga0501076_0008844
802 Ga0501076_0069778
803 Ga0501076_0092581
804 Ga0501076_0136208
805 Ga0501076_0143571
806 Ga0501076_0364920
807 Ga0501077_0050994
808 Ga0501079_0269099
809 Ga0501079_0336557
810 Ga0501080_0726262
811 Ga0501081_0243196
812 Ga0501081_0261628
813 Ga0501035_0785624
814 Ga0501044_0000762
815 Ga0501045_0007639
816 nmdc:mga05p37_1003891_c1
817 nmdc:mga05p37_114437_c1
818 nmdc:mga05p37_758437_c1
819 nmdc:mga08y16_170081_c1
820 nmdc:mga08y16_47470_c1
821 nmdc:mga0n895_224752_c1
822 nmdc:mga0n895_28950_c1
823 nmdc:mga0n895_7361_c1
824 nmdc:mga0rr50_4403_c1
825 nmdc:mga0a205_2441_c1
826 nmdc:mga0a205_30538_c1
827 nmdc:mga0a205_626499_c1
828 Ga0495612_0000093
829 Ga0495612_0135274
830 Ga0495595_0211817
831 Ga0495619_0139986
832 Ga0500637_0009489
833 Ga0501084_0088187
834 Ga0501084_0091002
835 Ga0501084_0164299
836 Ga0501084_0216942
837 Ga0501084_0219883
838 Ga0590071_004540
839 Ga0590071_060183
840 Ga0590077_003396
841 Ga0501082_0100183
842 Ga0501082_0167919
843 Ga0501082_0257297
844 Ga0530510_0004930
845 Ga0530510_0049354
846 Ga0530510_0062624
847 Ga0530510_0132202
848 Ga0530510_0427283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

9

200

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

15

208

0.94

PF08659

KR

KR domain

9

177

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i1j-assembly1.cif.gz_A structure of a putative short chain dehydrogenase from pseudomonas syringae 0.9095 2 199
2cfc-assembly1.cif.gz_D structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases 0.9057 2 198
2rh4-assembly1.cif.gz_B actinorhodin ketoreductase, actkr, with nadph and inhibitor emodin 0.8957 2 162
3gvc-assembly2.cif.gz_D-3 crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis 0.895 2 198
3tox-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase in complex with nad(p) from sinorhizobium meliloti 1021 0.8929 2 198
ID Description Score Start End Superfamily
af_D3ZT59_8_174_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9128 55 163 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9095 2 153 3.40.50.720
2cfcD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9057 2 198 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8986 2 198 3.40.50.720
af_C6TI76_34_304_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8976 2 166 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W6CIC7-F1-model_v4 Short-chain dehydrogenase 0.9861 1 203 GO:0016491
AF-D7BG86-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9835 2 202 GO:0016491
AF-A0A352Y0G9-F1-model_v4 Short-chain dehydrogenase 0.9818 82 203 GO:0004757
GO:0005737
GO:0006729
AF-A0A537WB13-F1-model_v4 SDR family oxidoreductase 0.9775 1 192 GO:0016491
AF-A0A6J4R8K5-F1-model_v4 Oxidoreductase SCO1803 0.9732 2 204 GO:0016491

Map