F440820

General Info

Members Datasets Scaffolds Average Seq Length
424 258 848 150

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0057621|Ga0466959_0057621_1540_2082
Length 173
Sequence MSDQEVAAFLDEQRVVVCATNGVRGWPHLMPLWYVVREGELWAWTYAKSQKARNLERDPRATLQIEAGERYDELRGVMIEAETSIHRAVEVVAELGSEIYARYTGHSGVEEMIAAQAPKRIALQFVPRRVASWDHRKLAGAGGQQAGPVLRDRGDGAGGHRGDRDHHDSRRRG

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
170 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
171 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
172 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
235 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
258 2891554331 Microbispora sp. CL1-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.24
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 6.37
Rhizosphere 88.92
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0057621 3300045049 Bacteria 2832
2 JGI24737J22298_10158353 3300001990 Bacteria 668
3 JGI25407J50210_10020791 3300003373 Bacteria 1706
4 JGI25407J50210_10081636 3300003373 Bacteria 803
5 JGI25407J50210_10135154 3300003373 Bacteria 607
6 Ga0070676_10334187 3300005328 Bacteria 1037
7 Ga0070683_101000139 3300005329 Bacteria 803
8 Ga0070690_100159648 3300005330 Bacteria 1544
9 Ga0070670_101102940 3300005331 Bacteria 724
10 Ga0068869_100412785 3300005334 Bacteria 1112
11 Ga0070680_100696533 3300005336 Unclassified 874
12 Ga0068868_100196985 3300005338 Bacteria 1677
13 Ga0070689_100922409 3300005340 Bacteria 773
14 Ga0070691_10124891 3300005341 Bacteria 1299
15 Ga0070691_10189559 3300005341 Bacteria 1075
16 Ga0070687_100126916 3300005343 Bacteria 1467
17 Ga0070692_10225088 3300005345 Bacteria 1111
18 Ga0070668_100033882 3300005347 Bacteria 3891
19 Ga0070668_100120162 3300005347 Bacteria 2099
20 Ga0070669_100894584 3300005353 Bacteria 758
21 Ga0070675_100311631 3300005354 Bacteria 1389
22 Ga0070671_101087713 3300005355 Bacteria 702
23 Ga0070673_100433165 3300005364 Bacteria 1180
24 Ga0070659_100804672 3300005366 Bacteria 817
25 Ga0070659_101218392 3300005366 Bacteria 666
26 Ga0070709_10379904 3300005434 Bacteria 1050
27 Ga0070709_10797123 3300005434 Bacteria 741
28 Ga0070714_100026485 3300005435 Bacteria 4793
29 Ga0070714_100084278 3300005435 Bacteria 2773
30 Ga0070714_100166306 3300005435 Bacteria 1999
31 Ga0070714_100256592 3300005435 Bacteria 1618
32 Ga0070713_100127469 3300005436 Bacteria 2241
33 Ga0070713_100396384 3300005436 Bacteria 1288
34 Ga0070713_100630859 3300005436 Bacteria 1019
35 Ga0070713_101321661 3300005436 Bacteria 699
36 Ga0070710_10007797 3300005437 Bacteria 5196
37 Ga0070710_10132661 3300005437 Bacteria 1520
38 Ga0070710_10656258 3300005437 Bacteria 736
39 Ga0070711_100020526 3300005439 Bacteria 4259
40 Ga0070705_100699279 3300005440 Bacteria 796
41 Ga0070705_100880188 3300005440 Bacteria 719
42 Ga0070700_100027152 3300005441 Bacteria 3391
43 Ga0070694_100139263 3300005444 Bacteria 1761
44 Ga0070694_100752619 3300005444 Bacteria 796
45 Ga0070694_101312189 3300005444 Bacteria 609
46 Ga0070662_100141165 3300005457 Bacteria 1867
47 Ga0070681_10136467 3300005458 Bacteria 2384
48 Ga0068867_101039588 3300005459 Bacteria 745
49 Ga0070684_100430068 3300005535 Bacteria 1219
50 Ga0068853_101286390 3300005539 Bacteria 707
51 Ga0070686_100216534 3300005544 Bacteria 1382
52 Ga0070695_100409327 3300005545 Bacteria 1030
53 Ga0070696_100090751 3300005546 Bacteria 2174
54 Ga0070693_100079070 3300005547 Bacteria 1956
55 Ga0070704_101108215 3300005549 Bacteria 719
56 Ga0068855_100812563 3300005563 Bacteria 993
57 Ga0070664_100506777 3300005564 Bacteria 1113
58 Ga0068857_100495448 3300005577 Bacteria 1146
59 Ga0068854_100021015 3300005578 Bacteria 4424
60 Ga0068854_100335251 3300005578 Bacteria 1234
61 Ga0068856_101009672 3300005614 Unclassified 850
62 Ga0070702_100440285 3300005615 Bacteria 943
63 Ga0068852_100055973 3300005616 Bacteria 3406
64 Ga0068859_100488515 3300005617 Bacteria 1327
65 Ga0068864_100375368 3300005618 Bacteria 1346
66 Ga0068866_10190274 3300005718 Bacteria 1219
67 Ga0068861_100049335 3300005719 Bacteria 3186
68 Ga0068861_100107808 3300005719 Bacteria 2227
69 Ga0068861_100340435 3300005719 Bacteria 1312
70 Ga0068851_10113165 3300005834 Bacteria 1451
71 Ga0068870_10505111 3300005840 Bacteria 806
72 Ga0068862_100271682 3300005844 Bacteria 1550
73 Ga0081455_10012662 3300005937 Bacteria 8396
74 Ga0081538_10000309 3300005981 Bacteria 56250
75 Ga0081538_10001142 3300005981 Bacteria 28050
76 Ga0081538_10003524 3300005981 Bacteria 14738
77 Ga0081538_10003732 3300005981 Bacteria 14263
78 Ga0081538_10005892 3300005981 Bacteria 10920
79 Ga0081538_10020525 3300005981 Bacteria 4856
80 Ga0081538_10305817 3300005981 Bacteria 583
81 Ga0070717_10022840 3300006028 Bacteria 4949
82 Ga0070717_10365634 3300006028 Bacteria 1292
83 Ga0070717_10556887 3300006028 Bacteria 1038
84 Ga0070717_11306146 3300006028 Bacteria 659
85 Ga0070715_10917485 3300006163 Unclassified 540
86 Ga0070716_101266149 3300006173 Bacteria 595
87 Ga0070712_100031252 3300006175 Bacteria 3585
88 Ga0070712_100056442 3300006175 Bacteria 2755
89 Ga0070712_100239109 3300006175 Bacteria 1446
90 Ga0097621_100542240 3300006237 Bacteria 1058
91 Ga0075428_100259299 3300006844 Bacteria 1872
92 Ga0075428_100364707 3300006844 Bacteria 1549
93 Ga0075428_100395319 3300006844 Bacteria 1482
94 Ga0075428_100459759 3300006844 Bacteria 1363
95 Ga0075428_100996803 3300006844 Bacteria 887
96 Ga0075430_101036741 3300006846 Bacteria 676
97 Ga0075431_100223271 3300006847 Bacteria 1921
98 Ga0075431_100281006 3300006847 Unclassified 1685
99 Ga0075433_10438861 3300006852 Bacteria 1151
100 Ga0075433_10877234 3300006852 Bacteria 783
101 Ga0075434_100009630 3300006871 Bacteria 9025
102 Ga0075434_100390278 3300006871 Bacteria 1413
103 Ga0068865_100368232 3300006881 Bacteria 1169
104 Ga0097620_100488498 3300006931 Bacteria 1327
105 Ga0075435_100493187 3300007076 Bacteria 1059
106 Ga0105251_10019187 3300009011 Bacteria 3618
107 Ga0111539_10049992 3300009094 Bacteria 4982
108 Ga0111539_10144878 3300009094 Bacteria 2781
109 Ga0111539_10561749 3300009094 Bacteria 1329
110 Ga0111539_10906869 3300009094 Bacteria 1025
111 Ga0111539_11446022 3300009094 Bacteria 797
112 Ga0105245_10035740 3300009098 Bacteria 4410
113 Ga0105245_10102997 3300009098 Bacteria 2644
114 Ga0114129_10002139 3300009147 Bacteria 27232
115 Ga0114129_10137121 3300009147 Bacteria 3357
116 Ga0114129_10198434 3300009147 Bacteria 2720
117 Ga0114129_10974369 3300009147 Bacteria 1070
118 Ga0114129_12026225 3300009147 Bacteria 696
119 Ga0105243_10236896 3300009148 Bacteria 1622
120 Ga0105243_10507720 3300009148 Bacteria 1144
121 Ga0105248_10088080 3300009177 Bacteria 3494
122 Ga0105237_10220548 3300009545 Bacteria 1896
123 Ga0105238_11187674 3300009551 Bacteria 787
124 Ga0105238_11685691 3300009551 Bacteria 665
125 Ga0105249_10065186 3300009553 Bacteria 3350
126 Ga0105249_10197272 3300009553 Bacteria 1968
127 Ga0105249_11889681 3300009553 Bacteria 670
128 Ga0105239_10142915 3300010375 Bacteria 2668
129 Ga0105239_10306009 3300010375 Bacteria 1790
130 Ga0105239_10367102 3300010375 Bacteria 1626
131 Ga0105246_10643452 3300011119 Bacteria 922
132 Ga0105246_11152462 3300011119 Bacteria 711
133 Ga0157371_10271809 3300013102 Bacteria 1223
134 Ga0157371_10376276 3300013102 Bacteria 1036
135 Ga0157369_10339627 3300013105 Bacteria 1560
136 Ga0157374_12100208 3300013296 Bacteria 592
137 Ga0157378_10952973 3300013297 Bacteria 891
138 Ga0163162_10131992 3300013306 Bacteria 2606
139 Ga0163162_11196378 3300013306 Bacteria 862
140 Ga0157375_10316660 3300013308 Bacteria 1724
141 Ga0157380_10837087 3300014326 Bacteria 941
142 Ga0157380_12174966 3300014326 Bacteria 618
143 Ga0157377_10170128 3300014745 Bacteria 1362
144 Ga0157379_10156182 3300014968 Bacteria 2058
145 Ga0157379_10767854 3300014968 Bacteria 908
146 Ga0157376_10342936 3300014969 Bacteria 1427
147 Ga0206353_10238951 3300020082 Bacteria 2042
148 Ga0213874_10000352 3300021377 Bacteria 9097
149 Ga0213874_10252222 3300021377 Unclassified 651
150 Ga0213876_10063732 3300021384 Bacteria 1946
151 Ga0213876_10233344 3300021384 Bacteria 978
152 Ga0207656_10039584 3300025321 Bacteria 1994
153 Ga0207692_10099929 3300025898 Bacteria 1590
154 Ga0207642_10118959 3300025899 Bacteria 1359
155 Ga0207710_10347511 3300025900 Bacteria 755
156 Ga0207688_10587570 3300025901 Bacteria 701
157 Ga0207647_10238829 3300025904 Bacteria 1044
158 Ga0207685_10429485 3300025905 Unclassified 683
159 Ga0207699_10064771 3300025906 Bacteria 2213
160 Ga0207643_10085510 3300025908 Bacteria 1832
161 Ga0207671_10086751 3300025914 Bacteria 2353
162 Ga0207693_10002068 3300025915 Bacteria 17538
163 Ga0207693_10030892 3300025915 Bacteria 4231
164 Ga0207693_10098888 3300025915 Bacteria 2288
165 Ga0207663_10038674 3300025916 Bacteria 2886
166 Ga0207663_11447683 3300025916 Bacteria 553
167 Ga0207662_10096330 3300025918 Bacteria 1828
168 Ga0207657_10124602 3300025919 Bacteria 2117
169 Ga0207652_10053041 3300025921 Bacteria 3482
170 Ga0207659_10149807 3300025926 Bacteria 1821
171 Ga0207687_10013332 3300025927 Bacteria 5366
172 Ga0207700_10100174 3300025928 Bacteria 2309
173 Ga0207700_10166159 3300025928 Bacteria 1836
174 Ga0207700_10373509 3300025928 Bacteria 1245
175 Ga0207700_11375888 3300025928 Unclassified 628
176 Ga0207664_10006095 3300025929 Bacteria 8256
177 Ga0207664_10085861 3300025929 Bacteria 2569
178 Ga0207664_10320928 3300025929 Bacteria 1367
179 Ga0207690_10264620 3300025932 Bacteria 1333
180 Ga0207706_10073562 3300025933 Bacteria 3005
181 Ga0207686_11187591 3300025934 Bacteria 624
182 Ga0207709_10073084 3300025935 Bacteria 2184
183 Ga0207670_10525089 3300025936 Bacteria 964
184 Ga0207704_10134425 3300025938 Bacteria 1719
185 Ga0207665_10173393 3300025939 Bacteria 1559
186 Ga0207665_10501583 3300025939 Bacteria 938
187 Ga0207689_10111715 3300025942 Bacteria 2246
188 Ga0207661_10718602 3300025944 Bacteria 919
189 Ga0207667_10565840 3300025949 Bacteria 1148
190 Ga0207651_10440350 3300025960 Bacteria 1116
191 Ga0207712_10057280 3300025961 Bacteria 2749
192 Ga0207712_10084804 3300025961 Bacteria 2316
193 Ga0207712_10420501 3300025961 Bacteria 1127
194 Ga0207668_10046924 3300025972 Bacteria 2955
195 Ga0207668_10127251 3300025972 Bacteria 1939
196 Ga0207640_10953519 3300025981 Bacteria 752
197 Ga0207658_10915520 3300025986 Bacteria 799
198 Ga0207677_10080015 3300026023 Bacteria 2339
199 Ga0207678_10596841 3300026067 Bacteria 968
200 Ga0207708_10038863 3300026075 Bacteria 3626
201 Ga0207708_10261167 3300026075 Bacteria 1398
202 Ga0207708_10684265 3300026075 Bacteria 876
203 Ga0207648_10458280 3300026089 Bacteria 1162
204 Ga0207676_10147113 3300026095 Bacteria 2024
205 Ga0207674_10423415 3300026116 Bacteria 1287
206 Ga0207675_100005131 3300026118 Bacteria 12609
207 Ga0207675_100055266 3300026118 Bacteria 3704
208 Ga0207675_100157976 3300026118 Bacteria 2161
209 Ga0207675_100484956 3300026118 Bacteria 1229
210 Ga0207683_10141525 3300026121 Bacteria 2168
211 Ga0207698_11525022 3300026142 Bacteria 684
212 Ga0207428_10054445 3300027907 Bacteria 3187
213 Ga0207428_10442006 3300027907 Bacteria 949
214 Ga0268265_10120507 3300028380 Bacteria 2161
215 Ga0268265_10149358 3300028380 Bacteria 1969
216 Ga0268265_10199615 3300028380 Bacteria 1734
217 Ga0307408_100139413 3300031548 Bacteria 1902
218 Ga0307405_10028170 3300031731 Bacteria 3268
219 Ga0307405_10121795 3300031731 Bacteria 1786
220 Ga0307413_10041160 3300031824 Bacteria 2703
221 Ga0307413_10171539 3300031824 Bacteria 1536
222 Ga0307410_10006725 3300031852 Bacteria 6232
223 Ga0307410_10011019 3300031852 Bacteria 5152
224 Ga0307406_10074142 3300031901 Bacteria 2240
225 Ga0307406_10245169 3300031901 Bacteria 1346
226 Ga0307406_10251642 3300031901 Bacteria 1331
227 Ga0307406_10569638 3300031901 Bacteria 929
228 Ga0307407_10009870 3300031903 Bacteria 4469
229 Ga0307407_10016957 3300031903 Bacteria 3641
230 Ga0307407_10227393 3300031903 Bacteria 1265
231 Ga0307407_10729435 3300031903 Bacteria 749
232 Ga0307412_10105084 3300031911 Bacteria 2005
233 Ga0307409_100004588 3300031995 Bacteria 7789
234 Ga0307409_100063108 3300031995 Bacteria 2904
235 Ga0307416_100080363 3300032002 Bacteria 2751
236 Ga0307416_100093758 3300032002 Bacteria 2587
237 Ga0307416_100428948 3300032002 Bacteria 1369
238 Ga0307414_10170027 3300032004 Bacteria 1741
239 Ga0307411_10060995 3300032005 Bacteria 2508
240 Ga0307411_10228329 3300032005 Bacteria 1449
241 Ga0307415_100009268 3300032126 Bacteria 5505
242 Ga0307415_100022085 3300032126 Bacteria 3922
243 Ga0307415_100135383 3300032126 Bacteria 1873
244 Ga0307415_100492301 3300032126 Bacteria 1070
245 Ga0373951_0108717 3300035091 Bacteria 744
246 Ga0373952_0032360 3300035092 Bacteria 1168
247 Ga0373953_0031483 3300035117 Bacteria 2063
248 Ga0373954_0131122 3300035118 Bacteria 1220
249 Ga0373956_0146808 3300035119 Bacteria 1109
250 Ga0373960_0018541 3300035121 Bacteria 1816
251 Ga0373955_0346123 3300035172 Bacteria 900
252 Ga0373961_0012578 3300035241 Bacteria 2121
253 Ga0373931_0677161 3300035691 Bacteria 680
254 Ga0373933_0039548 3300035724 Bacteria 2775
255 Ga0373937_0012035 3300036401 Bacteria 7592
256 Ga0395900_1247791 3300037418 Bacteria 658
257 Ga0395900_1332884 3300037418 Bacteria 631
258 Ga0395898_0219255 3300037466 Bacteria 1815
259 Ga0395905_0593741 3300037471 Bacteria 1009
260 Ga0436364_0184682 3300037853 Bacteria 1300
261 Ga0436364_1248656 3300037853 Bacteria 2046
262 Ga0436364_1527321 3300037853 Bacteria 670
263 Ga0395901_0130456 3300038443 Bacteria 2641
264 Ga0395901_0447895 3300038443 Bacteria 1321
265 Ga0395901_1083164 3300038443 Bacteria 773
266 Ga0436365_0510487 3300039437 Unclassified 661
267 Ga0436365_0649016 3300039437 Bacteria 1248
268 Ga0436365_1384707 3300039437 Bacteria 5771
269 Ga0436365_1760401 3300039437 Bacteria 6761
270 Ga0436365_1867002 3300039437 Bacteria 3148
271 Ga0436361_1130987 3300039447 Bacteria 1261
272 Ga0436363_0156008 3300039450 Unclassified 811
273 Ga0436363_0378239 3300039450 Bacteria 21783
274 Ga0436363_1379133 3300039450 Unclassified 696
275 Ga0436363_1606844 3300039450 Bacteria 740
276 Ga0436362_0806726 3300039453 Bacteria 2997
277 Ga0436362_1213202 3300039453 Bacteria 3581
278 Ga0436362_1276988 3300039453 Bacteria 7615
279 Ga0451798_0792776 3300041458 Bacteria 542
280 Ga0439463_028027 3300042016 Bacteria 1419
281 Ga0450888_019262 3300042126 Bacteria 859
282 Ga0439440_0041498 3300042993 Bacteria 1123
283 Ga0466969_0070909 3300044656 Bacteria 1676
284 Ga0466965_0683342 3300044683 Bacteria 588
285 Ga0466966_0122561 3300044684 Bacteria 1596
286 Ga0466966_0497573 3300044684 Bacteria 733
287 Ga0466961_0633094 3300044693 Bacteria 642
288 Ga0466963_0040189 3300044694 Bacteria 3066
289 Ga0466963_0216289 3300044694 Bacteria 1341
290 Ga0466963_0219382 3300044694 Bacteria 1332
291 Ga0466964_0398727 3300044706 Bacteria 718
292 Ga0466968_0061273 3300044735 Bacteria 1623
293 Ga0466968_0084011 3300044735 Bacteria 1403
294 Ga0466957_0263641 3300044842 Bacteria 1149
295 Ga0466957_0399667 3300044842 Bacteria 940
296 Ga0466960_0002306 3300044901 Bacteria 7160
297 Ga0466960_0061694 3300044901 Bacteria 1841
298 Ga0466960_0103758 3300044901 Bacteria 1468
299 Ga0466959_0029279 3300045049 Bacteria 4080
300 Ga0466959_0437052 3300045049 Bacteria 888
301 Ga0466958_0002068 3300045836 Bacteria 9925
302 Ga0466958_0085144 3300045836 Bacteria 1950
303 Ga0466958_0172954 3300045836 Bacteria 1368
304 Ga0466958_0381652 3300045836 Bacteria 909
305 Ga0466967_0106587 3300045976 Bacteria 2569
306 Ga0466967_0188593 3300045976 Bacteria 1948
307 Ga0466967_0306312 3300045976 Bacteria 1529
308 Ga0466967_0372268 3300045976 Bacteria 1386
309 Ga0466967_0546318 3300045976 Bacteria 1140
310 Ga0466967_0590442 3300045976 Bacteria 1096
311 Ga0466967_1687852 3300045976 Unclassified 631
312 Ga0495592_0064882 3300046454 Bacteria 2675
313 Ga0495641_0405310 3300046461 Bacteria 619
314 Ga0495651_0002129 3300046462 Bacteria 15315
315 Ga0495582_0199021 3300046473 Bacteria 1144
316 Ga0495605_0092303 3300046474 Bacteria 1402
317 Ga0495664_0078364 3300046477 Bacteria 1979
318 Ga0495596_0393884 3300046500 Unclassified 540
319 Ga0495608_0001555 3300046511 Bacteria 16384
320 Ga0495618_0003152 3300046514 Bacteria 10359
321 Ga0495628_0172384 3300046516 Bacteria 1640
322 Ga0495640_0046526 3300046533 Bacteria 3006
323 Ga0495587_0030697 3300046536 Bacteria 3259
324 Ga0495667_0001423 3300046559 Bacteria 15747
325 Ga0495668_0278263 3300046616 Bacteria 917
326 Ga0495635_0038295 3300046663 Bacteria 3320
327 Ga0495657_0005541 3300046675 Bacteria 9969
328 Ga0495599_0228588 3300046678 Bacteria 1136
329 Ga0495646_0021539 3300046680 Bacteria 4071
330 Ga0495589_0129430 3300046794 Bacteria 1213
331 Ga0495600_0008914 3300046809 Bacteria 6180
332 Ga0495604_0003214 3300047317 Bacteria 13057
333 Ga0495674_0007842 3300047319 Bacteria 10196
334 Ga0495680_0092032 3300047322 Bacteria 2272
335 Ga0495677_0235490 3300047445 Bacteria 715
336 Ga0495684_0042885 3300047471 Bacteria 3464
337 Ga0495684_0447782 3300047471 Bacteria 898
338 Ga0495602_0104847 3300048088 Bacteria 2312
339 Ga0496101_0762178 3300048904 Bacteria 763
340 Ga0496102_0099677 3300048905 Bacteria 2697
341 Ga0496102_0157935 3300048905 Bacteria 2132
342 Ga0496103_0146545 3300048906 Bacteria 1511
343 Ga0496103_0466044 3300048906 Bacteria 810
344 Ga0496104_0086348 3300048907 Bacteria 2995
345 Ga0496104_0573827 3300048907 Bacteria 1038
346 Ga0496105_0563004 3300048908 Bacteria 888
347 Ga0496105_0885745 3300048908 Bacteria 674
348 Ga0496107_0160213 3300048910 Bacteria 1667
349 Ga0496108_0058710 3300048911 Bacteria 3234
350 Ga0496109_0271782 3300048912 Bacteria 1597
351 Ga0496109_0851932 3300048912 Bacteria 849
352 Ga0496110_0195283 3300048913 Bacteria 1838
353 Ga0496111_0049967 3300048914 Bacteria 3015
354 Ga0496111_0281819 3300048914 Bacteria 1233
355 Ga0496112_0221427 3300048915 Bacteria 1848
356 Ga0496112_0430739 3300048915 Bacteria 1257
357 Ga0496112_0431311 3300048915 Bacteria 1256
358 Ga0496112_0782310 3300048915 Bacteria 879
359 Ga0496112_0791321 3300048915 Unclassified 873
360 Ga0496112_1032176 3300048915 Bacteria 742
361 Ga0496113_0647893 3300048916 Bacteria 845
362 Ga0496114_0117995 3300048917 Bacteria 2279
363 Ga0496115_0062477 3300048918 Bacteria 3004
364 Ga0496115_0395262 3300048918 Bacteria 1122
365 Ga0501038_0355726 3300049574 Bacteria 1140
366 Ga0501039_0207369 3300049575 Bacteria 1541
367 Ga0501040_0274230 3300049576 Bacteria 1204
368 Ga0501041_0143499 3300049577 Bacteria 1489
369 Ga0501046_0705485 3300049580 Unclassified 711
370 Ga0501067_0858748 3300049583 Bacteria 512
371 Ga0501071_0201241 3300049587 Bacteria 1496
372 Ga0501072_0044109 3300049588 Bacteria 3507
373 Ga0501072_0128309 3300049588 Bacteria 2021
374 Ga0501072_0659768 3300049588 Bacteria 823
375 Ga0501076_0142024 3300049592 Bacteria 1951
376 Ga0501076_0393094 3300049592 Bacteria 1140
377 Ga0501077_0074500 3300049593 Bacteria 2150
378 Ga0501077_0744390 3300049593 Bacteria 630
379 Ga0501209_070508 3300049656 Bacteria 993
380 Ga0501217_220903 3300049661 Bacteria 599
381 Ga0501079_1214425 3300049741 Bacteria 594
382 Ga0501081_0101215 3300049743 Bacteria 2037
383 Ga0501045_0014049 3300049824 Bacteria 5667
384 Ga0501045_0140920 3300049824 Bacteria 1793
385 nmdc:mga03n38_415958_c1 3300050490 Bacteria 742
386 nmdc:mga00v17_908992_c1 3300050491 Bacteria 557
387 nmdc:mga05p37_11090_c1 3300050507 Bacteria 10708
388 nmdc:mga05p37_136950_c1 3300050507 Bacteria 3001
389 nmdc:mga05p37_1697103_c1 3300050507 Bacteria 616
390 nmdc:mga05p37_242714_c1 3300050507 Bacteria 2165
391 nmdc:mga05p37_800199_c1 3300050507 Unclassified 1031
392 nmdc:mga05p37_96462_c1 3300050507 Bacteria 3643
393 nmdc:mga0qj67_1107573_c1 3300050509 Bacteria 618
394 nmdc:mga0qj67_34003_c1 3300050509 Bacteria 3980
395 nmdc:mga0qj67_859960_c1 3300050509 Bacteria 716
396 nmdc:mga06r32_29619_c1 3300050510 Bacteria 5133
397 nmdc:mga06r32_374887_c1 3300050510 Bacteria 1406
398 nmdc:mga06r32_955442_c1 3300050510 Bacteria 811
399 nmdc:mga08y16_124173_c1 3300050511 Bacteria 2686
400 nmdc:mga08y16_2154895_c1 3300050511 Bacteria 504
401 nmdc:mga08y16_21915_c1 3300050511 Bacteria 6744
402 nmdc:mga08y16_300996_c1 3300050511 Bacteria 1653
403 nmdc:mga08y16_888321_c1 3300050511 Bacteria 878
404 nmdc:mga08y16_957490_c1 3300050511 Bacteria 839
405 nmdc:mga0n895_240119_c1 3300050512 Bacteria 1838
406 nmdc:mga0n895_40907_c1 3300050512 Bacteria 4504
407 nmdc:mga0rr50_178812_c1 3300050513 Bacteria 1733
408 nmdc:mga0rr50_341336_c1 3300050513 Bacteria 1258
409 nmdc:mga08x19_30870_c1 3300050514 Bacteria 3368
410 nmdc:mga0a205_109747_c1 3300050515 Bacteria 2657
411 nmdc:mga0a205_16210_c1 3300050515 Bacteria 6978
412 nmdc:mga0a205_59034_c1 3300050515 Bacteria 3706
413 Ga0495601_0047268 3300053077 Bacteria 2709
414 Ga0495655_0082984 3300053083 Bacteria 920
415 Ga0495655_0097788 3300053083 Bacteria 865
416 Ga0495595_0022064 3300053084 Bacteria 2790
417 Ga0495619_0095468 3300053085 Bacteria 2017
418 Ga0501084_0251334 3300054114 Bacteria 1492
419 Ga0501082_0055827 3300060353 Bacteria 3402
420 Ga0501082_0641764 3300060353 Bacteria 929
421 Ga0466962_0004945 3300061719 Bacteria 6410
422 Ga0530510_0014564 3300061734 Bacteria 5548
423 2891397849 2891395885 Bacteria 9251614
424 2891559750 2891554331 Bacteria 8812224
425 Ga0466959_0057621
426 JGI24737J22298_10158353
427 JGI25407J50210_10020791
428 JGI25407J50210_10081636
429 JGI25407J50210_10135154
430 Ga0070676_10334187
431 Ga0070683_101000139
432 Ga0070690_100159648
433 Ga0070670_101102940
434 Ga0068869_100412785
435 Ga0070680_100696533
436 Ga0068868_100196985
437 Ga0070689_100922409
438 Ga0070691_10124891
439 Ga0070691_10189559
440 Ga0070687_100126916
441 Ga0070692_10225088
442 Ga0070668_100033882
443 Ga0070668_100120162
444 Ga0070669_100894584
445 Ga0070675_100311631
446 Ga0070671_101087713
447 Ga0070673_100433165
448 Ga0070659_100804672
449 Ga0070659_101218392
450 Ga0070709_10379904
451 Ga0070709_10797123
452 Ga0070714_100026485
453 Ga0070714_100084278
454 Ga0070714_100166306
455 Ga0070714_100256592
456 Ga0070713_100127469
457 Ga0070713_100396384
458 Ga0070713_100630859
459 Ga0070713_101321661
460 Ga0070710_10007797
461 Ga0070710_10132661
462 Ga0070710_10656258
463 Ga0070711_100020526
464 Ga0070705_100699279
465 Ga0070705_100880188
466 Ga0070700_100027152
467 Ga0070694_100139263
468 Ga0070694_100752619
469 Ga0070694_101312189
470 Ga0070662_100141165
471 Ga0070681_10136467
472 Ga0068867_101039588
473 Ga0070684_100430068
474 Ga0068853_101286390
475 Ga0070686_100216534
476 Ga0070695_100409327
477 Ga0070696_100090751
478 Ga0070693_100079070
479 Ga0070704_101108215
480 Ga0068855_100812563
481 Ga0070664_100506777
482 Ga0068857_100495448
483 Ga0068854_100021015
484 Ga0068854_100335251
485 Ga0068856_101009672
486 Ga0070702_100440285
487 Ga0068852_100055973
488 Ga0068859_100488515
489 Ga0068864_100375368
490 Ga0068866_10190274
491 Ga0068861_100049335
492 Ga0068861_100107808
493 Ga0068861_100340435
494 Ga0068851_10113165
495 Ga0068870_10505111
496 Ga0068862_100271682
497 Ga0081455_10012662
498 Ga0081538_10000309
499 Ga0081538_10001142
500 Ga0081538_10003524
501 Ga0081538_10003732
502 Ga0081538_10005892
503 Ga0081538_10020525
504 Ga0081538_10305817
505 Ga0070717_10022840
506 Ga0070717_10365634
507 Ga0070717_10556887
508 Ga0070717_11306146
509 Ga0070715_10917485
510 Ga0070716_101266149
511 Ga0070712_100031252
512 Ga0070712_100056442
513 Ga0070712_100239109
514 Ga0097621_100542240
515 Ga0075428_100259299
516 Ga0075428_100364707
517 Ga0075428_100395319
518 Ga0075428_100459759
519 Ga0075428_100996803
520 Ga0075430_101036741
521 Ga0075431_100223271
522 Ga0075431_100281006
523 Ga0075433_10438861
524 Ga0075433_10877234
525 Ga0075434_100009630
526 Ga0075434_100390278
527 Ga0068865_100368232
528 Ga0097620_100488498
529 Ga0075435_100493187
530 Ga0105251_10019187
531 Ga0111539_10049992
532 Ga0111539_10144878
533 Ga0111539_10561749
534 Ga0111539_10906869
535 Ga0111539_11446022
536 Ga0105245_10035740
537 Ga0105245_10102997
538 Ga0114129_10002139
539 Ga0114129_10137121
540 Ga0114129_10198434
541 Ga0114129_10974369
542 Ga0114129_12026225
543 Ga0105243_10236896
544 Ga0105243_10507720
545 Ga0105248_10088080
546 Ga0105237_10220548
547 Ga0105238_11187674
548 Ga0105238_11685691
549 Ga0105249_10065186
550 Ga0105249_10197272
551 Ga0105249_11889681
552 Ga0105239_10142915
553 Ga0105239_10306009
554 Ga0105239_10367102
555 Ga0105246_10643452
556 Ga0105246_11152462
557 Ga0157371_10271809
558 Ga0157371_10376276
559 Ga0157369_10339627
560 Ga0157374_12100208
561 Ga0157378_10952973
562 Ga0163162_10131992
563 Ga0163162_11196378
564 Ga0157375_10316660
565 Ga0157380_10837087
566 Ga0157380_12174966
567 Ga0157377_10170128
568 Ga0157379_10156182
569 Ga0157379_10767854
570 Ga0157376_10342936
571 Ga0206353_10238951
572 Ga0213874_10000352
573 Ga0213874_10252222
574 Ga0213876_10063732
575 Ga0213876_10233344
576 Ga0207656_10039584
577 Ga0207692_10099929
578 Ga0207642_10118959
579 Ga0207710_10347511
580 Ga0207688_10587570
581 Ga0207647_10238829
582 Ga0207685_10429485
583 Ga0207699_10064771
584 Ga0207643_10085510
585 Ga0207671_10086751
586 Ga0207693_10002068
587 Ga0207693_10030892
588 Ga0207693_10098888
589 Ga0207663_10038674
590 Ga0207663_11447683
591 Ga0207662_10096330
592 Ga0207657_10124602
593 Ga0207652_10053041
594 Ga0207659_10149807
595 Ga0207687_10013332
596 Ga0207700_10100174
597 Ga0207700_10166159
598 Ga0207700_10373509
599 Ga0207700_11375888
600 Ga0207664_10006095
601 Ga0207664_10085861
602 Ga0207664_10320928
603 Ga0207690_10264620
604 Ga0207706_10073562
605 Ga0207686_11187591
606 Ga0207709_10073084
607 Ga0207670_10525089
608 Ga0207704_10134425
609 Ga0207665_10173393
610 Ga0207665_10501583
611 Ga0207689_10111715
612 Ga0207661_10718602
613 Ga0207667_10565840
614 Ga0207651_10440350
615 Ga0207712_10057280
616 Ga0207712_10084804
617 Ga0207712_10420501
618 Ga0207668_10046924
619 Ga0207668_10127251
620 Ga0207640_10953519
621 Ga0207658_10915520
622 Ga0207677_10080015
623 Ga0207678_10596841
624 Ga0207708_10038863
625 Ga0207708_10261167
626 Ga0207708_10684265
627 Ga0207648_10458280
628 Ga0207676_10147113
629 Ga0207674_10423415
630 Ga0207675_100005131
631 Ga0207675_100055266
632 Ga0207675_100157976
633 Ga0207675_100484956
634 Ga0207683_10141525
635 Ga0207698_11525022
636 Ga0207428_10054445
637 Ga0207428_10442006
638 Ga0268265_10120507
639 Ga0268265_10149358
640 Ga0268265_10199615
641 Ga0307408_100139413
642 Ga0307405_10028170
643 Ga0307405_10121795
644 Ga0307413_10041160
645 Ga0307413_10171539
646 Ga0307410_10006725
647 Ga0307410_10011019
648 Ga0307406_10074142
649 Ga0307406_10245169
650 Ga0307406_10251642
651 Ga0307406_10569638
652 Ga0307407_10009870
653 Ga0307407_10016957
654 Ga0307407_10227393
655 Ga0307407_10729435
656 Ga0307412_10105084
657 Ga0307409_100004588
658 Ga0307409_100063108
659 Ga0307416_100080363
660 Ga0307416_100093758
661 Ga0307416_100428948
662 Ga0307414_10170027
663 Ga0307411_10060995
664 Ga0307411_10228329
665 Ga0307415_100009268
666 Ga0307415_100022085
667 Ga0307415_100135383
668 Ga0307415_100492301
669 Ga0373951_0108717
670 Ga0373952_0032360
671 Ga0373953_0031483
672 Ga0373954_0131122
673 Ga0373956_0146808
674 Ga0373960_0018541
675 Ga0373955_0346123
676 Ga0373961_0012578
677 Ga0373931_0677161
678 Ga0373933_0039548
679 Ga0373937_0012035
680 Ga0395900_1247791
681 Ga0395900_1332884
682 Ga0395898_0219255
683 Ga0395905_0593741
684 Ga0436364_0184682
685 Ga0436364_1248656
686 Ga0436364_1527321
687 Ga0395901_0130456
688 Ga0395901_0447895
689 Ga0395901_1083164
690 Ga0436365_0510487
691 Ga0436365_0649016
692 Ga0436365_1384707
693 Ga0436365_1760401
694 Ga0436365_1867002
695 Ga0436361_1130987
696 Ga0436363_0156008
697 Ga0436363_0378239
698 Ga0436363_1379133
699 Ga0436363_1606844
700 Ga0436362_0806726
701 Ga0436362_1213202
702 Ga0436362_1276988
703 Ga0451798_0792776
704 Ga0439463_028027
705 Ga0450888_019262
706 Ga0439440_0041498
707 Ga0466969_0070909
708 Ga0466965_0683342
709 Ga0466966_0122561
710 Ga0466966_0497573
711 Ga0466961_0633094
712 Ga0466963_0040189
713 Ga0466963_0216289
714 Ga0466963_0219382
715 Ga0466964_0398727
716 Ga0466968_0061273
717 Ga0466968_0084011
718 Ga0466957_0263641
719 Ga0466957_0399667
720 Ga0466960_0002306
721 Ga0466960_0061694
722 Ga0466960_0103758
723 Ga0466959_0029279
724 Ga0466959_0437052
725 Ga0466958_0002068
726 Ga0466958_0085144
727 Ga0466958_0172954
728 Ga0466958_0381652
729 Ga0466967_0106587
730 Ga0466967_0188593
731 Ga0466967_0306312
732 Ga0466967_0372268
733 Ga0466967_0546318
734 Ga0466967_0590442
735 Ga0466967_1687852
736 Ga0495592_0064882
737 Ga0495641_0405310
738 Ga0495651_0002129
739 Ga0495582_0199021
740 Ga0495605_0092303
741 Ga0495664_0078364
742 Ga0495596_0393884
743 Ga0495608_0001555
744 Ga0495618_0003152
745 Ga0495628_0172384
746 Ga0495640_0046526
747 Ga0495587_0030697
748 Ga0495667_0001423
749 Ga0495668_0278263
750 Ga0495635_0038295
751 Ga0495657_0005541
752 Ga0495599_0228588
753 Ga0495646_0021539
754 Ga0495589_0129430
755 Ga0495600_0008914
756 Ga0495604_0003214
757 Ga0495674_0007842
758 Ga0495680_0092032
759 Ga0495677_0235490
760 Ga0495684_0042885
761 Ga0495684_0447782
762 Ga0495602_0104847
763 Ga0496101_0762178
764 Ga0496102_0099677
765 Ga0496102_0157935
766 Ga0496103_0146545
767 Ga0496103_0466044
768 Ga0496104_0086348
769 Ga0496104_0573827
770 Ga0496105_0563004
771 Ga0496105_0885745
772 Ga0496107_0160213
773 Ga0496108_0058710
774 Ga0496109_0271782
775 Ga0496109_0851932
776 Ga0496110_0195283
777 Ga0496111_0049967
778 Ga0496111_0281819
779 Ga0496112_0221427
780 Ga0496112_0430739
781 Ga0496112_0431311
782 Ga0496112_0782310
783 Ga0496112_0791321
784 Ga0496112_1032176
785 Ga0496113_0647893
786 Ga0496114_0117995
787 Ga0496115_0062477
788 Ga0496115_0395262
789 Ga0501038_0355726
790 Ga0501039_0207369
791 Ga0501040_0274230
792 Ga0501041_0143499
793 Ga0501046_0705485
794 Ga0501067_0858748
795 Ga0501071_0201241
796 Ga0501072_0044109
797 Ga0501072_0128309
798 Ga0501072_0659768
799 Ga0501076_0142024
800 Ga0501076_0393094
801 Ga0501077_0074500
802 Ga0501077_0744390
803 Ga0501209_070508
804 Ga0501217_220903
805 Ga0501079_1214425
806 Ga0501081_0101215
807 Ga0501045_0014049
808 Ga0501045_0140920
809 nmdc:mga03n38_415958_c1
810 nmdc:mga00v17_908992_c1
811 nmdc:mga05p37_11090_c1
812 nmdc:mga05p37_136950_c1
813 nmdc:mga05p37_1697103_c1
814 nmdc:mga05p37_242714_c1
815 nmdc:mga05p37_800199_c1
816 nmdc:mga05p37_96462_c1
817 nmdc:mga0qj67_1107573_c1
818 nmdc:mga0qj67_34003_c1
819 nmdc:mga0qj67_859960_c1
820 nmdc:mga06r32_29619_c1
821 nmdc:mga06r32_374887_c1
822 nmdc:mga06r32_955442_c1
823 nmdc:mga08y16_124173_c1
824 nmdc:mga08y16_2154895_c1
825 nmdc:mga08y16_21915_c1
826 nmdc:mga08y16_300996_c1
827 nmdc:mga08y16_888321_c1
828 nmdc:mga08y16_957490_c1
829 nmdc:mga0n895_240119_c1
830 nmdc:mga0n895_40907_c1
831 nmdc:mga0rr50_178812_c1
832 nmdc:mga0rr50_341336_c1
833 nmdc:mga08x19_30870_c1
834 nmdc:mga0a205_109747_c1
835 nmdc:mga0a205_16210_c1
836 nmdc:mga0a205_59034_c1
837 Ga0495601_0047268
838 Ga0495655_0082984
839 Ga0495655_0097788
840 Ga0495595_0022064
841 Ga0495619_0095468
842 Ga0501084_0251334
843 Ga0501082_0055827
844 Ga0501082_0641764
845 Ga0466962_0004945
846 Ga0530510_0014564
847 2891397849
848 2891559750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

2

90

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.8778 1 157
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8601 16 146
3u5w-assembly1.cif.gz_A-2 crystal structure of a probable fad-binding, putative uncharacterized protein from brucella melitensis, apo form 0.8543 8 149
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.8463 1 157
3u0i-assembly1.cif.gz_A-2 crystal structure of a probable fad-binding, putative uncharacterized protein from brucella melitensis 0.8265 8 149
ID Description Score Start End Superfamily
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8909 9 157 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8909 9 157 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.878 9 157 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.868 9 157 2.30.110.10
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.857 16 146 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7W1RAB4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.976 1 157 GO:0005829
GO:0016627
GO:0070967
AF-A0A7W1RAB4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9699 1 157 GO:0005829
GO:0016627
GO:0070967
AF-A0A838PEA9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9664 38 157 GO:0005829
GO:0016627
GO:0070967
AF-A0A6J7E5Q9-F1-model_v4 Unannotated protein 0.9627 1 157 GO:0005829
GO:0016627
GO:0070967
AF-A0A838PEA9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9579 38 157 GO:0005829
GO:0016627
GO:0070967

Map