F440811

General Info

Members Datasets Scaffolds Average Seq Length
424 252 848 195

Family's Representative Sequence

Representative Sequence 3300042439|Ga0439464_0164892|Ga0439464_0164892_27_686
Length 219
Sequence MQRGSSRTAATVGSPAVRERLPTSPDAIRERYERLRAELGPECTIVAATKYVAVEDMAALAEAGVEVVGENRAQDLERKHAEYGDRFRWHFIGHLQSRKAPRVSELCELCHSLASESAARRLSIPALVEVNLSGEGSKSGIPPEELPAFLELYDDVRGLTTMPPATDDPESSRPYFRRLRELAAEHGLRELSMGTSQDYRVAAEEGATFVRLGSVLWQG

Samples

Sample ID Description Type Environment
1 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
151 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
152 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
159 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 6.37
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439464_0164892 3300042439 Bacteria 697
2 JGI24737J22298_10135425 3300001990 Bacteria 728
3 JGI24743J22301_10031064 3300001991 Bacteria 1051
4 JGI24749J21850_1020127 3300002076 Bacteria 942
5 JGI24744J21845_10000431 3300002077 Bacteria 7361
6 Ga0070690_100272429 3300005330 Bacteria 1205
7 Ga0070666_10045238 3300005335 Bacteria 2950
8 Ga0068868_100022279 3300005338 Bacteria 4778
9 Ga0070660_100051211 3300005339 Bacteria 3179
10 Ga0070660_100131670 3300005339 Bacteria 2002
11 Ga0070687_100222445 3300005343 Bacteria 1157
12 Ga0070668_100099115 3300005347 Bacteria 2307
13 Ga0070668_100447759 3300005347 Bacteria 1110
14 Ga0070675_100020791 3300005354 Bacteria 5238
15 Ga0070675_100104217 3300005354 Bacteria 2392
16 Ga0070671_100051304 3300005355 Bacteria 3431
17 Ga0070673_100262843 3300005364 Bacteria 1508
18 Ga0070703_10078700 3300005406 Unclassified 1118
19 Ga0070709_10849810 3300005434 Bacteria 719
20 Ga0070713_100016916 3300005436 Bacteria 5496
21 Ga0070710_10007274 3300005437 Bacteria 5354
22 Ga0070710_10332937 3300005437 Bacteria 1000
23 Ga0070701_10155349 3300005438 Bacteria 1321
24 Ga0070711_100003275 3300005439 Bacteria 9415
25 Ga0070705_100011270 3300005440 Bacteria 4504
26 Ga0070705_100041567 3300005440 Bacteria 2622
27 Ga0070705_100101127 3300005440 Bacteria 1820
28 Ga0070700_100002621 3300005441 Bacteria 9198
29 Ga0070694_100176921 3300005444 Bacteria 1575
30 Ga0070708_100175867 3300005445 Bacteria 2000
31 Ga0070678_100008915 3300005456 Bacteria 6040
32 Ga0070678_100323923 3300005456 Bacteria 1317
33 Ga0070662_100015880 3300005457 Bacteria 5050
34 Ga0070662_100224517 3300005457 Bacteria 1500
35 Ga0070681_10119501 3300005458 Bacteria 2571
36 Ga0068867_100040761 3300005459 Bacteria 3391
37 Ga0068867_100271195 3300005459 Bacteria 1387
38 Ga0070685_10001703 3300005466 Bacteria 11556
39 Ga0070698_101088494 3300005471 Bacteria 747
40 Ga0070699_100426446 3300005518 Bacteria 1201
41 Ga0070679_100413741 3300005530 Bacteria 1294
42 Ga0068853_100017800 3300005539 Bacteria 5867
43 Ga0068853_100489024 3300005539 Bacteria 1161
44 Ga0070672_100022002 3300005543 Bacteria 4676
45 Ga0070686_100002161 3300005544 Bacteria 10855
46 Ga0070686_100226594 3300005544 Bacteria 1353
47 Ga0070696_100072454 3300005546 Bacteria 2426
48 Ga0070696_100588887 3300005546 Unclassified 895
49 Ga0070693_100177762 3300005547 Bacteria 1368
50 Ga0070665_100012505 3300005548 Bacteria 8552
51 Ga0070704_100013124 3300005549 Bacteria 5132
52 Ga0070704_100474303 3300005549 Bacteria 1081
53 Ga0070704_101009414 3300005549 Bacteria 753
54 Ga0068855_100435336 3300005563 Bacteria 1433
55 Ga0068855_100557644 3300005563 Bacteria 1240
56 Ga0068857_100222623 3300005577 Bacteria 1724
57 Ga0068854_100092617 3300005578 Bacteria 2251
58 Ga0068856_100016313 3300005614 Bacteria 7189
59 Ga0070702_100007535 3300005615 Bacteria 5215
60 Ga0068852_100092269 3300005616 Bacteria 2711
61 Ga0068859_100198475 3300005617 Bacteria 2091
62 Ga0068866_10005713 3300005718 Bacteria 5156
63 Ga0068861_100167778 3300005719 Bacteria 1817
64 Ga0068863_100944241 3300005841 Bacteria 864
65 Ga0068860_100104907 3300005843 Bacteria 2699
66 Ga0068862_100411086 3300005844 Bacteria 1268
67 Ga0081455_10112841 3300005937 Bacteria 2157
68 Ga0081455_10160018 3300005937 Bacteria 1727
69 Ga0081540_1012254 3300005983 Bacteria 5666
70 Ga0081539_10003477 3300005985 Bacteria 19242
71 Ga0081539_10007808 3300005985 Bacteria 9569
72 Ga0070717_10013145 3300006028 Bacteria 6327
73 Ga0075365_10014100 3300006038 Bacteria 4801
74 Ga0075432_10006447 3300006058 Bacteria 3993
75 Ga0075432_10009616 3300006058 Bacteria 3292
76 Ga0070712_100072155 3300006175 Bacteria 2472
77 Ga0097621_100087794 3300006237 Bacteria 2598
78 Ga0068871_100020602 3300006358 Bacteria 5054
79 Ga0075431_100019830 3300006847 Bacteria 6865
80 Ga0075431_101310753 3300006847 Unclassified 685
81 Ga0075433_10014832 3300006852 Bacteria 6378
82 Ga0075433_10751426 3300006852 Unclassified 853
83 Ga0075434_100102689 3300006871 Bacteria 2867
84 Ga0075434_100137210 3300006871 Bacteria 2465
85 Ga0075434_100229698 3300006871 Unclassified 1875
86 Ga0068865_100001919 3300006881 Bacteria 12226
87 Ga0075436_100003202 3300006914 Bacteria 11222
88 Ga0097620_100198466 3300006931 Bacteria 2091
89 Ga0075435_100122348 3300007076 Bacteria 2172
90 Ga0075435_100258795 3300007076 Unclassified 1482
91 Ga0111539_10017571 3300009094 Bacteria 8852
92 Ga0111539_10390129 3300009094 Bacteria 1621
93 Ga0105245_10006729 3300009098 Bacteria 10086
94 Ga0105245_10517623 3300009098 Bacteria 1211
95 Ga0105245_11779482 3300009098 Archaea 669
96 Ga0114129_10007371 3300009147 Bacteria 15660
97 Ga0114129_10007795 3300009147 Bacteria 15234
98 Ga0114129_10070845 3300009147 Bacteria 4861
99 Ga0114129_10082552 3300009147 Bacteria 4465
100 Ga0105243_10002852 3300009148 Bacteria 14323
101 Ga0105241_10026869 3300009174 Bacteria 4284
102 Ga0105242_10003918 3300009176 Bacteria 11569
103 Ga0105242_10013526 3300009176 Bacteria 6311
104 Ga0105248_10013646 3300009177 Bacteria 8943
105 Ga0105248_10212293 3300009177 Bacteria 2181
106 Ga0105237_10416586 3300009545 Bacteria 1349
107 Ga0105238_10062175 3300009551 Bacteria 3734
108 Ga0105239_10010390 3300010375 Bacteria 10415
109 Ga0105239_10739084 3300010375 Bacteria 1126
110 Ga0157322_1022058 3300012490 Unclassified 621
111 Ga0157374_10002922 3300013296 Bacteria 14319
112 Ga0157378_10009605 3300013297 Bacteria 8423
113 Ga0163162_10012972 3300013306 Bacteria 8132
114 Ga0163162_10316757 3300013306 Bacteria 1692
115 Ga0157375_10175581 3300013308 Bacteria 2291
116 Ga0157375_10350596 3300013308 Bacteria 1642
117 Ga0157375_11882540 3300013308 Unclassified 710
118 Ga0157380_10081773 3300014326 Bacteria 2643
119 Ga0157379_10625596 3300014968 Bacteria 1006
120 Ga0157376_10030959 3300014969 Bacteria 4279
121 Ga0207692_10211608 3300025898 Bacteria 1145
122 Ga0207692_10419483 3300025898 Unclassified 838
123 Ga0207642_10081023 3300025899 Bacteria 1576
124 Ga0207710_10046431 3300025900 Bacteria 1939
125 Ga0207688_10075391 3300025901 Bacteria 1920
126 Ga0207680_10043653 3300025903 Bacteria 2631
127 Ga0207647_10201750 3300025904 Bacteria 1150
128 Ga0207699_10219856 3300025906 Bacteria 1296
129 Ga0207684_10876132 3300025910 Bacteria 756
130 Ga0207654_10016213 3300025911 Bacteria 3876
131 Ga0207695_10645133 3300025913 Bacteria 940
132 Ga0207671_10336692 3300025914 Bacteria 1195
133 Ga0207693_10004843 3300025915 Bacteria 11329
134 Ga0207663_10038877 3300025916 Bacteria 2880
135 Ga0207662_10170919 3300025918 Unclassified 1393
136 Ga0207662_10240281 3300025918 Bacteria 1186
137 Ga0207657_10000739 3300025919 Bacteria 34678
138 Ga0207657_10013020 3300025919 Bacteria 8173
139 Ga0207657_10425016 3300025919 Bacteria 1044
140 Ga0207652_10480972 3300025921 Bacteria 1118
141 Ga0207646_10230354 3300025922 Bacteria 1674
142 Ga0207694_10083034 3300025924 Bacteria 2519
143 Ga0207659_10063595 3300025926 Bacteria 2668
144 Ga0207687_10020301 3300025927 Bacteria 4407
145 Ga0207700_10434240 3300025928 Bacteria 1155
146 Ga0207690_10018587 3300025932 Bacteria 4264
147 Ga0207706_10033389 3300025933 Bacteria 4581
148 Ga0207706_10271475 3300025933 Bacteria 1480
149 Ga0207686_10008636 3300025934 Bacteria 5502
150 Ga0207686_10629363 3300025934 Bacteria 847
151 Ga0207709_10001437 3300025935 Bacteria 16621
152 Ga0207709_10553212 3300025935 Bacteria 905
153 Ga0207669_10000947 3300025937 Bacteria 12291
154 Ga0207669_10516019 3300025937 Bacteria 959
155 Ga0207704_10003034 3300025938 Bacteria 7583
156 Ga0207691_10003841 3300025940 Bacteria 14577
157 Ga0207711_10602529 3300025941 Bacteria 1025
158 Ga0207661_10247662 3300025944 Bacteria 1583
159 Ga0207651_10248177 3300025960 Bacteria 1455
160 Ga0207712_10010849 3300025961 Bacteria 5797
161 Ga0207668_10773211 3300025972 Bacteria 848
162 Ga0207639_10252898 3300026041 Bacteria 1537
163 Ga0207639_11376762 3300026041 Bacteria 662
164 Ga0207678_10116707 3300026067 Bacteria 2277
165 Ga0207708_10002124 3300026075 Bacteria 14612
166 Ga0207708_10041470 3300026075 Bacteria 3509
167 Ga0207702_10339362 3300026078 Bacteria 1435
168 Ga0207641_11028792 3300026088 Bacteria 821
169 Ga0207648_10003665 3300026089 Bacteria 16078
170 Ga0207675_100036335 3300026118 Bacteria 4596
171 Ga0207683_10000549 3300026121 Bacteria 34716
172 Ga0207698_10087931 3300026142 Bacteria 2532
173 Ga0207698_10318704 3300026142 Bacteria 1455
174 Ga0268265_10147441 3300028380 Bacteria 1980
175 Ga0268264_10105830 3300028381 Bacteria 2454
176 Ga0265336_10043071 3300028666 Bacteria 1377
177 Ga0265338_10090375 3300028800 Bacteria 2534
178 Ga0265338_10102682 3300028800 Bacteria 2325
179 Ga0265338_10237883 3300028800 Bacteria 1350
180 Ga0265320_10098861 3300031240 Bacteria 1345
181 Ga0265340_10042945 3300031247 Bacteria 2218
182 Ga0265316_10046426 3300031344 Bacteria 3442
183 Ga0307408_100092328 3300031548 Bacteria 2288
184 Ga0307408_100204698 3300031548 Bacteria 1600
185 Ga0307405_10087131 3300031731 Bacteria 2057
186 Ga0307413_10069267 3300031824 Bacteria 2213
187 Ga0307407_10233962 3300031903 Bacteria 1249
188 Ga0307407_10240817 3300031903 Bacteria 1234
189 Ga0307412_10424459 3300031911 Bacteria 1088
190 Ga0307409_100033256 3300031995 Bacteria 3750
191 Ga0307416_100159227 3300032002 Bacteria 2084
192 Ga0307416_100341458 3300032002 Bacteria 1510
193 Ga0307414_10069628 3300032004 Bacteria 2530
194 Ga0307411_10012847 3300032005 Bacteria 4590
195 Ga0307415_100067637 3300032126 Bacteria 2497
196 Ga0395899_0002082 3300037312 Bacteria 16425
197 Ga0395899_0057381 3300037312 Bacteria 2874
198 Ga0395899_0108969 3300037312 Bacteria 1993
199 Ga0395899_0127055 3300037312 Bacteria 1823
200 Ga0395899_0185925 3300037312 Bacteria 1456
201 Ga0395899_0551427 3300037312 Bacteria 741
202 Ga0395899_0557060 3300037312 Bacteria 736
203 Ga0395900_0003571 3300037418 Bacteria 16714
204 Ga0395900_0017742 3300037418 Bacteria 7263
205 Ga0395900_0100676 3300037418 Bacteria 2968
206 Ga0395900_0178677 3300037418 Bacteria 2158
207 Ga0395900_0183364 3300037418 Bacteria 2126
208 Ga0395900_0183868 3300037418 Bacteria 2122
209 Ga0395900_0219027 3300037418 Bacteria 1919
210 Ga0395900_0403876 3300037418 Bacteria 1330
211 Ga0395898_0001966 3300037466 Bacteria 25888
212 Ga0395898_0014811 3300037466 Bacteria 8004
213 Ga0395898_0057222 3300037466 Bacteria 3800
214 Ga0395898_0085375 3300037466 Bacteria 3042
215 Ga0395898_0154818 3300037466 Bacteria 2193
216 Ga0395898_0156983 3300037466 Bacteria 2176
217 Ga0395898_0166294 3300037466 Bacteria 2109
218 Ga0395898_0173458 3300037466 Bacteria 2061
219 Ga0395898_0762718 3300037466 Bacteria 908
220 Ga0395905_0004551 3300037471 Bacteria 14359
221 Ga0395905_0024003 3300037471 Bacteria 5757
222 Ga0395905_0052081 3300037471 Bacteria 3833
223 Ga0395905_0056838 3300037471 Bacteria 3659
224 Ga0395905_0120981 3300037471 Bacteria 2461
225 Ga0395905_0317090 3300037471 Bacteria 1448
226 Ga0395905_0464680 3300037471 Bacteria 1164
227 Ga0395905_0488243 3300037471 Bacteria 1131
228 Ga0395905_0546020 3300037471 Bacteria 1060
229 Ga0395901_0005947 3300038443 Bacteria 12356
230 Ga0395901_0012045 3300038443 Bacteria 8772
231 Ga0395901_0018505 3300038443 Bacteria 7112
232 Ga0395901_0042698 3300038443 Bacteria 4701
233 Ga0395901_0060256 3300038443 Bacteria 3949
234 Ga0395901_0080644 3300038443 Bacteria 3398
235 Ga0395901_0108232 3300038443 Bacteria 2918
236 Ga0395901_0120252 3300038443 Bacteria 2760
237 Ga0395901_0313827 3300038443 Bacteria 1623
238 Ga0395901_0407875 3300038443 Bacteria 1395
239 Ga0395901_0589753 3300038443 Bacteria 1122
240 Ga0395901_0628027 3300038443 Bacteria 1080
241 Ga0395901_0675321 3300038443 Bacteria 1033
242 Ga0439436_0033946 3300041404 Bacteria 1476
243 Ga0439438_028988 3300041405 Bacteria 1484
244 Ga0439439_0020827 3300041406 Bacteria 1631
245 Ga0439453_0035424 3300041408 Bacteria 961
246 Ga0439461_0004932 3300041410 Bacteria 2254
247 Ga0451853_0428316 3300041512 Bacteria 843
248 Ga0451853_0715157 3300041512 Bacteria 1867
249 Ga0439431_0006790 3300041997 Bacteria 2540
250 Ga0439431_0084707 3300041997 Bacteria 858
251 Ga0439433_0010555 3300041999 Bacteria 2017
252 Ga0439437_020042 3300042000 Bacteria 806
253 Ga0439442_001423 3300042002 Bacteria 4713
254 Ga0439445_0023401 3300042004 Bacteria 1564
255 Ga0439445_0175474 3300042004 Bacteria 629
256 Ga0439462_0012923 3300042015 Bacteria 2137
257 Ga0450907_044389 3300042146 Bacteria 762
258 Ga0439446_0000425 3300042156 Bacteria 8263
259 Ga0439446_0005075 3300042156 Bacteria 3370
260 Ga0439446_0026690 3300042156 Bacteria 1655
261 Ga0439434_0010591 3300042435 Bacteria 2719
262 Ga0439434_0059462 3300042435 Bacteria 1193
263 Ga0466963_0000059 3300044694 Bacteria 37360
264 Ga0466963_0019800 3300044694 Bacteria 4226
265 Ga0466964_0001483 3300044706 Bacteria 8036
266 Ga0466971_0009074 3300044719 Bacteria 4346
267 Ga0466971_0269236 3300044719 Unclassified 814
268 Ga0466968_0263419 3300044735 Bacteria 821
269 Ga0466957_0034703 3300044842 Bacteria 3025
270 Ga0466957_0046870 3300044842 Bacteria 2625
271 Ga0466960_0297433 3300044901 Bacteria 909
272 Ga0466959_0508049 3300045049 Bacteria 814
273 Ga0451576_0242555 3300045051 Bacteria 1883
274 Ga0466958_0010875 3300045836 Bacteria 5110
275 Ga0466958_0011292 3300045836 Bacteria 5028
276 Ga0466967_0000305 3300045976 Bacteria 22092
277 Ga0495603_0045442 3300046455 Bacteria 2619
278 Ga0495641_0021229 3300046461 Bacteria 3271
279 Ga0495580_0273228 3300046472 Bacteria 1154
280 Ga0495582_0057505 3300046473 Bacteria 2144
281 Ga0495582_0110486 3300046473 Bacteria 1544
282 Ga0495639_0003815 3300046475 Bacteria 6470
283 Ga0495584_0385751 3300046491 Bacteria 712
284 Ga0495594_0017601 3300046499 Bacteria 3778
285 Ga0495607_0119087 3300046501 Bacteria 1389
286 Ga0495642_0239626 3300046528 Bacteria 793
287 Ga0495598_0052928 3300046537 Bacteria 1228
288 Ga0495656_0110101 3300046615 Unclassified 1287
289 Ga0495611_0158948 3300046648 Bacteria 1056
290 Ga0495661_0265749 3300046665 Bacteria 870
291 Ga0495588_0100828 3300046674 Unclassified 1517
292 Ga0495588_0121550 3300046674 Bacteria 1376
293 Ga0495658_0055700 3300046683 Bacteria 2253
294 Ga0495658_0373403 3300046683 Bacteria 907
295 Ga0495589_0137808 3300046794 Archaea 1170
296 Ga0495581_0002147 3300047315 Bacteria 11128
297 Ga0495636_0353344 3300047318 Bacteria 694
298 Ga0495636_0420458 3300047318 Bacteria 639
299 Ga0495676_0211554 3300047321 Bacteria 1341
300 Ga0496101_0008763 3300048904 Bacteria 6618
301 Ga0496101_0998084 3300048904 Bacteria 658
302 Ga0496102_0012890 3300048905 Bacteria 7236
303 Ga0496102_0115968 3300048905 Bacteria 2499
304 Ga0496103_0001779 3300048906 Bacteria 14061
305 Ga0496103_0031043 3300048906 Bacteria 3254
306 Ga0496104_0286039 3300048907 Bacteria 1561
307 Ga0496105_0016150 3300048908 Bacteria 5955
308 Ga0496105_0239256 3300048908 Bacteria 1474
309 Ga0496106_0008187 3300048909 Bacteria 7725
310 Ga0496106_0116498 3300048909 Bacteria 2084
311 Ga0496107_0008399 3300048910 Bacteria 7146
312 Ga0496107_0229990 3300048910 Bacteria 1380
313 Ga0496108_0107672 3300048911 Bacteria 2380
314 Ga0496109_0030300 3300048912 Bacteria 4850
315 Ga0496109_0069220 3300048912 Bacteria 3236
316 Ga0496109_0136237 3300048912 Bacteria 2294
317 Ga0496109_0316634 3300048912 Bacteria 1472
318 Ga0496109_0634203 3300048912 Bacteria 1005
319 Ga0496111_0019287 3300048914 Bacteria 4735
320 Ga0496112_0001342 3300048915 Bacteria 18712
321 Ga0496112_0021006 3300048915 Bacteria 6201
322 Ga0496112_0102144 3300048915 Bacteria 2837
323 Ga0496112_0497061 3300048915 Bacteria 1155
324 Ga0496113_0265798 3300048916 Bacteria 1371
325 Ga0496114_0005912 3300048917 Bacteria 9616
326 Ga0496115_0759512 3300048918 Bacteria 757
327 Ga0501291_028753 3300049514 Bacteria 927
328 Ga0501031_0002862 3300049568 Bacteria 11023
329 Ga0501031_0213460 3300049568 Bacteria 1257
330 Ga0501032_0318895 3300049569 Bacteria 1003
331 Ga0501032_0451524 3300049569 Bacteria 823
332 Ga0501033_0116374 3300049570 Bacteria 1942
333 Ga0501034_0284761 3300049571 Bacteria 1592
334 Ga0501036_0298481 3300049572 Bacteria 1347
335 Ga0501036_0351674 3300049572 Bacteria 1230
336 Ga0501037_0069213 3300049573 Bacteria 2569
337 Ga0501037_0297695 3300049573 Bacteria 1121
338 Ga0501038_0019964 3300049574 Bacteria 6032
339 Ga0501038_0046986 3300049574 Bacteria 3741
340 Ga0501038_0110496 3300049574 Bacteria 2278
341 Ga0501039_0019654 3300049575 Bacteria 5179
342 Ga0501040_0025654 3300049576 Bacteria 3964
343 Ga0501040_0098798 3300049576 Bacteria 2034
344 Ga0501040_0187509 3300049576 Bacteria 1467
345 Ga0501040_0262420 3300049576 Bacteria 1233
346 Ga0501041_0069079 3300049577 Bacteria 2166
347 Ga0501042_0002850 3300049578 Bacteria 10717
348 Ga0501042_0058540 3300049578 Bacteria 2750
349 Ga0501043_0019739 3300049579 Bacteria 5292
350 Ga0501043_0043359 3300049579 Bacteria 3536
351 Ga0501046_0022461 3300049580 Bacteria 5198
352 Ga0501046_0138121 3300049580 Bacteria 1845
353 Ga0501048_0022680 3300049582 Bacteria 4589
354 Ga0501048_0027986 3300049582 Bacteria 4094
355 Ga0501048_0263866 3300049582 Bacteria 1223
356 Ga0501048_0745483 3300049582 Bacteria 703
357 Ga0501067_0002811 3300049583 Bacteria 9574
358 Ga0501067_0042731 3300049583 Bacteria 2516
359 Ga0501068_0017001 3300049584 Bacteria 4202
360 Ga0501068_0049548 3300049584 Bacteria 2537
361 Ga0501069_0016633 3300049585 Bacteria 3952
362 Ga0501069_0210194 3300049585 Unclassified 1129
363 Ga0501070_0006372 3300049586 Bacteria 10044
364 Ga0501070_0026943 3300049586 Bacteria 4820
365 Ga0501071_0010601 3300049587 Bacteria 6182
366 Ga0501071_0027853 3300049587 Bacteria 3978
367 Ga0501071_0260189 3300049587 Bacteria 1310
368 Ga0501071_0341782 3300049587 Bacteria 1138
369 Ga0501072_0000318 3300049588 Bacteria 34284
370 Ga0501072_0068717 3300049588 Bacteria 2796
371 Ga0501072_0092858 3300049588 Bacteria 2397
372 Ga0501072_0720656 3300049588 Bacteria 783
373 Ga0501072_0923813 3300049588 Bacteria 681
374 Ga0501073_0156424 3300049589 Bacteria 1579
375 Ga0501074_0002199 3300049590 Bacteria 13520
376 Ga0501074_0051723 3300049590 Bacteria 2964
377 Ga0501074_0086052 3300049590 Bacteria 2252
378 Ga0501075_0052134 3300049591 Bacteria 3076
379 Ga0501075_0055144 3300049591 Bacteria 2990
380 Ga0501076_0009703 3300049592 Bacteria 7110
381 Ga0501076_0040262 3300049592 Bacteria 3671
382 Ga0501076_0055986 3300049592 Bacteria 3128
383 Ga0501077_0133910 3300049593 Bacteria 1571
384 Ga0501079_0032658 3300049741 Bacteria 4002
385 Ga0501079_0169201 3300049741 Bacteria 1704
386 Ga0501079_0359174 3300049741 Bacteria 1141
387 Ga0501080_0049865 3300049742 Bacteria 3896
388 Ga0501080_0168848 3300049742 Bacteria 2018
389 Ga0501081_0007407 3300049743 Bacteria 7124
390 Ga0501081_0188691 3300049743 Bacteria 1492
391 Ga0501081_0209158 3300049743 Bacteria 1417
392 Ga0501083_0022258 3300049744 Bacteria 4398
393 Ga0501083_0104828 3300049744 Bacteria 1862
394 Ga0501035_0217711 3300049822 Bacteria 1631
395 Ga0501035_0247076 3300049822 Bacteria 1516
396 Ga0501044_0158485 3300049823 Bacteria 2242
397 Ga0501044_0452659 3300049823 Bacteria 1190
398 Ga0501045_0056670 3300049824 Bacteria 2866
399 Ga0501045_0090987 3300049824 Bacteria 2255
400 Ga0501045_0240316 3300049824 Bacteria 1348
401 Ga0501045_0927112 3300049824 Bacteria 639
402 nmdc:mga05p37_307137_c1 3300050507 Bacteria 1882
403 nmdc:mga05p37_3867_c1 3300050507 Bacteria 17516
404 nmdc:mga06r32_1054698_c1 3300050510 Bacteria 763
405 nmdc:mga06r32_80951_c1 3300050510 Bacteria 3161
406 nmdc:mga08y16_54014_c1 3300050511 Bacteria 4199
407 nmdc:mga0n895_106596_c1 3300050512 Bacteria 2815
408 nmdc:mga0n895_269717_c1 3300050512 Unclassified 1726
409 nmdc:mga0rr50_160406_c1 3300050513 Bacteria 1825
410 nmdc:mga0rr50_17989_c1 3300050513 Bacteria 4736
411 nmdc:mga08x19_52110_c1 3300050514 Bacteria 2631
412 nmdc:mga0a205_585590_c1 3300050515 Bacteria 969
413 Ga0495655_0032539 3300053083 Bacteria 1277
414 Ga0495655_0072598 3300053083 Archaea 966
415 Ga0495595_0084611 3300053084 Bacteria 1516
416 Ga0501084_0001046 3300054114 Bacteria 21522
417 Ga0501084_0412455 3300054114 Bacteria 1141
418 Ga0501084_1058140 3300054114 Bacteria 681
419 Ga0501082_0183265 3300060353 Bacteria 1821
420 Ga0501082_0322686 3300060353 Bacteria 1345
421 Ga0501082_0865513 3300060353 Bacteria 790
422 Ga0530510_0010226 3300061734 Bacteria 6573
423 Ga0530510_0073923 3300061734 Bacteria 2475
424 Ga0530510_0503016 3300061734 Bacteria 918
425 Ga0439464_0164892
426 JGI24737J22298_10135425
427 JGI24743J22301_10031064
428 JGI24749J21850_1020127
429 JGI24744J21845_10000431
430 Ga0070690_100272429
431 Ga0070666_10045238
432 Ga0068868_100022279
433 Ga0070660_100051211
434 Ga0070660_100131670
435 Ga0070687_100222445
436 Ga0070668_100099115
437 Ga0070668_100447759
438 Ga0070675_100020791
439 Ga0070675_100104217
440 Ga0070671_100051304
441 Ga0070673_100262843
442 Ga0070703_10078700
443 Ga0070709_10849810
444 Ga0070713_100016916
445 Ga0070710_10007274
446 Ga0070710_10332937
447 Ga0070701_10155349
448 Ga0070711_100003275
449 Ga0070705_100011270
450 Ga0070705_100041567
451 Ga0070705_100101127
452 Ga0070700_100002621
453 Ga0070694_100176921
454 Ga0070708_100175867
455 Ga0070678_100008915
456 Ga0070678_100323923
457 Ga0070662_100015880
458 Ga0070662_100224517
459 Ga0070681_10119501
460 Ga0068867_100040761
461 Ga0068867_100271195
462 Ga0070685_10001703
463 Ga0070698_101088494
464 Ga0070699_100426446
465 Ga0070679_100413741
466 Ga0068853_100017800
467 Ga0068853_100489024
468 Ga0070672_100022002
469 Ga0070686_100002161
470 Ga0070686_100226594
471 Ga0070696_100072454
472 Ga0070696_100588887
473 Ga0070693_100177762
474 Ga0070665_100012505
475 Ga0070704_100013124
476 Ga0070704_100474303
477 Ga0070704_101009414
478 Ga0068855_100435336
479 Ga0068855_100557644
480 Ga0068857_100222623
481 Ga0068854_100092617
482 Ga0068856_100016313
483 Ga0070702_100007535
484 Ga0068852_100092269
485 Ga0068859_100198475
486 Ga0068866_10005713
487 Ga0068861_100167778
488 Ga0068863_100944241
489 Ga0068860_100104907
490 Ga0068862_100411086
491 Ga0081455_10112841
492 Ga0081455_10160018
493 Ga0081540_1012254
494 Ga0081539_10003477
495 Ga0081539_10007808
496 Ga0070717_10013145
497 Ga0075365_10014100
498 Ga0075432_10006447
499 Ga0075432_10009616
500 Ga0070712_100072155
501 Ga0097621_100087794
502 Ga0068871_100020602
503 Ga0075431_100019830
504 Ga0075431_101310753
505 Ga0075433_10014832
506 Ga0075433_10751426
507 Ga0075434_100102689
508 Ga0075434_100137210
509 Ga0075434_100229698
510 Ga0068865_100001919
511 Ga0075436_100003202
512 Ga0097620_100198466
513 Ga0075435_100122348
514 Ga0075435_100258795
515 Ga0111539_10017571
516 Ga0111539_10390129
517 Ga0105245_10006729
518 Ga0105245_10517623
519 Ga0105245_11779482
520 Ga0114129_10007371
521 Ga0114129_10007795
522 Ga0114129_10070845
523 Ga0114129_10082552
524 Ga0105243_10002852
525 Ga0105241_10026869
526 Ga0105242_10003918
527 Ga0105242_10013526
528 Ga0105248_10013646
529 Ga0105248_10212293
530 Ga0105237_10416586
531 Ga0105238_10062175
532 Ga0105239_10010390
533 Ga0105239_10739084
534 Ga0157322_1022058
535 Ga0157374_10002922
536 Ga0157378_10009605
537 Ga0163162_10012972
538 Ga0163162_10316757
539 Ga0157375_10175581
540 Ga0157375_10350596
541 Ga0157375_11882540
542 Ga0157380_10081773
543 Ga0157379_10625596
544 Ga0157376_10030959
545 Ga0207692_10211608
546 Ga0207692_10419483
547 Ga0207642_10081023
548 Ga0207710_10046431
549 Ga0207688_10075391
550 Ga0207680_10043653
551 Ga0207647_10201750
552 Ga0207699_10219856
553 Ga0207684_10876132
554 Ga0207654_10016213
555 Ga0207695_10645133
556 Ga0207671_10336692
557 Ga0207693_10004843
558 Ga0207663_10038877
559 Ga0207662_10170919
560 Ga0207662_10240281
561 Ga0207657_10000739
562 Ga0207657_10013020
563 Ga0207657_10425016
564 Ga0207652_10480972
565 Ga0207646_10230354
566 Ga0207694_10083034
567 Ga0207659_10063595
568 Ga0207687_10020301
569 Ga0207700_10434240
570 Ga0207690_10018587
571 Ga0207706_10033389
572 Ga0207706_10271475
573 Ga0207686_10008636
574 Ga0207686_10629363
575 Ga0207709_10001437
576 Ga0207709_10553212
577 Ga0207669_10000947
578 Ga0207669_10516019
579 Ga0207704_10003034
580 Ga0207691_10003841
581 Ga0207711_10602529
582 Ga0207661_10247662
583 Ga0207651_10248177
584 Ga0207712_10010849
585 Ga0207668_10773211
586 Ga0207639_10252898
587 Ga0207639_11376762
588 Ga0207678_10116707
589 Ga0207708_10002124
590 Ga0207708_10041470
591 Ga0207702_10339362
592 Ga0207641_11028792
593 Ga0207648_10003665
594 Ga0207675_100036335
595 Ga0207683_10000549
596 Ga0207698_10087931
597 Ga0207698_10318704
598 Ga0268265_10147441
599 Ga0268264_10105830
600 Ga0265336_10043071
601 Ga0265338_10090375
602 Ga0265338_10102682
603 Ga0265338_10237883
604 Ga0265320_10098861
605 Ga0265340_10042945
606 Ga0265316_10046426
607 Ga0307408_100092328
608 Ga0307408_100204698
609 Ga0307405_10087131
610 Ga0307413_10069267
611 Ga0307407_10233962
612 Ga0307407_10240817
613 Ga0307412_10424459
614 Ga0307409_100033256
615 Ga0307416_100159227
616 Ga0307416_100341458
617 Ga0307414_10069628
618 Ga0307411_10012847
619 Ga0307415_100067637
620 Ga0395899_0002082
621 Ga0395899_0057381
622 Ga0395899_0108969
623 Ga0395899_0127055
624 Ga0395899_0185925
625 Ga0395899_0551427
626 Ga0395899_0557060
627 Ga0395900_0003571
628 Ga0395900_0017742
629 Ga0395900_0100676
630 Ga0395900_0178677
631 Ga0395900_0183364
632 Ga0395900_0183868
633 Ga0395900_0219027
634 Ga0395900_0403876
635 Ga0395898_0001966
636 Ga0395898_0014811
637 Ga0395898_0057222
638 Ga0395898_0085375
639 Ga0395898_0154818
640 Ga0395898_0156983
641 Ga0395898_0166294
642 Ga0395898_0173458
643 Ga0395898_0762718
644 Ga0395905_0004551
645 Ga0395905_0024003
646 Ga0395905_0052081
647 Ga0395905_0056838
648 Ga0395905_0120981
649 Ga0395905_0317090
650 Ga0395905_0464680
651 Ga0395905_0488243
652 Ga0395905_0546020
653 Ga0395901_0005947
654 Ga0395901_0012045
655 Ga0395901_0018505
656 Ga0395901_0042698
657 Ga0395901_0060256
658 Ga0395901_0080644
659 Ga0395901_0108232
660 Ga0395901_0120252
661 Ga0395901_0313827
662 Ga0395901_0407875
663 Ga0395901_0589753
664 Ga0395901_0628027
665 Ga0395901_0675321
666 Ga0439436_0033946
667 Ga0439438_028988
668 Ga0439439_0020827
669 Ga0439453_0035424
670 Ga0439461_0004932
671 Ga0451853_0428316
672 Ga0451853_0715157
673 Ga0439431_0006790
674 Ga0439431_0084707
675 Ga0439433_0010555
676 Ga0439437_020042
677 Ga0439442_001423
678 Ga0439445_0023401
679 Ga0439445_0175474
680 Ga0439462_0012923
681 Ga0450907_044389
682 Ga0439446_0000425
683 Ga0439446_0005075
684 Ga0439446_0026690
685 Ga0439434_0010591
686 Ga0439434_0059462
687 Ga0466963_0000059
688 Ga0466963_0019800
689 Ga0466964_0001483
690 Ga0466971_0009074
691 Ga0466971_0269236
692 Ga0466968_0263419
693 Ga0466957_0034703
694 Ga0466957_0046870
695 Ga0466960_0297433
696 Ga0466959_0508049
697 Ga0451576_0242555
698 Ga0466958_0010875
699 Ga0466958_0011292
700 Ga0466967_0000305
701 Ga0495603_0045442
702 Ga0495641_0021229
703 Ga0495580_0273228
704 Ga0495582_0057505
705 Ga0495582_0110486
706 Ga0495639_0003815
707 Ga0495584_0385751
708 Ga0495594_0017601
709 Ga0495607_0119087
710 Ga0495642_0239626
711 Ga0495598_0052928
712 Ga0495656_0110101
713 Ga0495611_0158948
714 Ga0495661_0265749
715 Ga0495588_0100828
716 Ga0495588_0121550
717 Ga0495658_0055700
718 Ga0495658_0373403
719 Ga0495589_0137808
720 Ga0495581_0002147
721 Ga0495636_0353344
722 Ga0495636_0420458
723 Ga0495676_0211554
724 Ga0496101_0008763
725 Ga0496101_0998084
726 Ga0496102_0012890
727 Ga0496102_0115968
728 Ga0496103_0001779
729 Ga0496103_0031043
730 Ga0496104_0286039
731 Ga0496105_0016150
732 Ga0496105_0239256
733 Ga0496106_0008187
734 Ga0496106_0116498
735 Ga0496107_0008399
736 Ga0496107_0229990
737 Ga0496108_0107672
738 Ga0496109_0030300
739 Ga0496109_0069220
740 Ga0496109_0136237
741 Ga0496109_0316634
742 Ga0496109_0634203
743 Ga0496111_0019287
744 Ga0496112_0001342
745 Ga0496112_0021006
746 Ga0496112_0102144
747 Ga0496112_0497061
748 Ga0496113_0265798
749 Ga0496114_0005912
750 Ga0496115_0759512
751 Ga0501291_028753
752 Ga0501031_0002862
753 Ga0501031_0213460
754 Ga0501032_0318895
755 Ga0501032_0451524
756 Ga0501033_0116374
757 Ga0501034_0284761
758 Ga0501036_0298481
759 Ga0501036_0351674
760 Ga0501037_0069213
761 Ga0501037_0297695
762 Ga0501038_0019964
763 Ga0501038_0046986
764 Ga0501038_0110496
765 Ga0501039_0019654
766 Ga0501040_0025654
767 Ga0501040_0098798
768 Ga0501040_0187509
769 Ga0501040_0262420
770 Ga0501041_0069079
771 Ga0501042_0002850
772 Ga0501042_0058540
773 Ga0501043_0019739
774 Ga0501043_0043359
775 Ga0501046_0022461
776 Ga0501046_0138121
777 Ga0501048_0022680
778 Ga0501048_0027986
779 Ga0501048_0263866
780 Ga0501048_0745483
781 Ga0501067_0002811
782 Ga0501067_0042731
783 Ga0501068_0017001
784 Ga0501068_0049548
785 Ga0501069_0016633
786 Ga0501069_0210194
787 Ga0501070_0006372
788 Ga0501070_0026943
789 Ga0501071_0010601
790 Ga0501071_0027853
791 Ga0501071_0260189
792 Ga0501071_0341782
793 Ga0501072_0000318
794 Ga0501072_0068717
795 Ga0501072_0092858
796 Ga0501072_0720656
797 Ga0501072_0923813
798 Ga0501073_0156424
799 Ga0501074_0002199
800 Ga0501074_0051723
801 Ga0501074_0086052
802 Ga0501075_0052134
803 Ga0501075_0055144
804 Ga0501076_0009703
805 Ga0501076_0040262
806 Ga0501076_0055986
807 Ga0501077_0133910
808 Ga0501079_0032658
809 Ga0501079_0169201
810 Ga0501079_0359174
811 Ga0501080_0049865
812 Ga0501080_0168848
813 Ga0501081_0007407
814 Ga0501081_0188691
815 Ga0501081_0209158
816 Ga0501083_0022258
817 Ga0501083_0104828
818 Ga0501035_0217711
819 Ga0501035_0247076
820 Ga0501044_0158485
821 Ga0501044_0452659
822 Ga0501045_0056670
823 Ga0501045_0090987
824 Ga0501045_0240316
825 Ga0501045_0927112
826 nmdc:mga05p37_307137_c1
827 nmdc:mga05p37_3867_c1
828 nmdc:mga06r32_1054698_c1
829 nmdc:mga06r32_80951_c1
830 nmdc:mga08y16_54014_c1
831 nmdc:mga0n895_106596_c1
832 nmdc:mga0n895_269717_c1
833 nmdc:mga0rr50_160406_c1
834 nmdc:mga0rr50_17989_c1
835 nmdc:mga08x19_52110_c1
836 nmdc:mga0a205_585590_c1
837 Ga0495655_0032539
838 Ga0495655_0072598
839 Ga0495595_0084611
840 Ga0501084_0001046
841 Ga0501084_0412455
842 Ga0501084_1058140
843 Ga0501082_0183265
844 Ga0501082_0322686
845 Ga0501082_0865513
846 Ga0530510_0010226
847 Ga0530510_0073923
848 Ga0530510_0503016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

23

219

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w8g-assembly1.cif.gz_A crystal structure of e. coli k-12 yggs 0.9142 6 197
7ub8-assembly2.cif.gz_B the crystal structure of the k38a/k137a/k233a/k234a quadruple mutant of e. coli yggs in complex with plp 0.9111 6 196
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9089 6 197
7uau-assembly1.cif.gz_A the crystal structure of the k137a mutant of e. coli yggs in complex with plp 0.9061 6 197
7ubp-assembly1.cif.gz_A the crystal structure of the k36a/k137a double mutant of e. coli yggs in complex with plp 0.8992 6 197
ID Description Score Start End Superfamily
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9142 6 197 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.905 7 197 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.888 6 197 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8805 6 196 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8747 7 197 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A538L8S1-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9961 7 197 GO:0009055
GO:0020037
GO:0030170
GO:0046872
AF-A0A538H635-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9955 1 197 GO:0030170
AF-A0A2V2SI98-F1-model_v4 deleted 0.9906 1 197
AF-A0A538E5C1-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9899 1 197 GO:0030170
AF-A0A538GTI3-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9899 1 197 GO:0030170

Map