F440739

General Info

Members Datasets Scaffolds Average Seq Length
424 394 195 228

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10243072|Ga0114129_102430723
Length 260
Sequence VIDAIGAGRIAGPRMSDNARQAMSGLTLVSHHLCPYVQRAAIALAEKGVAFERITVDLADKPAWFKSISPLGKVPLLRVAGPGGGEAVLFESAVICEYIEETQAGPALHPGDAIERAEHRAWIEFGSSILGDIYAIETTPDAALFEAKRQALVQKFARLEGVLGIGPFFAGDRFSLVDAAFGPVFRYFDVFDSIADLGILAGKPKVASWRRALAERPSVRSAVAADYSERLLRFLDARDSHLRTMMHAQRVRPSGSDPVQ

Samples

Sample ID Description Type Environment
1 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
2 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
3 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
4 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
5 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
6 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
7 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
8 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
9 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
10 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
11 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
12 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
13 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
14 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
15 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
16 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
17 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
18 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
19 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
20 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
21 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
22 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
23 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
24 2643221607 Rhizobium sp. Root73 Isolate Unclassified
25 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
26 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
27 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
28 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
29 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
30 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
31 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
32 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
33 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
34 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
35 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
36 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
37 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
38 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
39 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
40 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
41 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
42 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
43 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
44 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
45 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
46 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
47 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
48 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
49 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
50 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
51 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
52 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
53 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
54 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
55 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
56 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
57 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
58 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
59 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
60 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
61 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
62 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
63 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
64 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
65 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
66 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
67 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
68 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
69 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
70 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
71 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
72 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
73 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
74 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
75 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
76 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
77 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
78 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
79 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
80 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
81 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
82 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
83 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
84 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
85 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
86 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
87 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
88 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
89 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
90 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
91 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
92 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
93 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
94 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
95 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
96 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
97 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
98 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
99 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
100 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
101 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
102 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
103 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
104 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
105 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
106 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
107 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
108 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
109 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
110 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
111 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
112 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
113 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
114 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
115 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
116 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
117 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
118 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
119 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
120 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
121 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
122 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
123 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
124 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
125 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
126 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
127 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
128 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
129 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
130 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
131 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
132 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
133 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
134 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
135 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
136 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
137 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
138 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
139 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
140 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
141 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
142 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
143 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
144 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
145 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
146 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
147 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
148 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
149 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
150 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
151 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
152 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
153 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
154 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
155 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
156 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
157 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
158 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
159 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
160 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
161 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
162 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
163 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
164 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
165 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
166 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
167 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
168 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
169 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
170 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
171 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
172 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
173 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
174 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
175 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
176 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
177 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
178 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
179 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
180 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
181 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
182 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
183 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
184 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
185 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
186 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
187 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
188 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
189 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
190 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
191 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
192 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
193 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
194 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
195 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
196 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
197 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
198 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
199 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
200 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
201 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
202 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
203 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
204 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
205 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
206 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
207 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
208 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
209 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
210 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
211 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
212 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
213 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
214 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
215 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
216 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
217 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
218 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
219 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
220 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
221 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
222 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
223 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
224 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
225 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
226 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
227 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
228 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
229 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
230 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
231 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
232 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
233 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
234 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
235 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
236 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
237 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
238 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
239 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
240 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
241 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
242 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
243 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
244 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
245 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
246 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
247 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
248 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
249 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
250 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
251 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
252 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
253 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
254 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
255 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
256 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
257 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
258 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
259 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
260 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
261 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
262 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
263 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
264 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
265 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
266 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
267 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
268 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
269 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
270 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
271 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
272 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
273 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
274 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
275 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
276 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
277 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
278 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
279 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
280 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
281 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
282 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
283 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
284 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
285 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
286 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
287 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
288 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
289 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
290 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
291 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
292 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
293 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
296 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
297 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
298 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
299 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
317 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
319 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
323 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
324 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
325 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
326 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
327 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
328 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
329 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
330 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
331 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
332 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
333 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
334 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
335 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
340 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
378 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
379 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
380 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
381 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
384 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
385 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
386 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
387 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
391 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
392 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
393 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
394 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.28
Metatranscriptomes 0.71
Isolates 54.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.14
Nodule 51.18
Rhizoplane 2.12
Rhizosphere 29.95
Stem 0
Stem Tuber 0
Unclassified 6.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10052974 3300002067 Bacteria 1170
2 JGI25155J39150_1000260 3300002704 Bacteria 19957
3 JGI25162J39368_1006927 3300002737 Bacteria 1849
4 JGI25151J46595_10020322 3300003187 Bacteria 2802
5 JGI25151J46595_10037336 3300003187 Bacteria 1823
6 Ga0055524_1006518 3300003775 Bacteria 5054
7 Ga0055528_1000622 3300003790 Bacteria 26376
8 Ga0070690_100114696 3300005330 Bacteria 1802
9 Ga0070670_100008119 3300005331 Bacteria 8934
10 Ga0068868_100046638 3300005338 Bacteria 3393
11 Ga0070691_10037413 3300005341 Bacteria 2290
12 Ga0070687_100108505 3300005343 Bacteria 1567
13 Ga0070668_100464727 3300005347 Bacteria 1090
14 Ga0070703_10002703 3300005406 Bacteria 5092
15 Ga0070700_100000622 3300005441 Bacteria 17601
16 Ga0070694_100002378 3300005444 Bacteria 11122
17 Ga0070663_100017706 3300005455 Bacteria 4655
18 Ga0070681_10168996 3300005458 Bacteria 2109
19 Ga0070706_100332168 3300005467 Bacteria 1417
20 Ga0070707_100134416 3300005468 Bacteria 2406
21 Ga0070698_100427572 3300005471 Bacteria 1259
22 Ga0070699_100000299 3300005518 Bacteria 47843
23 Ga0068853_100352104 3300005539 Bacteria 1370
24 Ga0070695_100002830 3300005545 Bacteria 10082
25 Ga0070696_100021410 3300005546 Bacteria 4383
26 Ga0070693_100060713 3300005547 Bacteria 2195
27 Ga0070665_100049525 3300005548 Bacteria 4215
28 Ga0070665_100435206 3300005548 Bacteria 1321
29 Ga0070704_100001096 3300005549 Bacteria 14044
30 Ga0068855_100020047 3300005563 Bacteria 8029
31 Ga0068855_100180186 3300005563 Bacteria 2389
32 Ga0068857_100007474 3300005577 Bacteria 9407
33 Ga0070702_100029972 3300005615 Bacteria 2963
34 Ga0068859_100060624 3300005617 Bacteria 3812
35 Ga0068864_100199346 3300005618 Bacteria 1838
36 Ga0068863_100096296 3300005841 Bacteria 2810
37 Ga0068863_100716789 3300005841 Bacteria 995
38 Ga0068858_100835549 3300005842 Bacteria 899
39 Ga0068860_100024863 3300005843 Bacteria 5782
40 Ga0068860_100425940 3300005843 Bacteria 1316
41 Ga0068862_100069748 3300005844 Bacteria 3034
42 Ga0081538_10032497 3300005981 Bacteria 3495
43 Ga0075365_10018398 3300006038 Bacteria 4294
44 Ga0075365_10162854 3300006038 Bacteria 1555
45 Ga0075368_10024291 3300006042 Bacteria 2321
46 Ga0075363_100042165 3300006048 Bacteria 2410
47 Ga0075362_10062775 3300006177 Bacteria 1683
48 Ga0075367_10069644 3300006178 Bacteria 2112
49 Ga0075366_10133407 3300006195 Bacteria 1499
50 Ga0075428_100013384 3300006844 Bacteria 9125
51 Ga0075428_100109316 3300006844 Bacteria 3013
52 Ga0075430_100032009 3300006846 Bacteria 4464
53 Ga0075431_100001187 3300006847 Bacteria 23494
54 Ga0075431_100005359 3300006847 Bacteria 12660
55 Ga0097620_100060624 3300006931 Bacteria 3812
56 Ga0079104_1040465 3300006946 Bacteria 1091
57 Ga0099795_10145239 3300007788 Bacteria 968
58 Ga0105245_10158355 3300009098 Bacteria 2147
59 Ga0114129_10243072 3300009147 Bacteria 2419
60 Ga0105237_10166157 3300009545 Bacteria 2206
61 Ga0105238_10009682 3300009551 Bacteria 9647
62 Ga0105238_10073950 3300009551 Bacteria 3402
63 Ga0105249_10006694 3300009553 Bacteria 10039
64 Ga0099796_10017635 3300010159 Bacteria 2130
65 Ga0105239_10292348 3300010375 Bacteria 1835
66 Ga0157370_10039032 3300013104 Bacteria 4591
67 Ga0157369_10000359 3300013105 Bacteria 60703
68 Ga0157369_10000600 3300013105 Bacteria 46908
69 Ga0157369_10350108 3300013105 Bacteria 1534
70 Ga0157374_10000039 3300013296 Bacteria 164906
71 Ga0157374_10497649 3300013296 Bacteria 1223
72 Ga0157374_10879379 3300013296 Bacteria 913
73 Ga0157378_10573195 3300013297 Bacteria 1137
74 Ga0157372_10074001 3300013307 Bacteria 3840
75 Ga0157375_10352322 3300013308 Bacteria 1638
76 Ga0182008_10051837 3300014497 Bacteria 2035
77 Ga0157379_10077870 3300014968 Bacteria 2969
78 Ga0157376_10164164 3300014969 Bacteria 2016
79 Ga0224712_10000148 3300022467 Bacteria 11783
80 Ga0209759_1007631 3300025256 Bacteria 3457
81 Ga0209129_1000066 3300025258 Bacteria 226820
82 Ga0209673_1000024 3300025273 Bacteria 409632
83 Ga0209676_1026889 3300025292 Bacteria 1818
84 Ga0209025_1000557 3300025294 Bacteria 69226
85 Ga0209025_1001191 3300025294 Bacteria 36782
86 Ga0209564_1020651 3300025295 Bacteria 2403
87 Ga0209564_1036690 3300025295 Bacteria 1394
88 Ga0209758_1000399 3300025297 Bacteria 75022
89 Ga0209256_1002327 3300025299 Bacteria 15865
90 Ga0209051_1011512 3300025303 Bacteria 4360
91 Ga0209257_1031220 3300025304 Bacteria 1706
92 Ga0207653_10001485 3300025885 Bacteria 7598
93 Ga0207684_10245393 3300025910 Bacteria 1545
94 Ga0207695_10039021 3300025913 Bacteria 5107
95 Ga0207662_10061151 3300025918 Bacteria 2261
96 Ga0207646_10541892 3300025922 Bacteria 1047
97 Ga0207694_10017491 3300025924 Bacteria 5418
98 Ga0207694_10061937 3300025924 Bacteria 2912
99 Ga0207687_10076788 3300025927 Bacteria 2400
100 Ga0207689_10079794 3300025942 Bacteria 2689
101 Ga0207667_10329630 3300025949 Bacteria 1559
102 Ga0207668_10623952 3300025972 Bacteria 941
103 Ga0207678_10035481 3300026067 Bacteria 4342
104 Ga0207708_10013507 3300026075 Bacteria 6106
105 Ga0207641_10168422 3300026088 Bacteria 1997
106 Ga0207674_10002654 3300026116 Bacteria 22335
107 Ga0207683_10039816 3300026121 Bacteria 4100
108 Ga0209281_1001086 3300027111 Bacteria 20029
109 Ga0209179_1004715 3300027512 Bacteria 2080
110 Ga0209813_10020300 3300027866 Bacteria 1857
111 Ga0268266_10102780 3300028379 Bacteria 2521
112 Ga0268265_10003261 3300028380 Bacteria 11767
113 Ga0268264_10002472 3300028381 Bacteria 16244
114 Ga0268264_10060812 3300028381 Bacteria 3166
115 Ga0307512_10041318 3300030522 Bacteria 3834
116 Ga0307408_100255580 3300031548 Bacteria 1447
117 Ga0265314_10020185 3300031711 Bacteria 5145
118 Ga0307410_10207574 3300031852 Bacteria 1499
119 Ga0373958_0082160 3300034819 Bacteria 731
120 Ga0373936_0072641 3300035113 Bacteria 1421
121 Ga0395901_0024007 3300038443 Bacteria 6254
122 Ga0395901_0126939 3300038443 Bacteria 2680
123 Ga0400490_32195 3300038726 Bacteria 18163
124 Ga0400488_07419 3300038741 Bacteria 21837
125 Ga0400488_48955 3300038741 Bacteria 2284
126 Ga0400483_110957 3300039062 Bacteria 13309
127 Ga0400483_141821 3300039062 Bacteria 11200
128 Ga0400483_147151 3300039062 Unclassified 4843
129 Ga0400483_150738 3300039062 Bacteria 10438
130 Ga0400487_20876 3300039110 Bacteria 9973
131 Ga0400487_58018 3300039110 Bacteria 3743
132 Ga0439448_0005842 3300042005 Bacteria 3517
133 Ga0439449_0001016 3300042007 Bacteria 11058
134 Ga0439455_0041785 3300042012 Bacteria 1176
135 Ga0495638_0082508 3300046460 Bacteria 1950
136 Ga0495650_0000265 3300046471 Bacteria 100744
137 Ga0495606_0001030 3300046507 Bacteria 40419
138 Ga0495642_0146205 3300046528 Bacteria 1021
139 Ga0495625_0021983 3300046660 Bacteria 4898
140 Ga0496102_0005942 3300048905 Bacteria 10395
141 Ga0496102_0613870 3300048905 Bacteria 1011
142 Ga0496103_0022733 3300048906 Bacteria 3777
143 Ga0496104_0709773 3300048907 Bacteria 913
144 Ga0496106_0039585 3300048909 Bacteria 3530
145 Ga0496108_0347118 3300048911 Bacteria 1295
146 Ga0496110_0517682 3300048913 Bacteria 1085
147 Ga0496115_0094460 3300048918 Bacteria 2446
148 Ga0496121_0029072 3300048924 Bacteria 5124
149 Ga0496121_0146907 3300048924 Bacteria 1741
150 Ga0496121_0181856 3300048924 Bacteria 1516
151 Ga0496124_0086140 3300048927 Bacteria 2572
152 Ga0496125_0201406 3300048928 Bacteria 1303
153 Ga0501309_009602 3300049129 Bacteria 1237
154 Ga0501312_008017 3300049528 Bacteria 1361
155 Ga0501033_0156669 3300049570 Bacteria 1641
156 Ga0501034_0586606 3300049571 Bacteria 1021
157 Ga0501039_0635128 3300049575 Unclassified 836
158 Ga0501040_0125600 3300049576 Bacteria 1802
159 Ga0501041_0031144 3300049577 Bacteria 3221
160 Ga0501043_0237390 3300049579 Unclassified 1407
161 Ga0501047_0106598 3300049581 Bacteria 2683
162 Ga0501068_0221281 3300049584 Bacteria 1203
163 Ga0501072_0106976 3300049588 Bacteria 2225
164 Ga0501074_0114964 3300049590 Unclassified 1925
165 Ga0501076_0157437 3300049592 Bacteria 1850
166 Ga0501079_0051826 3300049741 Bacteria 3169
167 Ga0501079_0162878 3300049741 Bacteria 1739
168 Ga0501045_0011329 3300049824 Bacteria 6260
169 Ga0501045_0029513 3300049824 Bacteria 3965
170 nmdc:mga03683_43584_c1 3300050489 Bacteria 1851
171 nmdc:mga0yw44_247435_c1 3300050492 Bacteria 1186
172 nmdc:mga0k408_148344_c1 3300050493 Bacteria 888
173 nmdc:mga06z11_165728_c1 3300050494 Bacteria 1266
174 nmdc:mga04h51_11164_c1 3300050495 Bacteria 2487
175 nmdc:mga07m45_137603_c1 3300050496 Bacteria 1414
176 nmdc:mga07m45_363147_c1 3300050496 Bacteria 841
177 nmdc:mga05p37_248234_c1 3300050507 Bacteria 2136
178 nmdc:mga09592_101814_c1 3300050508 Bacteria 2461
179 nmdc:mga0qj67_452126_c1 3300050509 Bacteria 1035
180 nmdc:mga06r32_64730_c1 3300050510 Bacteria 3526
181 nmdc:mga06r32_78104_c1 3300050510 Bacteria 3217
182 Ga0500566_0000164 3300053094 Bacteria 33959
183 Ga0500640_060456 3300053095 Bacteria 1643
184 Ga0500572_003861 3300053111 Bacteria 3408
185 Ga0500591_005506 3300053115 Bacteria 5684
186 Ga0500593_015278 3300053117 Bacteria 3306
187 Ga0500608_034547 3300053122 Bacteria 2409
188 Ga0500559_0005326 3300053136 Bacteria 5928
189 Ga0500603_000674 3300053150 Bacteria 8318
190 Ga0500630_002325 3300053159 Bacteria 9178
191 Ga0500638_013802 3300053162 Bacteria 3668
192 Ga0500639_000001 3300053163 Bacteria 244795
193 Ga0500596_000389 3300053735 Bacteria 8009
194 Ga0501084_0039301 3300054114 Bacteria 3958
195 Ga0501082_0042495 3300060353 Bacteria 3919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_141821 Ga0400483_141821_9213_9797 174
2 3300039062 Ga0400483_150738 Ga0400483_150738_6034_6618 174
3 3300013296 Ga0157374_10497649 Ga0157374_104976491 204
4 3300049571 Ga0501034_0586606 Ga0501034_0586606_158_787 206
5 3300038443 Ga0395901_0126939 Ga0395901_0126939_2016_2660 211
6 3300050509 nmdc:mga0qj67_452126_c1 nmdc:mga0qj67_452126_c1_15_662 211
7 3300034819 Ga0373958_0082160 Ga0373958_0082160_35_706 214
8 3300038726 Ga0400490_32195 Ga0400490_32195_14979_15638 215
9 3300038741 Ga0400488_48955 Ga0400488_48955_719_1378 215
10 3300039062 Ga0400483_110957 Ga0400483_110957_11307_11966 215
11 3300039062 Ga0400483_147151 Ga0400483_147151_1770_2429 215
12 3300039110 Ga0400487_20876 Ga0400487_20876_3410_4063 215
13 3300039110 Ga0400487_58018 Ga0400487_58018_1582_2241 215
14 3300005981 Ga0081538_10032497 Ga0081538_100324974 218
15 3300006178 Ga0075367_10069644 Ga0075367_100696443 218
16 3300006195 Ga0075366_10133407 Ga0075366_101334072 218
17 3300026121 Ga0207683_10039816 Ga0207683_100398162 218
18 3300030522 Ga0307512_10041318 Ga0307512_100413182 218
19 3300038741 Ga0400488_07419 Ga0400488_07419_817_1479 218
20 3300046660 Ga0495625_0021983 Ga0495625_0021983_359_1030 218
21 3300050493 nmdc:mga0k408_148344_c1 nmdc:mga0k408_148344_c1_81_755 218
22 3300050496 nmdc:mga07m45_363147_c1 nmdc:mga07m45_363147_c1_114_788 218
23 3300002704 JGI25155J39150_1000260 JGI25155J39150_100026020 219
24 3300002737 JGI25162J39368_1006927 JGI25162J39368_10069272 219
25 3300005331 Ga0070670_100008119 Ga0070670_1000081194 219
26 3300009551 Ga0105238_10073950 Ga0105238_100739503 219
27 3300010375 Ga0105239_10292348 Ga0105239_102923483 219
28 3300025924 Ga0207694_10017491 Ga0207694_100174911 219
29 3300049570 Ga0501033_0156669 Ga0501033_0156669_609_1346 219
30 3300049577 Ga0501041_0031144 Ga0501041_0031144_1700_2437 219
31 3300049588 Ga0501072_0106976 Ga0501072_0106976_779_1516 219
32 3300049741 Ga0501079_0162878 Ga0501079_0162878_917_1654 219
33 3300049824 Ga0501045_0011329 Ga0501045_0011329_174_911 219
34 3300054114 Ga0501084_0039301 Ga0501084_0039301_2643_3380 219
35 iso_pu_bacteria 2767802442 2770194718 219
36 iso_pu_bacteria 2775506904 2776284436 219
37 iso_pu_bacteria 2908756301 2908761028 219
38 3300005338 Ga0068868_100046638 Ga0068868_1000466384 220
39 3300005841 Ga0068863_100096296 Ga0068863_1000962964 220
40 3300005843 Ga0068860_100425940 Ga0068860_1004259402 220
41 3300009098 Ga0105245_10158355 Ga0105245_101583552 220
42 3300009551 Ga0105238_10009682 Ga0105238_100096828 220
43 3300013308 Ga0157375_10352322 Ga0157375_103523222 220
44 3300014968 Ga0157379_10077870 Ga0157379_100778704 220
45 3300014969 Ga0157376_10164164 Ga0157376_101641643 220
46 3300025924 Ga0207694_10061937 Ga0207694_100619374 220
47 3300025927 Ga0207687_10076788 Ga0207687_100767883 220
48 3300026088 Ga0207641_10168422 Ga0207641_101684222 220
49 3300028381 Ga0268264_10060812 Ga0268264_100608123 220
50 3300031548 Ga0307408_100255580 Ga0307408_1002555802 220
51 3300031852 Ga0307410_10207574 Ga0307410_102075742 220
52 3300035113 Ga0373936_0072641 Ga0373936_0072641_576_1250 220
53 3300048924 Ga0496121_0146907 Ga0496121_0146907_977_1699 220
54 3300049129 Ga0501309_009602 Ga0501309_009602_101_772 220
55 3300049528 Ga0501312_008017 Ga0501312_008017_462_1133 220
56 3300005548 Ga0070665_100049525 Ga0070665_1000495253 221
57 3300005842 Ga0068858_100835549 Ga0068858_1008355491 221
58 3300007788 Ga0099795_10145239 Ga0099795_101452391 221
59 3300010159 Ga0099796_10017635 Ga0099796_100176352 221
60 3300013296 Ga0157374_10879379 Ga0157374_108793791 221
61 3300013297 Ga0157378_10573195 Ga0157378_105731952 221
62 3300027512 Ga0209179_1004715 Ga0209179_10047151 221
63 3300046471 Ga0495650_0000265 Ga0495650_0000265_97965_98645 221
64 3300046507 Ga0495606_0001030 Ga0495606_0001030_2060_2740 221
65 3300046528 Ga0495642_0146205 Ga0495642_0146205_203_883 221
66 3300049581 Ga0501047_0106598 Ga0501047_0106598_1806_2480 221
67 3300050492 nmdc:mga0yw44_247435_c1 nmdc:mga0yw44_247435_c1_13_693 221
68 3300053094 Ga0500566_0000164 Ga0500566_0000164_26033_26707 221
69 3300053095 Ga0500640_060456 Ga0500640_060456_655_1329 221
70 3300053111 Ga0500572_003861 Ga0500572_003861_1682_2356 221
71 3300053115 Ga0500591_005506 Ga0500591_005506_924_1598 221
72 3300053122 Ga0500608_034547 Ga0500608_034547_1118_1792 221
73 3300053136 Ga0500559_0005326 Ga0500559_0005326_3792_4466 221
74 3300053150 Ga0500603_000674 Ga0500603_000674_1114_1788 221
75 3300053159 Ga0500630_002325 Ga0500630_002325_609_1283 221
76 3300053162 Ga0500638_013802 Ga0500638_013802_1861_2535 221
77 3300053163 Ga0500639_000001 Ga0500639_000001_169366_170040 221
78 3300053735 Ga0500596_000389 Ga0500596_000389_3581_4255 221
79 iso_pu_bacteria 2791355253 2793279869 221
80 iso_pu_bacteria 2842482326 2842487936 221
81 iso_pu_bacteria 3005445848 3005447975 221
82 3300049576 Ga0501040_0125600 Ga0501040_0125600_667_1404 222
83 iso_pu_bacteria 2510065057 2510308136 222
84 iso_pu_bacteria 2511231052 2511498913 222
85 iso_pu_bacteria 2512047086 2512535044 222
86 iso_pu_bacteria 2513237086 2513586828 222
87 iso_pu_bacteria 2513237091 2513619130 222
88 iso_pu_bacteria 2513237140 2513882619 222
89 iso_pu_bacteria 2513237143 2513904602 222
90 iso_pu_bacteria 2515154107 2515607331 222
91 iso_pu_bacteria 2516653046 2516895189 222
92 iso_pu_bacteria 2524023207 2524450924 222
93 iso_pu_bacteria 2551306084 2551675249 222
94 iso_pu_bacteria 2551306085 2551684530 222
95 iso_pu_bacteria 2551306086 2551694882 222
96 iso_pu_bacteria 2551306087 2551699647 222
97 iso_pu_bacteria 2551306089 2551709263 222
98 iso_pu_bacteria 2551306090 2551720823 222
99 iso_pu_bacteria 2551306091 2551727983 222
100 iso_pu_bacteria 2551306092 2551732984 222
101 iso_pu_bacteria 2551306093 2551741162 222
102 iso_pu_bacteria 2838074704 2838074949 222
103 iso_pu_bacteria 2855825444 2855827827 222
104 iso_pu_bacteria 2855839649 2855843195 222
105 iso_pu_bacteria 2858800743 2858802923 222
106 iso_pu_bacteria 2915986958 2915989807 222
107 iso_pu_bacteria 2915993759 2915998272 222
108 iso_pu_bacteria 2916000859 2916004931 222
109 iso_pu_bacteria 2916007675 2916014203 222
110 iso_pu_bacteria 2916021584 2916028002 222
111 iso_pu_bacteria 2916028427 2916033709 222
112 iso_pu_bacteria 2916035215 2916040549 222
113 iso_pu_bacteria 2916041962 2916047397 222
114 iso_pu_bacteria 2916048683 2916054866 222
115 iso_pu_bacteria 2916055098 2916058971 222
116 iso_pu_bacteria 2916076590 2916078745 222
117 iso_pu_bacteria 2920760137 2920763805 222
118 iso_pu_bacteria 2921201388 2921203741 222
119 iso_pu_bacteria 2921237296 2921243368 222
120 iso_pu_bacteria 2921244191 2921250254 222
121 iso_pu_bacteria 2921257292 2921263525 222
122 iso_pu_bacteria 2921263974 2921269465 222
123 iso_pu_bacteria 2921282425 2921289041 222
124 iso_pu_bacteria 2921289301 2921295246 222
125 iso_pu_bacteria 2921296804 2921301428 222
126 iso_pu_bacteria 2924144063 2924149132 222
127 iso_pu_bacteria 2924150972 2924154910 222
128 iso_pu_bacteria 2924158325 2924164519 222
129 iso_pu_bacteria 2924165586 2924171635 222
130 iso_pu_bacteria 2924172951 2924177369 222
131 iso_pu_bacteria 2924179722 2924185586 222
132 iso_pu_bacteria 2924186466 2924191156 222
133 iso_pu_bacteria 2924193448 2924198120 222
134 iso_pu_bacteria 2924200457 2924204948 222
135 iso_pu_bacteria 2924207177 2924211761 222
136 iso_pu_bacteria 2924214083 2924216004 222
137 iso_pu_bacteria 2924221636 2924221872 222
138 iso_pu_bacteria 2924228884 2924234712 222
139 iso_pu_bacteria 2936996657 2936998681 222
140 iso_pu_bacteria 2937002841 2937008939 222
141 iso_pu_bacteria 2937009748 2937013930 222
142 iso_pu_bacteria 2937016420 2937020844 222
143 iso_pu_bacteria 2937023124 2937025705 222
144 iso_pu_bacteria 2937042894 2937048951 222
145 iso_pu_bacteria 2937049772 2937050101 222
146 iso_pu_bacteria 2937056579 2937061930 222
147 iso_pu_bacteria 2937063883 2937071038 222
148 iso_pu_bacteria 2937071275 2937078178 222
149 iso_pu_bacteria 2937091812 2937098892 222
150 iso_pu_bacteria 2937098957 2937101073 222
151 iso_pu_bacteria 2937106411 2937112309 222
152 iso_pu_bacteria 2937113482 2937118522 222
153 iso_pu_bacteria 2937119839 2937121848 222
154 iso_pu_bacteria 2937126314 2937131946 222
155 iso_pu_bacteria 2957382221 2957386917 222
156 iso_pu_bacteria 2957388812 2957393758 222
157 iso_pu_bacteria 2957395598 2957401781 222
158 iso_pu_bacteria 2957402308 2957405619 222
159 iso_pu_bacteria 2957408893 2957413788 222
160 iso_pu_bacteria 2957415311 2957421917 222
161 iso_pu_bacteria 2957422303 2957428258 222
162 iso_pu_bacteria 2957430029 2957434372 222
163 iso_pu_bacteria 2957443900 2957449808 222
164 iso_pu_bacteria 2957450854 2957456156 222
165 iso_pu_bacteria 2957457609 2957462229 222
166 iso_pu_bacteria 2957464669 2957469119 222
167 iso_pu_bacteria 2957471148 2957475490 222
168 iso_pu_bacteria 2957478035 2957482452 222
169 iso_pu_bacteria 2957484790 2957491484 222
170 iso_pu_bacteria 2957491536 2957493756 222
171 iso_pu_bacteria 2957505466 2957510504 222
172 iso_pu_bacteria 2960584000 2960588386 222
173 iso_pu_bacteria 2960597568 2960600461 222
174 iso_pu_bacteria 2960603979 2960605714 222
175 iso_pu_bacteria 2960610863 2960615308 222
176 iso_pu_bacteria 2960617483 2960622857 222
177 iso_pu_bacteria 2960624210 2960625818 222
178 iso_pu_bacteria 2960637947 2960640963 222
179 iso_pu_bacteria 2960645483 2960646801 222
180 iso_pu_bacteria 2960652885 2960659527 222
181 iso_pu_bacteria 2960660292 2960666613 222
182 iso_pu_bacteria 2960667422 2960673074 222
183 iso_pu_bacteria 2960674078 2960677946 222
184 iso_pu_bacteria 2960687367 2960688493 222
185 iso_pu_bacteria 2964607997 2964609202 222
186 iso_pu_bacteria 2964615318 2964618174 222
187 iso_pu_bacteria 2964621998 2964627934 222
188 iso_pu_bacteria 2964628898 2964634712 222
189 iso_pu_bacteria 2964636051 2964641877 222
190 iso_pu_bacteria 2964643177 2964648133 222
191 iso_pu_bacteria 2964649959 2964655063 222
192 iso_pu_bacteria 2964656573 2964661864 222
193 iso_pu_bacteria 2964663802 2964668557 222
194 iso_pu_bacteria 2964670856 2964675130 222
195 iso_pu_bacteria 2964678106 2964681381 222
196 iso_pu_bacteria 2964685014 2964690374 222
197 iso_pu_bacteria 2964691889 2964697628 222
198 iso_pu_bacteria 2964698721 2964704052 222
199 iso_pu_bacteria 2964705432 2964708936 222
200 iso_pu_bacteria 2964712639 2964718062 222
201 iso_pu_bacteria 2964719344 2964722488 222
202 iso_pu_bacteria 2967664464 2967665812 222
203 iso_pu_bacteria 2967671571 2967673045 222
204 iso_pu_bacteria 2967678726 2967684580 222
205 iso_pu_bacteria 2967693043 2967697552 222
206 iso_pu_bacteria 2967699805 2967706512 222
207 iso_pu_bacteria 2967706974 2967713186 222
208 iso_pu_bacteria 2967714385 2967720256 222
209 iso_pu_bacteria 2967721400 2967727643 222
210 iso_pu_bacteria 2967735183 2967735655 222
211 iso_pu_bacteria 2967742019 2967742592 222
212 iso_pu_bacteria 2967748971 2967749620 222
213 iso_pu_bacteria 2967755722 2967758431 222
214 iso_pu_bacteria 2967762386 2967767640 222
215 iso_pu_bacteria 2967769361 2967774447 222
216 iso_pu_bacteria 2967775926 2967781275 222
217 iso_pu_bacteria 2970019648 2970021799 222
218 iso_pu_bacteria 2970033650 2970039961 222
219 iso_pu_bacteria 2970040964 2970046698 222
220 iso_pu_bacteria 2970047711 2970050202 222
221 iso_pu_bacteria 2970054988 2970060552 222
222 iso_pu_bacteria 2970061556 2970067758 222
223 iso_pu_bacteria 2970068827 2970075719 222
224 iso_pu_bacteria 2970076120 2970081367 222
225 iso_pu_bacteria 2970082768 2970085141 222
226 iso_pu_bacteria 2970088815 2970093789 222
227 iso_pu_bacteria 2970095765 2970101443 222
228 iso_pu_bacteria 2970102677 2970106186 222
229 iso_pu_bacteria 2970109326 2970115390 222
230 iso_pu_bacteria 2970116247 2970121331 222
231 iso_pu_bacteria 2970129317 2970133841 222
232 iso_pu_bacteria 2970136068 2970142295 222
233 iso_pu_bacteria 2970149975 2970154598 222
234 iso_pu_bacteria 2970156795 2970157261 222
235 iso_pu_bacteria 2970164137 2970169699 222
236 iso_pu_bacteria 2970170962 2970174015 222
237 iso_pu_bacteria 2970177841 2970182480 222
238 iso_pu_bacteria 2970184632 2970186979 222
239 iso_pu_bacteria 2970191845 2970197757 222
240 iso_pu_bacteria 2977516862 2977519189 222
241 iso_pu_bacteria 2977523885 2977527032 222
242 iso_pu_bacteria 2977537788 2977542774 222
243 iso_pu_bacteria 2977551784 2977557672 222
244 iso_pu_bacteria 2977558990 2977564670 222
245 iso_pu_bacteria 2977565890 2977569946 222
246 iso_pu_bacteria 2977572785 2977578898 222
247 iso_pu_bacteria 2977579622 2977584574 222
248 iso_pu_bacteria 648276728 648736651 222
249 iso_pu_bacteria 8003992118 8003995777 222
250 3300005330 Ga0070690_100114696 Ga0070690_1001146962 223
251 3300005341 Ga0070691_10037413 Ga0070691_100374133 223
252 3300005343 Ga0070687_100108505 Ga0070687_1001085053 223
253 3300005347 Ga0070668_100464727 Ga0070668_1004647271 223
254 3300005406 Ga0070703_10002703 Ga0070703_100027033 223
255 3300005441 Ga0070700_100000622 Ga0070700_10000062217 223
256 3300005444 Ga0070694_100002378 Ga0070694_10000237814 223
257 3300005455 Ga0070663_100017706 Ga0070663_1000177062 223
258 3300005458 Ga0070681_10168996 Ga0070681_101689962 223
259 3300005467 Ga0070706_100332168 Ga0070706_1003321681 223
260 3300005468 Ga0070707_100134416 Ga0070707_1001344163 223
261 3300005471 Ga0070698_100427572 Ga0070698_1004275722 223
262 3300005518 Ga0070699_100000299 Ga0070699_10000029934 223
263 3300005539 Ga0068853_100352104 Ga0068853_1003521042 223
264 3300005545 Ga0070695_100002830 Ga0070695_10000283010 223
265 3300005546 Ga0070696_100021410 Ga0070696_1000214103 223
266 3300005547 Ga0070693_100060713 Ga0070693_1000607131 223
267 3300005549 Ga0070704_100001096 Ga0070704_1000010962 223
268 3300005577 Ga0068857_100007474 Ga0068857_1000074743 223
269 3300005615 Ga0070702_100029972 Ga0070702_1000299723 223
270 3300005617 Ga0068859_100060624 Ga0068859_1000606243 223
271 3300005618 Ga0068864_100199346 Ga0068864_1001993461 223
272 3300005843 Ga0068860_100024863 Ga0068860_1000248633 223
273 3300005844 Ga0068862_100069748 Ga0068862_1000697483 223
274 3300006931 Ga0097620_100060624 Ga0097620_1000606243 223
275 3300009553 Ga0105249_10006694 Ga0105249_100066948 223
276 3300025885 Ga0207653_10001485 Ga0207653_100014853 223
277 3300025910 Ga0207684_10245393 Ga0207684_102453932 223
278 3300025918 Ga0207662_10061151 Ga0207662_100611513 223
279 3300025922 Ga0207646_10541892 Ga0207646_105418921 223
280 3300025942 Ga0207689_10079794 Ga0207689_100797943 223
281 3300025972 Ga0207668_10623952 Ga0207668_106239522 223
282 3300026067 Ga0207678_10035481 Ga0207678_100354814 223
283 3300026075 Ga0207708_10013507 Ga0207708_100135074 223
284 3300026116 Ga0207674_10002654 Ga0207674_1000265415 223
285 3300028380 Ga0268265_10003261 Ga0268265_100032619 223
286 3300028381 Ga0268264_10002472 Ga0268264_1000247218 223
287 3300048905 Ga0496102_0005942 Ga0496102_0005942_4821_5501 223
288 3300048906 Ga0496103_0022733 Ga0496103_0022733_2650_3330 223
289 3300048909 Ga0496106_0039585 Ga0496106_0039585_2007_2687 223
290 3300048918 Ga0496115_0094460 Ga0496115_0094460_1568_2248 223
291 iso_pu_bacteria 2582581283 2585164567 223
292 iso_pu_bacteria 2643221607 2644051486 223
293 iso_pu_bacteria 2643221636 2644199983 223
294 iso_pu_bacteria 2643221686 2644480355 223
295 3300031711 Ga0265314_10020185 Ga0265314_100201852 224
296 iso_pu_bacteria 2791355123 2792749388 224
297 iso_pu_bacteria 2871451962 2871455897 224
298 iso_pu_bacteria 2874168670 2874174661 224
299 3300003187 JGI25151J46595_10020322 JGI25151J46595_100203222 225
300 3300003187 JGI25151J46595_10037336 JGI25151J46595_100373362 225
301 3300003775 Ga0055524_1006518 Ga0055524_10065184 225
302 3300003790 Ga0055528_1000622 Ga0055528_100062218 225
303 3300005548 Ga0070665_100435206 Ga0070665_1004352062 225
304 3300005841 Ga0068863_100716789 Ga0068863_1007167891 225
305 3300006844 Ga0075428_100109316 Ga0075428_1001093164 225
306 3300006847 Ga0075431_100001187 Ga0075431_10000118722 225
307 3300025258 Ga0209129_1000066 Ga0209129_100006681 225
308 3300025273 Ga0209673_1000024 Ga0209673_1000024184 225
309 3300025292 Ga0209676_1026889 Ga0209676_10268892 225
310 3300025294 Ga0209025_1000557 Ga0209025_100055713 225
311 3300025294 Ga0209025_1001191 Ga0209025_100119134 225
312 3300025295 Ga0209564_1020651 Ga0209564_10206512 225
313 3300025295 Ga0209564_1036690 Ga0209564_10366902 225
314 3300025297 Ga0209758_1000399 Ga0209758_100039930 225
315 3300025299 Ga0209256_1002327 Ga0209256_10023279 225
316 3300025303 Ga0209051_1011512 Ga0209051_10115124 225
317 3300025304 Ga0209257_1031220 Ga0209257_10312202 225
318 3300049575 Ga0501039_0635128 Ga0501039_0635128_116_811 225
319 3300049579 Ga0501043_0237390 Ga0501043_0237390_636_1331 225
320 3300049590 Ga0501074_0114964 Ga0501074_0114964_580_1275 225
321 3300049741 Ga0501079_0051826 Ga0501079_0051826_145_840 225
322 3300049824 Ga0501045_0029513 Ga0501045_0029513_1602_2297 225
323 3300050510 nmdc:mga06r32_78104_c1 nmdc:mga06r32_78104_c1_1226_1915 225
324 3300053117 Ga0500593_015278 Ga0500593_015278_2240_2923 225
325 3300060353 Ga0501082_0042495 Ga0501082_0042495_170_865 225
326 3300006946 Ga0079104_1040465 Ga0079104_10404652 226
327 3300027111 Ga0209281_1001086 Ga0209281_100108620 226
328 3300042007 Ga0439449_0001016 Ga0439449_0001016_7416_8102 226
329 iso_pu_bacteria 2509276022 2509396450 226
330 3300006844 Ga0075428_100013384 Ga0075428_1000133849 227
331 3300006846 Ga0075430_100032009 Ga0075430_1000320093 227
332 3300006847 Ga0075431_100005359 Ga0075431_10000535911 227
333 3300048924 Ga0496121_0029072 Ga0496121_0029072_2416_3105 227
334 3300048924 Ga0496121_0181856 Ga0496121_0181856_609_1298 227
335 3300048927 Ga0496124_0086140 Ga0496124_0086140_1661_2350 227
336 3300048928 Ga0496125_0201406 Ga0496125_0201406_285_974 227
337 3300050496 nmdc:mga07m45_137603_c1 nmdc:mga07m45_137603_c1_459_1148 227
338 3300006038 Ga0075365_10018398 Ga0075365_100183985 228
339 3300006042 Ga0075368_10024291 Ga0075368_100242913 228
340 3300006048 Ga0075363_100042165 Ga0075363_1000421652 228
341 3300027866 Ga0209813_10020300 Ga0209813_100203002 228
342 3300028379 Ga0268266_10102780 Ga0268266_101027804 228
343 3300046460 Ga0495638_0082508 Ga0495638_0082508_636_1349 228
344 3300048905 Ga0496102_0613870 Ga0496102_0613870_26_739 228
345 3300048907 Ga0496104_0709773 Ga0496104_0709773_102_818 228
346 3300048911 Ga0496108_0347118 Ga0496108_0347118_249_962 228
347 3300048913 Ga0496110_0517682 Ga0496110_0517682_213_929 228
348 3300049584 Ga0501068_0221281 Ga0501068_0221281_479_1189 228
349 3300050494 nmdc:mga06z11_165728_c1 nmdc:mga06z11_165728_c1_398_1117 228
350 3300050495 nmdc:mga04h51_11164_c1 nmdc:mga04h51_11164_c1_1022_1741 228
351 3300049592 Ga0501076_0157437 Ga0501076_0157437_835_1572 229
352 3300038443 Ga0395901_0024007 Ga0395901_0024007_3686_4426 230
353 3300013105 Ga0157369_10000600 Ga0157369_1000060042 231
354 3300050508 nmdc:mga09592_101814_c1 nmdc:mga09592_101814_c1_1699_2412 231
355 iso_pu_bacteria 2856328259 2856331244 231
356 iso_pu_bacteria 2856334872 2856338262 231
357 iso_pu_bacteria 2857367948 2857373910 231
358 iso_pu_bacteria 2869249662 2869256123 231
359 iso_pu_bacteria 2869264136 2869270185 231
360 iso_pu_bacteria 2869271264 2869277792 231
361 iso_pu_bacteria 2871459585 2871462690 231
362 iso_pu_bacteria 2874131515 2874136612 231
363 iso_pu_bacteria 2874162495 2874165620 231
364 iso_pu_bacteria 2876399893 2876401446 231
365 iso_pu_bacteria 2878774303 2878776165 231
366 iso_pu_bacteria 2878781027 2878788477 231
367 iso_pu_bacteria 2906363423 2906367349 231
368 iso_pu_bacteria 2906370794 2906371526 231
369 iso_pu_bacteria 2906393657 2906397385 231
370 iso_pu_bacteria 2906408224 2906413917 231
371 iso_pu_bacteria 2922151315 2922157223 231
372 iso_pu_bacteria 2922172374 2922172594 231
373 iso_pu_bacteria 2922178524 2922180745 231
374 iso_pu_bacteria 2924748358 2924749817 231
375 iso_pu_bacteria 2937868953 2937875004 231
376 iso_pu_bacteria 2958122699 2958123947 231
377 iso_pu_bacteria 2958137437 2958137471 231
378 iso_pu_bacteria 2958158011 2958163579 231
379 iso_pu_bacteria 2965025482 2965031407 231
380 iso_pu_bacteria 2965032056 2965037424 231
381 iso_pu_bacteria 2965040258 2965041099 231
382 iso_pu_bacteria 2965047637 2965048857 231
383 iso_pu_bacteria 2965089291 2965090193 231
384 iso_pu_bacteria 2965102966 2965105788 231
385 iso_pu_bacteria 2965110997 2965111066 231
386 iso_pu_bacteria 2970547951 2970554675 231
387 iso_pu_bacteria 2977872689 2977879901 231
388 iso_pu_bacteria 2977915119 2977921546 231
389 iso_pu_bacteria 2977935797 2977939579 231
390 iso_pu_bacteria 2977950692 2977956183 231
391 iso_pu_bacteria 2977957713 2977960611 231
392 iso_pu_bacteria 2979793036 2979797365 231
393 iso_pu_bacteria 2987645492 2987647411 231
394 iso_pu_bacteria 2987673487 2987679268 231
395 iso_pu_bacteria 3004195979 3004203369 231
396 iso_pu_bacteria 3004239961 3004241766 231
397 iso_pu_bacteria 8004300914 8004304457 231
398 iso_pu_bacteria 8004361976 8004362070 231
399 iso_pu_bacteria 8004695233 8004701163 231
400 3300006177 Ga0075362_10062775 Ga0075362_100627752 232
401 3300050489 nmdc:mga03683_43584_c1 nmdc:mga03683_43584_c1_614_1393 232
402 3300006038 Ga0075365_10162854 Ga0075365_101628541 233
403 3300009147 Ga0114129_10243072 Ga0114129_102430723 233
404 3300050507 nmdc:mga05p37_248234_c1 nmdc:mga05p37_248234_c1_1050_1790 233
405 3300050510 nmdc:mga06r32_64730_c1 nmdc:mga06r32_64730_c1_1329_2069 233
406 iso_pu_bacteria 2513237305 2514421630 233
407 iso_pu_bacteria 2597489875 2597813604 233
408 iso_pu_bacteria 2721755686 2723575531 233
409 3300002067 JGI24735J21928_10052974 JGI24735J21928_100529742 236
410 3300005563 Ga0068855_100020047 Ga0068855_1000200479 236
411 3300005563 Ga0068855_100180186 Ga0068855_1001801863 236
412 3300009545 Ga0105237_10166157 Ga0105237_101661573 236
413 3300013104 Ga0157370_10039032 Ga0157370_100390325 236
414 3300013105 Ga0157369_10000359 Ga0157369_1000035921 236
415 3300013105 Ga0157369_10350108 Ga0157369_103501082 236
416 3300013296 Ga0157374_10000039 Ga0157374_1000003945 236
417 3300013307 Ga0157372_10074001 Ga0157372_100740014 236
418 3300014497 Ga0182008_10051837 Ga0182008_100518373 236
419 3300022467 Ga0224712_10000148 Ga0224712_1000014813 236
420 3300025256 Ga0209759_1007631 Ga0209759_10076312 236
421 3300025913 Ga0207695_10039021 Ga0207695_100390213 236
422 3300025949 Ga0207667_10329630 Ga0207667_103296301 236
423 3300042005 Ga0439448_0005842 Ga0439448_0005842_1718_2428 236
424 3300042012 Ga0439455_0041785 Ga0439455_0041785_371_1081 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

24

101

0.94

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

119

217

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

33

102

0.91

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

142

212

0.89

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

28

107

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

129

226

0.85

PF22441

CLIC-like_N

CLIC-like N-terminal domain

27

106

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lfl-assembly1.cif.gz_A-2 crystal structure of human glutathione transferase omega 1, delta 155 0.9014 9 224
6srb-assembly1.cif.gz_A crystal structure of glutathione transferase omega 3c from trametes versicolor 0.8998 10 207
7dwf-assembly2.cif.gz_B crystal structure of a glutathione s-transferase mutant sbgstu7(t53i) from salix babylonica 0.8986 11 222
6mhb-assembly3.cif.gz_E glutathione s-transferase omega 1 bound to covalent inhibitor 18 0.8973 9 224
3lfl-assembly2.cif.gz_C crystal structure of human glutathione transferase omega 1, delta 155 0.8956 9 219
ID Description Score Start End Superfamily
af_A0A1D6IL16_82_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9214 9 66 3.40.30.10
5g5fA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9204 10 86 3.40.30.10
3q19A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9152 9 93 3.40.30.10
af_Q9VSL3_17_104_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9146 10 86 3.40.30.10
af_Q9VSL6_6_114_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9107 10 103 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2N7VF80-F1-model_v4 GST C-terminal domain-containing protein 0.9865 81 231 GO:0005737
AF-A0A7Y3SRF5-F1-model_v4 deleted 0.9801 8 233
AF-A0A1E7VGR0-F1-model_v4 deleted 0.9752 9 232
AF-A0A1G7HYC5-F1-model_v4 deleted 0.9752 6 230
AF-A0A7Y6T8E8-F1-model_v4 deleted 0.9719 8 231

Feature Viewer

pLDDT pTM Quality
92.1 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map