F440817
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 424 | 199 | 848 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300044706|Ga0466964_0487409|Ga0466964_0487409_193_582 |
| Length | 129 |
| Sequence | VSDIGIDELAARLGDVALVDVRTPHEFDGTHGKPCDPRQGHIPGARNLDIYRLMELSPDDVRTELGLEPGTEVVAYCHSGSRSAIAAQVLRSLGYDARNYVGSWHEWSRHDDLPVELDHRPGSPSEPRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 45 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 48 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 49 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 75 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 76 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 77 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 78 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 83 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 84 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 90 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 91 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 92 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 93 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 94 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 95 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 96 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 97 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 98 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 100 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 101 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 104 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 105 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 111 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 112 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 113 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 114 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 115 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 120 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 121 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 122 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 123 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 124 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 199 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.88 |
| Metatranscriptomes | 2.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.14 |
| Rhizosphere | 87.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466964_0487409 | 3300044706 | Bacteria | 660 |
| 2 | Ga0070658_10001993 | 3300005327 | Bacteria | 17160 |
| 3 | Ga0070658_10179838 | 3300005327 | Unclassified | 1780 |
| 4 | Ga0070658_11046134 | 3300005327 | Unclassified | 710 |
| 5 | Ga0070683_100005332 | 3300005329 | Bacteria | 10719 |
| 6 | Ga0070683_100238384 | 3300005329 | Unclassified | 1730 |
| 7 | Ga0070683_100546014 | 3300005329 | Bacteria | 1108 |
| 8 | Ga0070680_100036017 | 3300005336 | Bacteria | 3997 |
| 9 | Ga0070680_100067983 | 3300005336 | Bacteria | 2924 |
| 10 | Ga0070680_100526644 | 3300005336 | Bacteria | 1012 |
| 11 | Ga0070660_100002630 | 3300005339 | Bacteria | 12341 |
| 12 | Ga0070660_100016421 | 3300005339 | Bacteria | 5372 |
| 13 | Ga0070660_100896586 | 3300005339 | Bacteria | 748 |
| 14 | Ga0070661_100029707 | 3300005344 | Bacteria | 3946 |
| 15 | Ga0070661_101174538 | 3300005344 | Unclassified | 641 |
| 16 | Ga0070671_100086541 | 3300005355 | Bacteria | 2622 |
| 17 | Ga0070659_100322082 | 3300005366 | Unclassified | 1292 |
| 18 | Ga0070714_100149547 | 3300005435 | Bacteria | 2103 |
| 19 | Ga0070714_100462789 | 3300005435 | Bacteria | 1206 |
| 20 | Ga0070713_100252913 | 3300005436 | Bacteria | 1608 |
| 21 | Ga0070710_10326066 | 3300005437 | Archaea | 1009 |
| 22 | Ga0070711_100065751 | 3300005439 | Archaea | 2537 |
| 23 | Ga0070705_101041923 | 3300005440 | Bacteria | 666 |
| 24 | Ga0070663_100339733 | 3300005455 | Bacteria | 1213 |
| 25 | Ga0070681_10004166 | 3300005458 | Bacteria | 13683 |
| 26 | Ga0070681_10029404 | 3300005458 | Bacteria | 5518 |
| 27 | Ga0070681_10044882 | 3300005458 | Unclassified | 4424 |
| 28 | Ga0070681_10613148 | 3300005458 | Bacteria | 1003 |
| 29 | Ga0070706_100165916 | 3300005467 | Unclassified | 2062 |
| 30 | Ga0070707_100336004 | 3300005468 | Bacteria | 1468 |
| 31 | Ga0070707_101274316 | 3300005468 | Bacteria | 701 |
| 32 | Ga0070679_100037248 | 3300005530 | Bacteria | 4830 |
| 33 | Ga0070679_100059039 | 3300005530 | Bacteria | 3823 |
| 34 | Ga0070679_100121229 | 3300005530 | Bacteria | 2600 |
| 35 | Ga0070679_100574307 | 3300005530 | Unclassified | 1071 |
| 36 | Ga0070679_100628536 | 3300005530 | Unclassified | 1017 |
| 37 | Ga0070679_101479726 | 3300005530 | Bacteria | 626 |
| 38 | Ga0070684_100000815 | 3300005535 | Bacteria | 21767 |
| 39 | Ga0070697_100584039 | 3300005536 | Bacteria | 981 |
| 40 | Ga0070665_100673876 | 3300005548 | Bacteria | 1047 |
| 41 | Ga0068855_100015550 | 3300005563 | Bacteria | 9160 |
| 42 | Ga0068855_100126308 | 3300005563 | Unclassified | 2924 |
| 43 | Ga0068855_100229303 | 3300005563 | Bacteria | 2080 |
| 44 | Ga0068855_101616055 | 3300005563 | Unclassified | 663 |
| 45 | Ga0070664_100358204 | 3300005564 | Bacteria | 1328 |
| 46 | Ga0068857_100055902 | 3300005577 | Bacteria | 3502 |
| 47 | Ga0068852_100024941 | 3300005616 | Bacteria | 4838 |
| 48 | Ga0068852_100242582 | 3300005616 | Bacteria | 1723 |
| 49 | Ga0068851_10617211 | 3300005834 | Unclassified | 661 |
| 50 | Ga0070717_10097425 | 3300006028 | Unclassified | 2492 |
| 51 | Ga0070717_10860941 | 3300006028 | Bacteria | 825 |
| 52 | Ga0070712_100599788 | 3300006175 | Bacteria | 932 |
| 53 | Ga0070712_101002844 | 3300006175 | Bacteria | 723 |
| 54 | Ga0097621_100317314 | 3300006237 | Archaea | 1380 |
| 55 | Ga0068871_100159746 | 3300006358 | Unclassified | 1927 |
| 56 | Ga0068871_100598961 | 3300006358 | Unclassified | 1002 |
| 57 | Ga0068871_101850390 | 3300006358 | Bacteria | 573 |
| 58 | Ga0099795_10475261 | 3300007788 | Unclassified | 579 |
| 59 | Ga0105240_10216494 | 3300009093 | Bacteria | 2234 |
| 60 | Ga0105240_10679708 | 3300009093 | Unclassified | 1126 |
| 61 | Ga0105245_10126404 | 3300009098 | Bacteria | 2394 |
| 62 | Ga0105245_10474071 | 3300009098 | Bacteria | 1264 |
| 63 | Ga0105245_12443073 | 3300009098 | Bacteria | 576 |
| 64 | Ga0105243_10953495 | 3300009148 | Bacteria | 857 |
| 65 | Ga0105241_10393624 | 3300009174 | Unclassified | 1214 |
| 66 | Ga0105241_11736850 | 3300009174 | Bacteria | 607 |
| 67 | Ga0105242_10113885 | 3300009176 | Bacteria | 2310 |
| 68 | Ga0105248_10454955 | 3300009177 | Unclassified | 1443 |
| 69 | Ga0157370_10003987 | 3300013104 | Bacteria | 17162 |
| 70 | Ga0157369_10448539 | 3300013105 | Bacteria | 1336 |
| 71 | Ga0157369_11138822 | 3300013105 | Bacteria | 797 |
| 72 | Ga0157378_10055927 | 3300013297 | Unclassified | 3515 |
| 73 | Ga0157377_10794482 | 3300014745 | Bacteria | 697 |
| 74 | Ga0157376_10158704 | 3300014969 | Unclassified | 2048 |
| 75 | Ga0157376_11767227 | 3300014969 | Bacteria | 654 |
| 76 | Ga0197907_10336061 | 3300020069 | Bacteria | 1235 |
| 77 | Ga0206356_10659644 | 3300020070 | Bacteria | 2307 |
| 78 | Ga0206356_10827110 | 3300020070 | Bacteria | 976 |
| 79 | Ga0206354_10141706 | 3300020081 | Bacteria | 3051 |
| 80 | Ga0206354_10670230 | 3300020081 | Bacteria | 1593 |
| 81 | Ga0206354_10903884 | 3300020081 | Unclassified | 775 |
| 82 | Ga0206353_10021557 | 3300020082 | Bacteria | 2259 |
| 83 | Ga0206353_10558951 | 3300020082 | Bacteria | 4516 |
| 84 | Ga0206353_11629934 | 3300020082 | Bacteria | 1600 |
| 85 | Ga0213876_10288073 | 3300021384 | Bacteria | 873 |
| 86 | Ga0213875_10053893 | 3300021388 | Bacteria | 1884 |
| 87 | Ga0207705_10045651 | 3300025909 | Bacteria | 3148 |
| 88 | Ga0207705_10123292 | 3300025909 | Unclassified | 1924 |
| 89 | Ga0207705_10769831 | 3300025909 | Bacteria | 748 |
| 90 | Ga0207684_10141428 | 3300025910 | Unclassified | 2069 |
| 91 | Ga0207707_10047556 | 3300025912 | Unclassified | 3736 |
| 92 | Ga0207707_10060777 | 3300025912 | Bacteria | 3287 |
| 93 | Ga0207707_10142359 | 3300025912 | Bacteria | 2096 |
| 94 | Ga0207707_10351905 | 3300025912 | Bacteria | 1269 |
| 95 | Ga0207707_10504303 | 3300025912 | Unclassified | 1032 |
| 96 | Ga0207693_10191068 | 3300025915 | Archaea | 1611 |
| 97 | Ga0207693_10544890 | 3300025915 | Bacteria | 905 |
| 98 | Ga0207663_10026845 | 3300025916 | Archaea | 3347 |
| 99 | Ga0207660_10226783 | 3300025917 | Bacteria | 1468 |
| 100 | Ga0207660_10783825 | 3300025917 | Bacteria | 778 |
| 101 | Ga0207660_10791677 | 3300025917 | Bacteria | 774 |
| 102 | Ga0207657_10000433 | 3300025919 | Bacteria | 44551 |
| 103 | Ga0207657_10008706 | 3300025919 | Bacteria | 10270 |
| 104 | Ga0207657_10266125 | 3300025919 | Unclassified | 1363 |
| 105 | Ga0207649_10327011 | 3300025920 | Bacteria | 1128 |
| 106 | Ga0207649_10433900 | 3300025920 | Unclassified | 989 |
| 107 | Ga0207652_10041073 | 3300025921 | Bacteria | 3930 |
| 108 | Ga0207652_10047923 | 3300025921 | Bacteria | 3651 |
| 109 | Ga0207652_10054547 | 3300025921 | Bacteria | 3436 |
| 110 | Ga0207687_10399653 | 3300025927 | Bacteria | 1130 |
| 111 | Ga0207687_10531936 | 3300025927 | Bacteria | 984 |
| 112 | Ga0207700_10275332 | 3300025928 | Bacteria | 1446 |
| 113 | Ga0207664_10126303 | 3300025929 | Bacteria | 2148 |
| 114 | Ga0207664_10301800 | 3300025929 | Bacteria | 1409 |
| 115 | Ga0207664_10619549 | 3300025929 | Unclassified | 972 |
| 116 | Ga0207644_10467746 | 3300025931 | Bacteria | 1037 |
| 117 | Ga0207686_11605135 | 3300025934 | Bacteria | 537 |
| 118 | Ga0207711_10490405 | 3300025941 | Unclassified | 1145 |
| 119 | Ga0207661_10015842 | 3300025944 | Bacteria | 5554 |
| 120 | Ga0207661_10230119 | 3300025944 | Unclassified | 1641 |
| 121 | Ga0207679_10513839 | 3300025945 | Bacteria | 1070 |
| 122 | Ga0207667_10020264 | 3300025949 | Bacteria | 7401 |
| 123 | Ga0207667_10066448 | 3300025949 | Bacteria | 3759 |
| 124 | Ga0207667_10180377 | 3300025949 | Unclassified | 2169 |
| 125 | Ga0207667_10399162 | 3300025949 | Unclassified | 1400 |
| 126 | Ga0207677_10530510 | 3300026023 | Bacteria | 1023 |
| 127 | Ga0207639_10149541 | 3300026041 | Bacteria | 1955 |
| 128 | Ga0207678_10338277 | 3300026067 | Bacteria | 1296 |
| 129 | Ga0207674_10122568 | 3300026116 | Bacteria | 2566 |
| 130 | Ga0207683_10111848 | 3300026121 | Bacteria | 2445 |
| 131 | Ga0207683_10399452 | 3300026121 | Bacteria | 1264 |
| 132 | Ga0207698_10229113 | 3300026142 | Bacteria | 1685 |
| 133 | Ga0268266_10519692 | 3300028379 | Bacteria | 1138 |
| 134 | Ga0265326_10060684 | 3300028558 | Bacteria | 1070 |
| 135 | Ga0265334_10008281 | 3300028573 | Bacteria | 4425 |
| 136 | Ga0265318_10161308 | 3300028577 | Unclassified | 822 |
| 137 | Ga0265318_10331224 | 3300028577 | Bacteria | 555 |
| 138 | Ga0265323_10037911 | 3300028653 | Bacteria | 1764 |
| 139 | Ga0265322_10008235 | 3300028654 | Bacteria | 3039 |
| 140 | Ga0265338_10010875 | 3300028800 | Bacteria | 10591 |
| 141 | Ga0265338_10156501 | 3300028800 | Bacteria | 1765 |
| 142 | Ga0265338_10206332 | 3300028800 | Bacteria | 1478 |
| 143 | Ga0265330_10053607 | 3300031235 | Bacteria | 1764 |
| 144 | Ga0265328_10146675 | 3300031239 | Bacteria | 887 |
| 145 | Ga0265325_10022041 | 3300031241 | Bacteria | 3492 |
| 146 | Ga0265340_10033955 | 3300031247 | Bacteria | 2538 |
| 147 | Ga0265327_10013001 | 3300031251 | Bacteria | 5565 |
| 148 | Ga0265327_10042145 | 3300031251 | Bacteria | 2453 |
| 149 | Ga0265327_10051563 | 3300031251 | Bacteria | 2147 |
| 150 | Ga0265316_10014974 | 3300031344 | Bacteria | 6801 |
| 151 | Ga0265313_10009255 | 3300031595 | Bacteria | 6415 |
| 152 | Ga0265313_10143677 | 3300031595 | Unclassified | 1025 |
| 153 | Ga0265314_10086227 | 3300031711 | Bacteria | 2056 |
| 154 | Ga0265342_10258411 | 3300031712 | Bacteria | 927 |
| 155 | Ga0373926_0111808 | 3300035083 | Bacteria | 1026 |
| 156 | Ga0373923_0151737 | 3300035111 | Archaea | 1053 |
| 157 | Ga0373936_0029613 | 3300035113 | Bacteria | 2156 |
| 158 | Ga0373954_0271353 | 3300035118 | Archaea | 836 |
| 159 | Ga0373956_0194726 | 3300035119 | Archaea | 960 |
| 160 | Ga0373957_0109395 | 3300035120 | Archaea | 1112 |
| 161 | Ga0373943_0000914 | 3300035170 | Bacteria | 12991 |
| 162 | Ga0373943_0111656 | 3300035170 | Bacteria | 1442 |
| 163 | Ga0373946_0027921 | 3300035171 | Bacteria | 2235 |
| 164 | Ga0373946_0044908 | 3300035171 | Unclassified | 1826 |
| 165 | Ga0373955_0061219 | 3300035172 | Archaea | 2078 |
| 166 | Ga0373955_0825796 | 3300035172 | Bacteria | 570 |
| 167 | Ga0373935_0180143 | 3300035692 | Bacteria | 1451 |
| 168 | Ga0373927_0163425 | 3300035695 | Bacteria | 1459 |
| 169 | Ga0373947_0009787 | 3300035725 | Bacteria | 5503 |
| 170 | Ga0373947_0046110 | 3300035725 | Bacteria | 2609 |
| 171 | Ga0373937_0066338 | 3300036401 | Archaea | 3323 |
| 172 | Ga0373925_0001868 | 3300037068 | Bacteria | 17520 |
| 173 | Ga0395899_0075798 | 3300037312 | Bacteria | 2456 |
| 174 | Ga0395899_0078348 | 3300037312 | Bacteria | 2409 |
| 175 | Ga0395899_0143636 | 3300037312 | Bacteria | 1696 |
| 176 | Ga0395899_0203373 | 3300037312 | Unclassified | 1379 |
| 177 | Ga0395899_0321087 | 3300037312 | Bacteria | 1043 |
| 178 | Ga0395900_0044872 | 3300037418 | Bacteria | 4553 |
| 179 | Ga0395900_0057973 | 3300037418 | Bacteria | 3987 |
| 180 | Ga0395900_0109585 | 3300037418 | Bacteria | 2837 |
| 181 | Ga0395900_0181972 | 3300037418 | Bacteria | 2135 |
| 182 | Ga0395900_0388358 | 3300037418 | Bacteria | 1362 |
| 183 | Ga0395900_0763897 | 3300037418 | Unclassified | 896 |
| 184 | Ga0395900_0948872 | 3300037418 | Bacteria | 782 |
| 185 | Ga0395898_0004806 | 3300037466 | Bacteria | 14705 |
| 186 | Ga0395898_0045053 | 3300037466 | Bacteria | 4337 |
| 187 | Ga0395898_0164070 | 3300037466 | Bacteria | 2125 |
| 188 | Ga0395898_0178555 | 3300037466 | Bacteria | 2029 |
| 189 | Ga0395898_0179250 | 3300037466 | Bacteria | 2025 |
| 190 | Ga0395898_0754909 | 3300037466 | Unclassified | 914 |
| 191 | Ga0395905_0018204 | 3300037471 | Bacteria | 6668 |
| 192 | Ga0395905_0331176 | 3300037471 | Bacteria | 1413 |
| 193 | Ga0395905_0802930 | 3300037471 | Bacteria | 844 |
| 194 | Ga0395905_1382874 | 3300037471 | Unclassified | 608 |
| 195 | Ga0395905_1552299 | 3300037471 | Bacteria | 567 |
| 196 | Ga0436364_0631366 | 3300037853 | Bacteria | 3397 |
| 197 | Ga0395901_0008961 | 3300038443 | Bacteria | 10131 |
| 198 | Ga0395901_0019375 | 3300038443 | Bacteria | 6956 |
| 199 | Ga0395901_0031971 | 3300038443 | Bacteria | 5429 |
| 200 | Ga0395901_0036309 | 3300038443 | Bacteria | 5093 |
| 201 | Ga0395901_0079861 | 3300038443 | Bacteria | 3415 |
| 202 | Ga0395901_0214746 | 3300038443 | Bacteria | 2012 |
| 203 | Ga0395901_0352580 | 3300038443 | Bacteria | 1518 |
| 204 | Ga0395901_0465112 | 3300038443 | Bacteria | 1292 |
| 205 | Ga0395901_0786260 | 3300038443 | Unclassified | 942 |
| 206 | Ga0395901_0845635 | 3300038443 | Bacteria | 901 |
| 207 | Ga0436365_0904554 | 3300039437 | Bacteria | 2360 |
| 208 | Ga0436363_0375092 | 3300039450 | Bacteria | 738 |
| 209 | Ga0436363_0767079 | 3300039450 | Bacteria | 504 |
| 210 | Ga0436363_0773531 | 3300039450 | Bacteria | 710 |
| 211 | Ga0436363_1291606 | 3300039450 | Bacteria | 999 |
| 212 | Ga0436362_1111496 | 3300039453 | Bacteria | 549 |
| 213 | Ga0451807_2221517 | 3300041486 | Unclassified | 563 |
| 214 | Ga0466969_0034158 | 3300044656 | Bacteria | 2578 |
| 215 | Ga0466969_0049965 | 3300044656 | Bacteria | 2062 |
| 216 | Ga0466972_0293416 | 3300044658 | Bacteria | 760 |
| 217 | Ga0466972_0539684 | 3300044658 | Bacteria | 550 |
| 218 | Ga0466965_0961934 | 3300044683 | Bacteria | 500 |
| 219 | Ga0466966_0065063 | 3300044684 | Bacteria | 2294 |
| 220 | Ga0466966_0067395 | 3300044684 | Bacteria | 2248 |
| 221 | Ga0466966_0073520 | 3300044684 | Bacteria | 2137 |
| 222 | Ga0466966_0196467 | 3300044684 | Bacteria | 1221 |
| 223 | Ga0466966_0247348 | 3300044684 | Bacteria | 1074 |
| 224 | Ga0466966_0466182 | 3300044684 | Bacteria | 759 |
| 225 | Ga0466961_0007487 | 3300044693 | Bacteria | 6944 |
| 226 | Ga0466961_0021554 | 3300044693 | Unclassified | 4146 |
| 227 | Ga0466961_0214602 | 3300044693 | Unclassified | 1187 |
| 228 | Ga0466961_0222521 | 3300044693 | Archaea | 1163 |
| 229 | Ga0466961_0782414 | 3300044693 | Unclassified | 570 |
| 230 | Ga0466963_0001406 | 3300044694 | Bacteria | 12923 |
| 231 | Ga0466963_0004880 | 3300044694 | Bacteria | 7820 |
| 232 | Ga0466963_0008124 | 3300044694 | Bacteria | 6283 |
| 233 | Ga0466963_0011551 | 3300044694 | Bacteria | 5377 |
| 234 | Ga0466963_0030343 | 3300044694 | Bacteria | 3488 |
| 235 | Ga0466963_0046696 | 3300044694 | Bacteria | 2856 |
| 236 | Ga0466963_0085604 | 3300044694 | Bacteria | 2140 |
| 237 | Ga0466963_0142871 | 3300044694 | Bacteria | 1659 |
| 238 | Ga0466963_0361622 | 3300044694 | Bacteria | 1022 |
| 239 | Ga0466963_0397472 | 3300044694 | Bacteria | 972 |
| 240 | Ga0466963_0608780 | 3300044694 | Bacteria | 771 |
| 241 | Ga0466964_0010777 | 3300044706 | Bacteria | 3451 |
| 242 | Ga0466964_0037562 | 3300044706 | Unclassified | 1945 |
| 243 | Ga0466964_0070430 | 3300044706 | Bacteria | 1477 |
| 244 | Ga0466964_0303978 | 3300044706 | Bacteria | 805 |
| 245 | Ga0466971_0000385 | 3300044719 | Bacteria | 16997 |
| 246 | Ga0466971_0211748 | 3300044719 | Bacteria | 917 |
| 247 | Ga0466968_0005447 | 3300044735 | Bacteria | 4762 |
| 248 | Ga0466968_0034739 | 3300044735 | Unclassified | 2106 |
| 249 | Ga0466968_0210149 | 3300044735 | Unclassified | 914 |
| 250 | Ga0466968_0565981 | 3300044735 | Bacteria | 571 |
| 251 | Ga0466970_0193745 | 3300044765 | Unclassified | 1130 |
| 252 | Ga0466970_0584261 | 3300044765 | Bacteria | 647 |
| 253 | Ga0466970_0618113 | 3300044765 | Unclassified | 629 |
| 254 | Ga0466957_0000164 | 3300044842 | Bacteria | 29396 |
| 255 | Ga0466957_0051848 | 3300044842 | Bacteria | 2497 |
| 256 | Ga0466957_0063795 | 3300044842 | Bacteria | 2265 |
| 257 | Ga0466957_0124061 | 3300044842 | Bacteria | 1649 |
| 258 | Ga0466959_0055649 | 3300045049 | Bacteria | 2887 |
| 259 | Ga0466959_0141733 | 3300045049 | Bacteria | 1698 |
| 260 | Ga0466959_0155194 | 3300045049 | Bacteria | 1612 |
| 261 | Ga0466959_0329129 | 3300045049 | Bacteria | 1043 |
| 262 | Ga0466959_0371287 | 3300045049 | Unclassified | 974 |
| 263 | Ga0466959_0394331 | 3300045049 | Bacteria | 941 |
| 264 | Ga0466958_0000218 | 3300045836 | Bacteria | 21642 |
| 265 | Ga0466958_0061182 | 3300045836 | Unclassified | 2293 |
| 266 | Ga0466958_0229050 | 3300045836 | Bacteria | 1186 |
| 267 | Ga0466967_0000911 | 3300045976 | Bacteria | 15866 |
| 268 | Ga0466967_0019021 | 3300045976 | Bacteria | 5512 |
| 269 | Ga0466967_0044711 | 3300045976 | Bacteria | 3843 |
| 270 | Ga0466967_0055382 | 3300045976 | Bacteria | 3493 |
| 271 | Ga0466967_0077111 | 3300045976 | Bacteria | 2999 |
| 272 | Ga0466967_0096213 | 3300045976 | Bacteria | 2700 |
| 273 | Ga0466967_0098651 | 3300045976 | Bacteria | 2667 |
| 274 | Ga0466967_0136075 | 3300045976 | Unclassified | 2285 |
| 275 | Ga0466967_0244763 | 3300045976 | Bacteria | 1711 |
| 276 | Ga0466967_0291346 | 3300045976 | Bacteria | 1568 |
| 277 | Ga0466967_0292547 | 3300045976 | Bacteria | 1565 |
| 278 | Ga0466967_0713560 | 3300045976 | Bacteria | 993 |
| 279 | Ga0466967_1318397 | 3300045976 | Unclassified | 719 |
| 280 | Ga0495592_0096135 | 3300046454 | Archaea | 2117 |
| 281 | Ga0495603_0073426 | 3300046455 | Bacteria | 2010 |
| 282 | Ga0495629_0019050 | 3300046459 | Bacteria | 4907 |
| 283 | Ga0495641_0001534 | 3300046461 | Bacteria | 19606 |
| 284 | Ga0495641_0125114 | 3300046461 | Bacteria | 1147 |
| 285 | Ga0495651_0302409 | 3300046462 | Bacteria | 1072 |
| 286 | Ga0495653_0012864 | 3300046463 | Bacteria | 6832 |
| 287 | Ga0495653_0019618 | 3300046463 | Bacteria | 5483 |
| 288 | Ga0495653_0787213 | 3300046463 | Bacteria | 572 |
| 289 | Ga0495582_0000391 | 3300046473 | Bacteria | 23825 |
| 290 | Ga0495582_0109783 | 3300046473 | Bacteria | 1549 |
| 291 | Ga0495639_0000300 | 3300046475 | Bacteria | 24087 |
| 292 | Ga0495662_0002922 | 3300046476 | Bacteria | 8634 |
| 293 | Ga0495664_0185020 | 3300046477 | Bacteria | 1263 |
| 294 | Ga0495664_0764581 | 3300046477 | Archaea | 569 |
| 295 | Ga0495608_0029738 | 3300046511 | Archaea | 3702 |
| 296 | Ga0495608_0349970 | 3300046511 | Bacteria | 909 |
| 297 | Ga0495618_0120106 | 3300046514 | Bacteria | 1683 |
| 298 | Ga0495628_0029192 | 3300046516 | Archaea | 4475 |
| 299 | Ga0495628_0134505 | 3300046516 | Bacteria | 1890 |
| 300 | Ga0495630_0016630 | 3300046517 | Bacteria | 5379 |
| 301 | Ga0495630_0028632 | 3300046517 | Bacteria | 4139 |
| 302 | Ga0495630_0056696 | 3300046517 | Archaea | 2935 |
| 303 | Ga0495630_1251632 | 3300046517 | Bacteria | 560 |
| 304 | Ga0495652_0022886 | 3300046529 | Bacteria | 5543 |
| 305 | Ga0495652_0162035 | 3300046529 | Bacteria | 1735 |
| 306 | Ga0495665_0010292 | 3300046531 | Bacteria | 5062 |
| 307 | Ga0495640_0188103 | 3300046533 | Bacteria | 1313 |
| 308 | Ga0495640_0376251 | 3300046533 | Archaea | 874 |
| 309 | Ga0495587_0014591 | 3300046536 | Bacteria | 4923 |
| 310 | Ga0495587_0612239 | 3300046536 | Bacteria | 599 |
| 311 | Ga0495645_0057474 | 3300046543 | Archaea | 2823 |
| 312 | Ga0495645_0647422 | 3300046543 | Bacteria | 646 |
| 313 | Ga0495667_0026512 | 3300046559 | Bacteria | 3906 |
| 314 | Ga0495667_0056596 | 3300046559 | Bacteria | 2578 |
| 315 | Ga0495667_0258593 | 3300046559 | Archaea | 1107 |
| 316 | Ga0495634_0056272 | 3300046642 | Bacteria | 2628 |
| 317 | Ga0495634_0312643 | 3300046642 | Bacteria | 947 |
| 318 | Ga0495635_0029741 | 3300046663 | Archaea | 3799 |
| 319 | Ga0495635_0137701 | 3300046663 | Bacteria | 1663 |
| 320 | Ga0495588_0331125 | 3300046674 | Archaea | 801 |
| 321 | Ga0495657_0014444 | 3300046675 | Bacteria | 5797 |
| 322 | Ga0495657_0494275 | 3300046675 | Bacteria | 714 |
| 323 | Ga0495623_0014076 | 3300046679 | Bacteria | 5182 |
| 324 | Ga0495623_0647380 | 3300046679 | Bacteria | 545 |
| 325 | Ga0495646_0085075 | 3300046680 | Bacteria | 1836 |
| 326 | Ga0495647_0003678 | 3300046681 | Bacteria | 4925 |
| 327 | Ga0495658_0000043 | 3300046683 | Bacteria | 62762 |
| 328 | Ga0495613_0017457 | 3300046689 | Bacteria | 5343 |
| 329 | Ga0495613_0084609 | 3300046689 | Archaea | 2303 |
| 330 | Ga0495624_0013568 | 3300046690 | Bacteria | 5554 |
| 331 | Ga0495600_0023043 | 3300046809 | Bacteria | 4004 |
| 332 | Ga0495600_0051578 | 3300046809 | Archaea | 2685 |
| 333 | Ga0495581_0025078 | 3300047315 | Bacteria | 3455 |
| 334 | Ga0495604_0097240 | 3300047317 | Archaea | 2171 |
| 335 | Ga0495604_0183211 | 3300047317 | Unclassified | 1463 |
| 336 | Ga0495674_0039396 | 3300047319 | Bacteria | 4236 |
| 337 | Ga0495674_0218685 | 3300047319 | Archaea | 1575 |
| 338 | Ga0495674_0263520 | 3300047319 | Bacteria | 1415 |
| 339 | Ga0495674_0928872 | 3300047319 | Bacteria | 670 |
| 340 | Ga0495676_0004468 | 3300047321 | Bacteria | 12780 |
| 341 | Ga0495680_0005179 | 3300047322 | Bacteria | 12301 |
| 342 | Ga0495680_0019721 | 3300047322 | Bacteria | 5688 |
| 343 | Ga0495680_0061370 | 3300047322 | Bacteria | 2892 |
| 344 | Ga0495675_0011425 | 3300047444 | Bacteria | 5574 |
| 345 | Ga0495684_0029794 | 3300047471 | Archaea | 4188 |
| 346 | Ga0495684_0084562 | 3300047471 | Bacteria | 2406 |
| 347 | Ga0495593_0031198 | 3300047673 | Bacteria | 2913 |
| 348 | Ga0495602_0060081 | 3300048088 | Archaea | 3314 |
| 349 | Ga0495602_0764659 | 3300048088 | Bacteria | 651 |
| 350 | Ga0495614_0029635 | 3300048089 | Bacteria | 2355 |
| 351 | Ga0496100_0024191 | 3300048903 | Bacteria | 3701 |
| 352 | Ga0496100_0129859 | 3300048903 | Bacteria | 1773 |
| 353 | Ga0496100_0522155 | 3300048903 | Unclassified | 916 |
| 354 | Ga0496101_0002400 | 3300048904 | Bacteria | 11492 |
| 355 | Ga0496101_0163295 | 3300048904 | Bacteria | 1709 |
| 356 | Ga0496101_0173351 | 3300048904 | Bacteria | 1658 |
| 357 | Ga0496102_0002153 | 3300048905 | Bacteria | 16911 |
| 358 | Ga0496102_0092175 | 3300048905 | Unclassified | 2806 |
| 359 | Ga0496102_1122937 | 3300048905 | Unclassified | 706 |
| 360 | Ga0496103_0053280 | 3300048906 | Bacteria | 2507 |
| 361 | Ga0496103_0287100 | 3300048906 | Bacteria | 1058 |
| 362 | Ga0496103_0449635 | 3300048906 | Bacteria | 826 |
| 363 | Ga0496103_0961169 | 3300048906 | Bacteria | 533 |
| 364 | Ga0496104_0021226 | 3300048907 | Bacteria | 5958 |
| 365 | Ga0496104_0032696 | 3300048907 | Bacteria | 4842 |
| 366 | Ga0496104_0366422 | 3300048907 | Bacteria | 1353 |
| 367 | Ga0496105_0025417 | 3300048908 | Unclassified | 4820 |
| 368 | Ga0496105_0113625 | 3300048908 | Bacteria | 2234 |
| 369 | Ga0496106_1324470 | 3300048909 | Unclassified | 558 |
| 370 | Ga0496107_0016405 | 3300048910 | Bacteria | 5200 |
| 371 | Ga0496107_0030865 | 3300048910 | Bacteria | 3821 |
| 372 | Ga0496108_0036138 | 3300048911 | Bacteria | 4109 |
| 373 | Ga0496108_0449894 | 3300048911 | Bacteria | 1125 |
| 374 | Ga0496109_0167736 | 3300048912 | Bacteria | 2059 |
| 375 | Ga0496111_0016305 | 3300048914 | Bacteria | 5117 |
| 376 | Ga0496111_0097531 | 3300048914 | Bacteria | 2158 |
| 377 | Ga0496112_0005680 | 3300048915 | Bacteria | 10837 |
| 378 | Ga0496112_0008449 | 3300048915 | Bacteria | 9225 |
| 379 | Ga0496112_0023132 | 3300048915 | Bacteria | 5932 |
| 380 | Ga0496112_0055143 | 3300048915 | Bacteria | 3907 |
| 381 | Ga0496112_0515656 | 3300048915 | Unclassified | 1130 |
| 382 | Ga0496113_0241217 | 3300048916 | Bacteria | 1442 |
| 383 | Ga0496113_0528147 | 3300048916 | Unclassified | 947 |
| 384 | Ga0496114_0001106 | 3300048917 | Bacteria | 20370 |
| 385 | Ga0496114_0025071 | 3300048917 | Bacteria | 4871 |
| 386 | Ga0496114_0081354 | 3300048917 | Unclassified | 2736 |
| 387 | Ga0496114_0095305 | 3300048917 | Bacteria | 2532 |
| 388 | Ga0496114_0176014 | 3300048917 | Bacteria | 1867 |
| 389 | Ga0496115_0001931 | 3300048918 | Bacteria | 14798 |
| 390 | Ga0496115_0398693 | 3300048918 | Unclassified | 1117 |
| 391 | Ga0496115_1274213 | 3300048918 | Unclassified | 549 |
| 392 | Ga0496115_1323519 | 3300048918 | Unclassified | 535 |
| 393 | Ga0501034_0320226 | 3300049571 | Bacteria | 1484 |
| 394 | Ga0501038_0549814 | 3300049574 | Unclassified | 878 |
| 395 | Ga0501046_0767253 | 3300049580 | Unclassified | 677 |
| 396 | Ga0501047_0072124 | 3300049581 | Bacteria | 3324 |
| 397 | Ga0501067_0003948 | 3300049583 | Bacteria | 8188 |
| 398 | Ga0501067_0095467 | 3300049583 | Bacteria | 1651 |
| 399 | Ga0501068_0040192 | 3300049584 | Bacteria | 2807 |
| 400 | Ga0501069_0002903 | 3300049585 | Bacteria | 8803 |
| 401 | Ga0501069_0332174 | 3300049585 | Bacteria | 894 |
| 402 | Ga0501070_0001360 | 3300049586 | Bacteria | 21918 |
| 403 | Ga0501070_0160821 | 3300049586 | Bacteria | 1851 |
| 404 | Ga0501070_0790440 | 3300049586 | Bacteria | 746 |
| 405 | Ga0501070_1087096 | 3300049586 | Bacteria | 617 |
| 406 | Ga0501074_0159266 | 3300049590 | Bacteria | 1612 |
| 407 | Ga0501074_0198033 | 3300049590 | Bacteria | 1432 |
| 408 | Ga0501074_0207144 | 3300049590 | Bacteria | 1397 |
| 409 | Ga0501079_0660589 | 3300049741 | Unclassified | 823 |
| 410 | Ga0501080_0814163 | 3300049742 | Bacteria | 818 |
| 411 | Ga0501044_0702379 | 3300049823 | Bacteria | 897 |
| 412 | Ga0501044_0969881 | 3300049823 | Bacteria | 723 |
| 413 | Ga0495601_0122903 | 3300053077 | Archaea | 1687 |
| 414 | Ga0495601_0244209 | 3300053077 | Bacteria | 1172 |
| 415 | Ga0495612_0097512 | 3300053078 | Archaea | 1249 |
| 416 | Ga0495595_0004802 | 3300053084 | Bacteria | 5442 |
| 417 | Ga0495595_0034181 | 3300053084 | Bacteria | 2298 |
| 418 | Ga0495619_0027191 | 3300053085 | Bacteria | 3684 |
| 419 | Ga0495619_0285917 | 3300053085 | Archaea | 1142 |
| 420 | Ga0466962_0000275 | 3300061719 | Bacteria | 21710 |
| 421 | Ga0466962_0042529 | 3300061719 | Bacteria | 2175 |
| 422 | Ga0466962_0187050 | 3300061719 | Bacteria | 1010 |
| 423 | Ga0466962_0330550 | 3300061719 | Bacteria | 757 |
| 424 | Ga0530510_0189992 | 3300061734 | Bacteria | 1524 |
| 425 | Ga0466964_0487409 | |||
| 426 | Ga0070658_10001993 | |||
| 427 | Ga0070658_10179838 | |||
| 428 | Ga0070658_11046134 | |||
| 429 | Ga0070683_100005332 | |||
| 430 | Ga0070683_100238384 | |||
| 431 | Ga0070683_100546014 | |||
| 432 | Ga0070680_100036017 | |||
| 433 | Ga0070680_100067983 | |||
| 434 | Ga0070680_100526644 | |||
| 435 | Ga0070660_100002630 | |||
| 436 | Ga0070660_100016421 | |||
| 437 | Ga0070660_100896586 | |||
| 438 | Ga0070661_100029707 | |||
| 439 | Ga0070661_101174538 | |||
| 440 | Ga0070671_100086541 | |||
| 441 | Ga0070659_100322082 | |||
| 442 | Ga0070714_100149547 | |||
| 443 | Ga0070714_100462789 | |||
| 444 | Ga0070713_100252913 | |||
| 445 | Ga0070710_10326066 | |||
| 446 | Ga0070711_100065751 | |||
| 447 | Ga0070705_101041923 | |||
| 448 | Ga0070663_100339733 | |||
| 449 | Ga0070681_10004166 | |||
| 450 | Ga0070681_10029404 | |||
| 451 | Ga0070681_10044882 | |||
| 452 | Ga0070681_10613148 | |||
| 453 | Ga0070706_100165916 | |||
| 454 | Ga0070707_100336004 | |||
| 455 | Ga0070707_101274316 | |||
| 456 | Ga0070679_100037248 | |||
| 457 | Ga0070679_100059039 | |||
| 458 | Ga0070679_100121229 | |||
| 459 | Ga0070679_100574307 | |||
| 460 | Ga0070679_100628536 | |||
| 461 | Ga0070679_101479726 | |||
| 462 | Ga0070684_100000815 | |||
| 463 | Ga0070697_100584039 | |||
| 464 | Ga0070665_100673876 | |||
| 465 | Ga0068855_100015550 | |||
| 466 | Ga0068855_100126308 | |||
| 467 | Ga0068855_100229303 | |||
| 468 | Ga0068855_101616055 | |||
| 469 | Ga0070664_100358204 | |||
| 470 | Ga0068857_100055902 | |||
| 471 | Ga0068852_100024941 | |||
| 472 | Ga0068852_100242582 | |||
| 473 | Ga0068851_10617211 | |||
| 474 | Ga0070717_10097425 | |||
| 475 | Ga0070717_10860941 | |||
| 476 | Ga0070712_100599788 | |||
| 477 | Ga0070712_101002844 | |||
| 478 | Ga0097621_100317314 | |||
| 479 | Ga0068871_100159746 | |||
| 480 | Ga0068871_100598961 | |||
| 481 | Ga0068871_101850390 | |||
| 482 | Ga0099795_10475261 | |||
| 483 | Ga0105240_10216494 | |||
| 484 | Ga0105240_10679708 | |||
| 485 | Ga0105245_10126404 | |||
| 486 | Ga0105245_10474071 | |||
| 487 | Ga0105245_12443073 | |||
| 488 | Ga0105243_10953495 | |||
| 489 | Ga0105241_10393624 | |||
| 490 | Ga0105241_11736850 | |||
| 491 | Ga0105242_10113885 | |||
| 492 | Ga0105248_10454955 | |||
| 493 | Ga0157370_10003987 | |||
| 494 | Ga0157369_10448539 | |||
| 495 | Ga0157369_11138822 | |||
| 496 | Ga0157378_10055927 | |||
| 497 | Ga0157377_10794482 | |||
| 498 | Ga0157376_10158704 | |||
| 499 | Ga0157376_11767227 | |||
| 500 | Ga0197907_10336061 | |||
| 501 | Ga0206356_10659644 | |||
| 502 | Ga0206356_10827110 | |||
| 503 | Ga0206354_10141706 | |||
| 504 | Ga0206354_10670230 | |||
| 505 | Ga0206354_10903884 | |||
| 506 | Ga0206353_10021557 | |||
| 507 | Ga0206353_10558951 | |||
| 508 | Ga0206353_11629934 | |||
| 509 | Ga0213876_10288073 | |||
| 510 | Ga0213875_10053893 | |||
| 511 | Ga0207705_10045651 | |||
| 512 | Ga0207705_10123292 | |||
| 513 | Ga0207705_10769831 | |||
| 514 | Ga0207684_10141428 | |||
| 515 | Ga0207707_10047556 | |||
| 516 | Ga0207707_10060777 | |||
| 517 | Ga0207707_10142359 | |||
| 518 | Ga0207707_10351905 | |||
| 519 | Ga0207707_10504303 | |||
| 520 | Ga0207693_10191068 | |||
| 521 | Ga0207693_10544890 | |||
| 522 | Ga0207663_10026845 | |||
| 523 | Ga0207660_10226783 | |||
| 524 | Ga0207660_10783825 | |||
| 525 | Ga0207660_10791677 | |||
| 526 | Ga0207657_10000433 | |||
| 527 | Ga0207657_10008706 | |||
| 528 | Ga0207657_10266125 | |||
| 529 | Ga0207649_10327011 | |||
| 530 | Ga0207649_10433900 | |||
| 531 | Ga0207652_10041073 | |||
| 532 | Ga0207652_10047923 | |||
| 533 | Ga0207652_10054547 | |||
| 534 | Ga0207687_10399653 | |||
| 535 | Ga0207687_10531936 | |||
| 536 | Ga0207700_10275332 | |||
| 537 | Ga0207664_10126303 | |||
| 538 | Ga0207664_10301800 | |||
| 539 | Ga0207664_10619549 | |||
| 540 | Ga0207644_10467746 | |||
| 541 | Ga0207686_11605135 | |||
| 542 | Ga0207711_10490405 | |||
| 543 | Ga0207661_10015842 | |||
| 544 | Ga0207661_10230119 | |||
| 545 | Ga0207679_10513839 | |||
| 546 | Ga0207667_10020264 | |||
| 547 | Ga0207667_10066448 | |||
| 548 | Ga0207667_10180377 | |||
| 549 | Ga0207667_10399162 | |||
| 550 | Ga0207677_10530510 | |||
| 551 | Ga0207639_10149541 | |||
| 552 | Ga0207678_10338277 | |||
| 553 | Ga0207674_10122568 | |||
| 554 | Ga0207683_10111848 | |||
| 555 | Ga0207683_10399452 | |||
| 556 | Ga0207698_10229113 | |||
| 557 | Ga0268266_10519692 | |||
| 558 | Ga0265326_10060684 | |||
| 559 | Ga0265334_10008281 | |||
| 560 | Ga0265318_10161308 | |||
| 561 | Ga0265318_10331224 | |||
| 562 | Ga0265323_10037911 | |||
| 563 | Ga0265322_10008235 | |||
| 564 | Ga0265338_10010875 | |||
| 565 | Ga0265338_10156501 | |||
| 566 | Ga0265338_10206332 | |||
| 567 | Ga0265330_10053607 | |||
| 568 | Ga0265328_10146675 | |||
| 569 | Ga0265325_10022041 | |||
| 570 | Ga0265340_10033955 | |||
| 571 | Ga0265327_10013001 | |||
| 572 | Ga0265327_10042145 | |||
| 573 | Ga0265327_10051563 | |||
| 574 | Ga0265316_10014974 | |||
| 575 | Ga0265313_10009255 | |||
| 576 | Ga0265313_10143677 | |||
| 577 | Ga0265314_10086227 | |||
| 578 | Ga0265342_10258411 | |||
| 579 | Ga0373926_0111808 | |||
| 580 | Ga0373923_0151737 | |||
| 581 | Ga0373936_0029613 | |||
| 582 | Ga0373954_0271353 | |||
| 583 | Ga0373956_0194726 | |||
| 584 | Ga0373957_0109395 | |||
| 585 | Ga0373943_0000914 | |||
| 586 | Ga0373943_0111656 | |||
| 587 | Ga0373946_0027921 | |||
| 588 | Ga0373946_0044908 | |||
| 589 | Ga0373955_0061219 | |||
| 590 | Ga0373955_0825796 | |||
| 591 | Ga0373935_0180143 | |||
| 592 | Ga0373927_0163425 | |||
| 593 | Ga0373947_0009787 | |||
| 594 | Ga0373947_0046110 | |||
| 595 | Ga0373937_0066338 | |||
| 596 | Ga0373925_0001868 | |||
| 597 | Ga0395899_0075798 | |||
| 598 | Ga0395899_0078348 | |||
| 599 | Ga0395899_0143636 | |||
| 600 | Ga0395899_0203373 | |||
| 601 | Ga0395899_0321087 | |||
| 602 | Ga0395900_0044872 | |||
| 603 | Ga0395900_0057973 | |||
| 604 | Ga0395900_0109585 | |||
| 605 | Ga0395900_0181972 | |||
| 606 | Ga0395900_0388358 | |||
| 607 | Ga0395900_0763897 | |||
| 608 | Ga0395900_0948872 | |||
| 609 | Ga0395898_0004806 | |||
| 610 | Ga0395898_0045053 | |||
| 611 | Ga0395898_0164070 | |||
| 612 | Ga0395898_0178555 | |||
| 613 | Ga0395898_0179250 | |||
| 614 | Ga0395898_0754909 | |||
| 615 | Ga0395905_0018204 | |||
| 616 | Ga0395905_0331176 | |||
| 617 | Ga0395905_0802930 | |||
| 618 | Ga0395905_1382874 | |||
| 619 | Ga0395905_1552299 | |||
| 620 | Ga0436364_0631366 | |||
| 621 | Ga0395901_0008961 | |||
| 622 | Ga0395901_0019375 | |||
| 623 | Ga0395901_0031971 | |||
| 624 | Ga0395901_0036309 | |||
| 625 | Ga0395901_0079861 | |||
| 626 | Ga0395901_0214746 | |||
| 627 | Ga0395901_0352580 | |||
| 628 | Ga0395901_0465112 | |||
| 629 | Ga0395901_0786260 | |||
| 630 | Ga0395901_0845635 | |||
| 631 | Ga0436365_0904554 | |||
| 632 | Ga0436363_0375092 | |||
| 633 | Ga0436363_0767079 | |||
| 634 | Ga0436363_0773531 | |||
| 635 | Ga0436363_1291606 | |||
| 636 | Ga0436362_1111496 | |||
| 637 | Ga0451807_2221517 | |||
| 638 | Ga0466969_0034158 | |||
| 639 | Ga0466969_0049965 | |||
| 640 | Ga0466972_0293416 | |||
| 641 | Ga0466972_0539684 | |||
| 642 | Ga0466965_0961934 | |||
| 643 | Ga0466966_0065063 | |||
| 644 | Ga0466966_0067395 | |||
| 645 | Ga0466966_0073520 | |||
| 646 | Ga0466966_0196467 | |||
| 647 | Ga0466966_0247348 | |||
| 648 | Ga0466966_0466182 | |||
| 649 | Ga0466961_0007487 | |||
| 650 | Ga0466961_0021554 | |||
| 651 | Ga0466961_0214602 | |||
| 652 | Ga0466961_0222521 | |||
| 653 | Ga0466961_0782414 | |||
| 654 | Ga0466963_0001406 | |||
| 655 | Ga0466963_0004880 | |||
| 656 | Ga0466963_0008124 | |||
| 657 | Ga0466963_0011551 | |||
| 658 | Ga0466963_0030343 | |||
| 659 | Ga0466963_0046696 | |||
| 660 | Ga0466963_0085604 | |||
| 661 | Ga0466963_0142871 | |||
| 662 | Ga0466963_0361622 | |||
| 663 | Ga0466963_0397472 | |||
| 664 | Ga0466963_0608780 | |||
| 665 | Ga0466964_0010777 | |||
| 666 | Ga0466964_0037562 | |||
| 667 | Ga0466964_0070430 | |||
| 668 | Ga0466964_0303978 | |||
| 669 | Ga0466971_0000385 | |||
| 670 | Ga0466971_0211748 | |||
| 671 | Ga0466968_0005447 | |||
| 672 | Ga0466968_0034739 | |||
| 673 | Ga0466968_0210149 | |||
| 674 | Ga0466968_0565981 | |||
| 675 | Ga0466970_0193745 | |||
| 676 | Ga0466970_0584261 | |||
| 677 | Ga0466970_0618113 | |||
| 678 | Ga0466957_0000164 | |||
| 679 | Ga0466957_0051848 | |||
| 680 | Ga0466957_0063795 | |||
| 681 | Ga0466957_0124061 | |||
| 682 | Ga0466959_0055649 | |||
| 683 | Ga0466959_0141733 | |||
| 684 | Ga0466959_0155194 | |||
| 685 | Ga0466959_0329129 | |||
| 686 | Ga0466959_0371287 | |||
| 687 | Ga0466959_0394331 | |||
| 688 | Ga0466958_0000218 | |||
| 689 | Ga0466958_0061182 | |||
| 690 | Ga0466958_0229050 | |||
| 691 | Ga0466967_0000911 | |||
| 692 | Ga0466967_0019021 | |||
| 693 | Ga0466967_0044711 | |||
| 694 | Ga0466967_0055382 | |||
| 695 | Ga0466967_0077111 | |||
| 696 | Ga0466967_0096213 | |||
| 697 | Ga0466967_0098651 | |||
| 698 | Ga0466967_0136075 | |||
| 699 | Ga0466967_0244763 | |||
| 700 | Ga0466967_0291346 | |||
| 701 | Ga0466967_0292547 | |||
| 702 | Ga0466967_0713560 | |||
| 703 | Ga0466967_1318397 | |||
| 704 | Ga0495592_0096135 | |||
| 705 | Ga0495603_0073426 | |||
| 706 | Ga0495629_0019050 | |||
| 707 | Ga0495641_0001534 | |||
| 708 | Ga0495641_0125114 | |||
| 709 | Ga0495651_0302409 | |||
| 710 | Ga0495653_0012864 | |||
| 711 | Ga0495653_0019618 | |||
| 712 | Ga0495653_0787213 | |||
| 713 | Ga0495582_0000391 | |||
| 714 | Ga0495582_0109783 | |||
| 715 | Ga0495639_0000300 | |||
| 716 | Ga0495662_0002922 | |||
| 717 | Ga0495664_0185020 | |||
| 718 | Ga0495664_0764581 | |||
| 719 | Ga0495608_0029738 | |||
| 720 | Ga0495608_0349970 | |||
| 721 | Ga0495618_0120106 | |||
| 722 | Ga0495628_0029192 | |||
| 723 | Ga0495628_0134505 | |||
| 724 | Ga0495630_0016630 | |||
| 725 | Ga0495630_0028632 | |||
| 726 | Ga0495630_0056696 | |||
| 727 | Ga0495630_1251632 | |||
| 728 | Ga0495652_0022886 | |||
| 729 | Ga0495652_0162035 | |||
| 730 | Ga0495665_0010292 | |||
| 731 | Ga0495640_0188103 | |||
| 732 | Ga0495640_0376251 | |||
| 733 | Ga0495587_0014591 | |||
| 734 | Ga0495587_0612239 | |||
| 735 | Ga0495645_0057474 | |||
| 736 | Ga0495645_0647422 | |||
| 737 | Ga0495667_0026512 | |||
| 738 | Ga0495667_0056596 | |||
| 739 | Ga0495667_0258593 | |||
| 740 | Ga0495634_0056272 | |||
| 741 | Ga0495634_0312643 | |||
| 742 | Ga0495635_0029741 | |||
| 743 | Ga0495635_0137701 | |||
| 744 | Ga0495588_0331125 | |||
| 745 | Ga0495657_0014444 | |||
| 746 | Ga0495657_0494275 | |||
| 747 | Ga0495623_0014076 | |||
| 748 | Ga0495623_0647380 | |||
| 749 | Ga0495646_0085075 | |||
| 750 | Ga0495647_0003678 | |||
| 751 | Ga0495658_0000043 | |||
| 752 | Ga0495613_0017457 | |||
| 753 | Ga0495613_0084609 | |||
| 754 | Ga0495624_0013568 | |||
| 755 | Ga0495600_0023043 | |||
| 756 | Ga0495600_0051578 | |||
| 757 | Ga0495581_0025078 | |||
| 758 | Ga0495604_0097240 | |||
| 759 | Ga0495604_0183211 | |||
| 760 | Ga0495674_0039396 | |||
| 761 | Ga0495674_0218685 | |||
| 762 | Ga0495674_0263520 | |||
| 763 | Ga0495674_0928872 | |||
| 764 | Ga0495676_0004468 | |||
| 765 | Ga0495680_0005179 | |||
| 766 | Ga0495680_0019721 | |||
| 767 | Ga0495680_0061370 | |||
| 768 | Ga0495675_0011425 | |||
| 769 | Ga0495684_0029794 | |||
| 770 | Ga0495684_0084562 | |||
| 771 | Ga0495593_0031198 | |||
| 772 | Ga0495602_0060081 | |||
| 773 | Ga0495602_0764659 | |||
| 774 | Ga0495614_0029635 | |||
| 775 | Ga0496100_0024191 | |||
| 776 | Ga0496100_0129859 | |||
| 777 | Ga0496100_0522155 | |||
| 778 | Ga0496101_0002400 | |||
| 779 | Ga0496101_0163295 | |||
| 780 | Ga0496101_0173351 | |||
| 781 | Ga0496102_0002153 | |||
| 782 | Ga0496102_0092175 | |||
| 783 | Ga0496102_1122937 | |||
| 784 | Ga0496103_0053280 | |||
| 785 | Ga0496103_0287100 | |||
| 786 | Ga0496103_0449635 | |||
| 787 | Ga0496103_0961169 | |||
| 788 | Ga0496104_0021226 | |||
| 789 | Ga0496104_0032696 | |||
| 790 | Ga0496104_0366422 | |||
| 791 | Ga0496105_0025417 | |||
| 792 | Ga0496105_0113625 | |||
| 793 | Ga0496106_1324470 | |||
| 794 | Ga0496107_0016405 | |||
| 795 | Ga0496107_0030865 | |||
| 796 | Ga0496108_0036138 | |||
| 797 | Ga0496108_0449894 | |||
| 798 | Ga0496109_0167736 | |||
| 799 | Ga0496111_0016305 | |||
| 800 | Ga0496111_0097531 | |||
| 801 | Ga0496112_0005680 | |||
| 802 | Ga0496112_0008449 | |||
| 803 | Ga0496112_0023132 | |||
| 804 | Ga0496112_0055143 | |||
| 805 | Ga0496112_0515656 | |||
| 806 | Ga0496113_0241217 | |||
| 807 | Ga0496113_0528147 | |||
| 808 | Ga0496114_0001106 | |||
| 809 | Ga0496114_0025071 | |||
| 810 | Ga0496114_0081354 | |||
| 811 | Ga0496114_0095305 | |||
| 812 | Ga0496114_0176014 | |||
| 813 | Ga0496115_0001931 | |||
| 814 | Ga0496115_0398693 | |||
| 815 | Ga0496115_1274213 | |||
| 816 | Ga0496115_1323519 | |||
| 817 | Ga0501034_0320226 | |||
| 818 | Ga0501038_0549814 | |||
| 819 | Ga0501046_0767253 | |||
| 820 | Ga0501047_0072124 | |||
| 821 | Ga0501067_0003948 | |||
| 822 | Ga0501067_0095467 | |||
| 823 | Ga0501068_0040192 | |||
| 824 | Ga0501069_0002903 | |||
| 825 | Ga0501069_0332174 | |||
| 826 | Ga0501070_0001360 | |||
| 827 | Ga0501070_0160821 | |||
| 828 | Ga0501070_0790440 | |||
| 829 | Ga0501070_1087096 | |||
| 830 | Ga0501074_0159266 | |||
| 831 | Ga0501074_0198033 | |||
| 832 | Ga0501074_0207144 | |||
| 833 | Ga0501079_0660589 | |||
| 834 | Ga0501080_0814163 | |||
| 835 | Ga0501044_0702379 | |||
| 836 | Ga0501044_0969881 | |||
| 837 | Ga0495601_0122903 | |||
| 838 | Ga0495601_0244209 | |||
| 839 | Ga0495612_0097512 | |||
| 840 | Ga0495595_0004802 | |||
| 841 | Ga0495595_0034181 | |||
| 842 | Ga0495619_0027191 | |||
| 843 | Ga0495619_0285917 | |||
| 844 | Ga0466962_0000275 | |||
| 845 | Ga0466962_0042529 | |||
| 846 | Ga0466962_0187050 | |||
| 847 | Ga0466962_0330550 | |||
| 848 | Ga0530510_0189992 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gk5-assembly1.cif.gz_A | crystal structure of rhodanese-related protein (tvg0868615) from thermoplasma volcanium, northeast structural genomics consortium target tvr109a | 0.8631 | 1 | 114 |
| 2eg3-assembly1.cif.gz_A | crystal structure of probable thiosulfate sulfurtransferase | 0.8527 | 2 | 117 |
| 3ntd-assembly1.cif.gz_A | structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c531s mutant | 0.8471 | 1 | 108 |
| 8a56-assembly1.cif.gz_B | coenzyme a-persulfide reductase (coapr) from enterococcus faecalis | 0.8402 | 2 | 103 |
| 3nt6-assembly1.cif.gz_B | structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant | 0.8393 | 1 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gk5A00 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.8631 | 1 | 114 | 3.40.250.10 |
| af_P91247_159_242_3.40.250.10 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.8541 | 58 | 111 | 3.40.250.10 |
| 2eg4B02 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.8423 | 2 | 116 | 3.40.250.10 |
| af_Q9USJ1_158_295_3.40.250.10 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.8242 | 3 | 107 | 3.40.250.10 |
| 3gk5A00 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.8242 | 1 | 114 | 3.40.250.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9FKZ0-F1-model_v4 | thiosulfate sulfurtransferase (EC 2.8.1.1) | 0.9054 | 1 | 115 |
|
| AF-A0A6I3BQU2-F1-model_v4 | thiosulfate sulfurtransferase (EC 2.8.1.1) | 0.8944 | 2 | 117 |
|
| AF-T1C0R0-F1-model_v4 | Rhodanese domain-containing protein | 0.8835 | 1 | 103 |
|
| AF-A0A538LYJ7-F1-model_v4 | thiosulfate sulfurtransferase (EC 2.8.1.1) | 0.8819 | 41 | 117 |
GO:0004792
|
| AF-D6A748-F1-model_v4 | Predicted protein | 0.8792 | 1 | 108 |
|