F440663

General Info

Members Datasets Scaffolds Average Seq Length
424 286 338 230

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10224467|rootH1_102244672
Length 270
Sequence MIDCGAFKDTTFALSSDACTSTWSKAKNMTVRLNAFHQPIGAALPDWQGAQLPDGRPLVGRYCRLERIDVERHAADLYAAFQDAPDSRDWTYLFAGPFETFAAYRTYLTAIEKLSDPMHYAVIDLGSGKAVGTLALVRIDAPNGVIEVGSVTYSPRMKRTRLSTETMSLLLKYVFEDLGYRRFEWKCDSLNAPSRTAALRYGFKFEGIFRQAVVTRQRNRDTAWHSIVDSEYPALQTAYARWLDERNFDGEGRQMMRLANLIAEEALNPG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
4 2516143018 Ensifer sp. BR816 Isolate Nodule
5 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
6 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
7 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
8 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
9 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
10 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
11 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
12 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
13 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
14 2643221582 Rhizobium sp. Root651 Isolate Unclassified
15 2643221693 Rhizobium sp. Root491 Isolate Unclassified
16 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
17 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
18 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
19 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
20 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
21 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
22 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
23 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
24 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
25 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
26 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
27 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
28 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
29 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
30 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
31 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
32 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
33 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
34 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
35 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
36 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
37 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
38 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
39 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
40 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
41 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
42 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
43 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
44 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
45 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
46 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
47 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
48 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
49 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
50 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
51 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
52 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
53 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
54 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
55 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
56 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
57 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
58 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
59 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
60 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
61 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
62 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
63 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
64 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
65 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
66 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
67 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
68 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
69 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
70 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
71 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
72 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
73 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
74 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
75 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
76 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
77 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
78 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
79 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
80 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
81 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
82 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
83 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
84 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
85 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
86 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
87 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
88 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
89 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
90 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
91 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
92 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
93 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
94 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
97 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
98 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
99 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
100 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
101 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
102 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
121 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
140 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
141 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
142 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
202 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
203 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
204 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
205 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
280 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
281 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
282 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
284 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
285 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
286 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.25
Metatranscriptomes 0.47
Isolates 20.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.94
Bulb 0
Endosphere 9.91
Nodule 9.91
Rhizoplane 2.36
Rhizosphere 60.38
Stem 0
Stem Tuber 0.24
Unclassified 16.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1003237 3300002705 Bacteria 5424
2 rootH2_10167087 3300003320 Unclassified 2029
3 rootH2_10185573 3300003320 Bacteria 1731
4 rootL2_10059262 3300003322 Bacteria 12992
5 rootH1_10173911 3300003323 Bacteria 3175
6 rootH1_10224467 3300003323 Bacteria 1342
7 rootH1_10224468 3300003323 Bacteria 1233
8 Ga0055539_1000059 3300003752 Bacteria 146394
9 Ga0055533_1006624 3300003756 Bacteria 1680
10 Ga0055532_1000025 3300003758 Bacteria 240145
11 Ga0055525_1000536 3300003759 Bacteria 18093
12 Ga0055527_1001075 3300003760 Bacteria 6439
13 Ga0055535_1000019 3300003761 Bacteria 240145
14 Ga0055529_1000035 3300003763 Bacteria 240145
15 Ga0058692_1003354 3300003856 Bacteria 4964
16 Ga0058692_1004428 3300003856 Bacteria 4164
17 Ga0065165_1006467 3300005262 Bacteria 6130
18 Ga0070658_10039403 3300005327 Bacteria 3811
19 Ga0070683_100063026 3300005329 Bacteria 3447
20 Ga0070683_100510905 3300005329 Bacteria 1148
21 Ga0070661_100004402 3300005344 Bacteria 9709
22 Ga0070661_100184507 3300005344 Bacteria 1589
23 Ga0070713_100125145 3300005436 Bacteria 2260
24 Ga0070713_100667138 3300005436 Bacteria 991
25 Ga0070700_100442416 3300005441 Bacteria 987
26 Ga0070708_100007774 3300005445 Bacteria 8591
27 Ga0070699_100173829 3300005518 Bacteria 1909
28 Ga0070684_100066433 3300005535 Bacteria 3166
29 Ga0070684_100124389 3300005535 Bacteria 2322
30 Ga0070684_100299856 3300005535 Unclassified 1475
31 Ga0070684_100553982 3300005535 Bacteria 1067
32 Ga0070697_100210428 3300005536 Bacteria 1655
33 Ga0068853_100000129 3300005539 Bacteria 50871
34 Ga0070665_100015285 3300005548 Bacteria 7707
35 Ga0070665_100067822 3300005548 Bacteria 3577
36 Ga0070665_100074769 3300005548 Bacteria 3394
37 Ga0068855_100004818 3300005563 Bacteria 16475
38 Ga0068855_100006201 3300005563 Bacteria 14577
39 Ga0068855_100023839 3300005563 Bacteria 7331
40 Ga0068855_100035755 3300005563 Bacteria 5917
41 Ga0068855_100546240 3300005563 Bacteria 1254
42 Ga0068857_100005170 3300005577 Bacteria 11097
43 Ga0068857_100066268 3300005577 Bacteria 3213
44 Ga0068854_100000017 3300005578 Bacteria 142796
45 Ga0068854_100337496 3300005578 Bacteria 1230
46 Ga0068856_100010629 3300005614 Bacteria 8946
47 Ga0068856_100010811 3300005614 Bacteria 8865
48 Ga0068856_100010971 3300005614 Bacteria 8796
49 Ga0068856_100031396 3300005614 Bacteria 5196
50 Ga0068852_100000536 3300005616 Bacteria 24930
51 Ga0068852_100001819 3300005616 Bacteria 14497
52 Ga0068852_100043167 3300005616 Bacteria 3823
53 Ga0068852_100185165 3300005616 Bacteria 1960
54 Ga0068852_100313826 3300005616 Bacteria 1521
55 Ga0068851_10009756 3300005834 Bacteria 4471
56 Ga0068851_10127603 3300005834 Bacteria 1373
57 Ga0070717_10305875 3300006028 Bacteria 1414
58 Ga0075365_10411665 3300006038 Bacteria 954
59 Ga0075368_10005361 3300006042 Bacteria 4407
60 Ga0075364_10018927 3300006051 Bacteria 4318
61 Ga0075364_10237848 3300006051 Bacteria 1237
62 Ga0070716_100070971 3300006173 Bacteria 2046
63 Ga0070716_100139794 3300006173 Bacteria 1542
64 Ga0075362_10010734 3300006177 Bacteria 3586
65 Ga0075370_10195688 3300006353 Bacteria 1192
66 Ga0079104_1000042 3300006946 Bacteria 185991
67 Ga0099826_10000861 3300006948 Bacteria 16486
68 Ga0099826_10004209 3300006948 Bacteria 10027
69 Ga0105240_10000213 3300009093 Bacteria 117084
70 Ga0105240_10002018 3300009093 Bacteria 33484
71 Ga0105240_10009823 3300009093 Bacteria 13508
72 Ga0105240_10073090 3300009093 Bacteria 4235
73 Ga0105240_10267471 3300009093 Bacteria 1970
74 Ga0105240_11285972 3300009093 Bacteria 772
75 Ga0105243_10003708 3300009148 Bacteria 12273
76 Ga0105241_10002373 3300009174 Bacteria 14146
77 Ga0105241_10209569 3300009174 Bacteria 1632
78 Ga0105237_10013022 3300009545 Bacteria 8733
79 Ga0105237_10187540 3300009545 Bacteria 2068
80 Ga0105238_10000345 3300009551 Bacteria 50067
81 Ga0105238_10000399 3300009551 Bacteria 46183
82 Ga0105238_10079759 3300009551 Bacteria 3263
83 Ga0105238_10300709 3300009551 Bacteria 1588
84 Ga0105239_10013829 3300010375 Bacteria 8957
85 Ga0105239_10042500 3300010375 Bacteria 4981
86 Ga0105239_10212388 3300010375 Bacteria 2169
87 Ga0105239_10454525 3300010375 Unclassified 1453
88 Ga0105239_10619758 3300010375 Bacteria 1235
89 Ga0157373_10012347 3300013100 Bacteria 6280
90 Ga0157373_10019313 3300013100 Bacteria 4963
91 Ga0157373_10328237 3300013100 Bacteria 1089
92 Ga0157371_10000005 3300013102 Bacteria 416456
93 Ga0157370_10000010 3300013104 Bacteria 218199
94 Ga0157370_10000036 3300013104 Bacteria 136933
95 Ga0157370_10000058 3300013104 Bacteria 117088
96 Ga0157369_10000381 3300013105 Bacteria 58704
97 Ga0157369_10000625 3300013105 Bacteria 45958
98 Ga0157369_10003113 3300013105 Bacteria 19827
99 Ga0157369_10050763 3300013105 Bacteria 4490
100 Ga0157369_10150048 3300013105 Bacteria 2463
101 Ga0157374_10033254 3300013296 Bacteria 4704
102 Ga0157374_10124567 3300013296 Bacteria 2490
103 Ga0157374_10222351 3300013296 Bacteria 1853
104 Ga0157378_10066334 3300013297 Bacteria 3233
105 Ga0163162_10298964 3300013306 Bacteria 1741
106 Ga0157372_10000622 3300013307 Bacteria 38721
107 Ga0157372_10007772 3300013307 Bacteria 11388
108 Ga0157372_10029594 3300013307 Bacteria 5982
109 Ga0157372_10081099 3300013307 Bacteria 3672
110 Ga0157372_10662389 3300013307 Bacteria 1215
111 Ga0157376_10187504 3300014969 Bacteria 1894
112 Ga0182006_1000891 3300015261 Bacteria 20009
113 Ga0182006_1006046 3300015261 Bacteria 5666
114 Ga0206351_10908646 3300020077 Bacteria 3891
115 Ga0214544_1000063 3300021320 Bacteria 129929
116 Ga0214542_1000095 3300021321 Bacteria 116012
117 Ga0214543_1000008 3300021327 Bacteria 385680
118 Ga0214543_1000026 3300021327 Bacteria 220652
119 Ga0209784_100008 3300025224 Bacteria 740293
120 Ga0209784_102582 3300025224 Bacteria 1770
121 Ga0209566_100006 3300025225 Bacteria 789272
122 Ga0209674_100070 3300025226 Bacteria 242214
123 Ga0209672_100150 3300025228 Bacteria 62635
124 Ga0209147_100005 3300025229 Bacteria 1036530
125 Ga0209563_100016 3300025230 Bacteria 802091
126 Ga0209258_100007 3300025242 Bacteria 1036530
127 Ga0209677_100008 3300025253 Bacteria 802091
128 Ga0209759_1001668 3300025256 Bacteria 11581
129 Ga0209759_1017254 3300025256 Bacteria 1786
130 Ga0209455_1000011 3300025272 Bacteria 947242
131 Ga0209130_1023255 3300025284 Bacteria 1370
132 Ga0207656_10012920 3300025321 Bacteria 3181
133 Ga0207656_10309095 3300025321 Bacteria 783
134 Ga0207705_10149086 3300025909 Bacteria 1751
135 Ga0207654_10000646 3300025911 Bacteria 19657
136 Ga0207654_10001631 3300025911 Bacteria 11725
137 Ga0207695_10000191 3300025913 Bacteria 174087
138 Ga0207695_10001192 3300025913 Bacteria 44681
139 Ga0207695_10008210 3300025913 Bacteria 13114
140 Ga0207695_10015595 3300025913 Bacteria 8937
141 Ga0207695_10032361 3300025913 Bacteria 5723
142 Ga0207695_10039835 3300025913 Bacteria 5047
143 Ga0207649_10004837 3300025920 Bacteria 7281
144 Ga0207649_10006190 3300025920 Bacteria 6495
145 Ga0207681_10172828 3300025923 Bacteria 1639
146 Ga0207694_10002659 3300025924 Bacteria 14481
147 Ga0207694_10011526 3300025924 Bacteria 6671
148 Ga0207694_10106033 3300025924 Bacteria 2232
149 Ga0207700_10093762 3300025928 Bacteria 2377
150 Ga0207664_10180364 3300025929 Bacteria 1812
151 Ga0207709_10594217 3300025935 Bacteria 876
152 Ga0207665_10005483 3300025939 Bacteria 8467
153 Ga0207661_10021867 3300025944 Bacteria 4802
154 Ga0207661_10260276 3300025944 Bacteria 1545
155 Ga0207661_10304216 3300025944 Bacteria 1430
156 Ga0207667_10003339 3300025949 Bacteria 19800
157 Ga0207667_10003449 3300025949 Bacteria 19518
158 Ga0207667_10020993 3300025949 Bacteria 7243
159 Ga0207667_10131723 3300025949 Bacteria 2575
160 Ga0207667_10182955 3300025949 Bacteria 2152
161 Ga0207640_10000610 3300025981 Bacteria 21108
162 Ga0207640_10018590 3300025981 Bacteria 4087
163 Ga0207640_10050984 3300025981 Bacteria 2688
164 Ga0207639_10065128 3300026041 Bacteria 2828
165 Ga0207708_10486924 3300026075 Bacteria 1032
166 Ga0207702_10006400 3300026078 Bacteria 10159
167 Ga0207702_10011820 3300026078 Bacteria 7267
168 Ga0207674_10015986 3300026116 Bacteria 8222
169 Ga0207674_10021380 3300026116 Bacteria 6968
170 Ga0207698_10000070 3300026142 Bacteria 68316
171 Ga0207698_10002613 3300026142 Bacteria 10710
172 Ga0207698_10017575 3300026142 Bacteria 4857
173 Ga0207698_10338582 3300026142 Bacteria 1416
174 Ga0207698_10634495 3300026142 Unclassified 1057
175 Ga0209281_1000194 3300027111 Bacteria 139318
176 Ga0209371_1000003 3300027312 Bacteria 1122971
177 Ga0209371_1006428 3300027312 Bacteria 4354
178 Ga0209282_1000245 3300027666 Bacteria 27454
179 Ga0209813_10035098 3300027866 Bacteria 1500
180 Ga0268266_10013845 3300028379 Bacteria 6945
181 Ga0307515_10003195 3300028794 Bacteria 34661
182 Ga0268256_1000004 3300030500 Bacteria 1122967
183 Ga0268256_1001786 3300030500 Bacteria 12113
184 Ga0265328_10074687 3300031239 Unclassified 1247
185 Ga0265339_10000136 3300031249 Bacteria 60534
186 Ga0307408_100000831 3300031548 Bacteria 24498
187 Ga0307408_100008293 3300031548 Bacteria 6859
188 Ga0265314_10029340 3300031711 Bacteria 4090
189 Ga0265314_10089371 3300031711 Bacteria 2010
190 Ga0265342_10002511 3300031712 Bacteria 15795
191 Ga0307405_10046315 3300031731 Bacteria 2671
192 Ga0307412_10006103 3300031911 Bacteria 6789
193 Ga0307412_10095490 3300031911 Bacteria 2090
194 Ga0307409_100229936 3300031995 Bacteria 1680
195 Ga0307409_100328972 3300031995 Unclassified 1433
196 Ga0307416_100226237 3300032002 Bacteria 1799
197 Ga0307416_100447416 3300032002 Unclassified 1343
198 Ga0307411_10019373 3300032005 Bacteria 3930
199 Ga0373927_0000047 3300035695 Bacteria 87289
200 Ga0373937_1092730 3300036401 Bacteria 746
201 Ga0373925_0009566 3300037068 Bacteria 7061
202 Ga0395899_0303954 3300037312 Bacteria 1079
203 Ga0395900_0001077 3300037418 Bacteria 34739
204 Ga0395900_0069770 3300037418 Bacteria 3613
205 Ga0395898_0116992 3300037466 Bacteria 2554
206 Ga0395905_0000453 3300037471 Bacteria 57443
207 Ga0395905_0006639 3300037471 Bacteria 11601
208 Ga0395905_0123091 3300037471 Bacteria 2439
209 Ga0395901_0883260 3300038443 Bacteria 877
210 Ga0439436_0029201 3300041404 Bacteria 1606
211 Ga0439439_0008505 3300041406 Bacteria 2426
212 Ga0439466_0027444 3300041411 Bacteria 1972
213 Ga0439465_0122919 3300041413 Bacteria 911
214 Ga0439462_0076410 3300042015 Bacteria 912
215 Ga0450906_005939 3300042145 Bacteria 2484
216 Ga0450907_014897 3300042146 Bacteria 1298
217 Ga0450910_006854 3300042147 Bacteria 1578
218 Ga0466986_0030856 3300044650 Bacteria 3638
219 Ga0466969_0049506 3300044656 Bacteria 2073
220 Ga0466982_0285798 3300044672 Bacteria 947
221 Ga0466961_0000673 3300044693 Bacteria 21521
222 Ga0466963_0033273 3300044694 Bacteria 3345
223 Ga0466963_0212098 3300044694 Bacteria 1355
224 Ga0466960_0099066 3300044901 Bacteria 1498
225 Ga0466967_0000525 3300045976 Bacteria 18669
226 Ga0466967_0181728 3300045976 Bacteria 1984
227 Ga0495592_0014756 3300046454 Eukaryota 5930
228 Ga0495629_0026039 3300046459 Bacteria 4157
229 Ga0495638_0016205 3300046460 Bacteria 4995
230 Ga0495650_0011627 3300046471 Bacteria 4803
231 Ga0495608_0027355 3300046511 Eukaryota 3880
232 Ga0495618_0151260 3300046514 Eukaryota 1482
233 Ga0495628_0008711 3300046516 Eukaryota 8681
234 Ga0495630_0067632 3300046517 Eukaryota 2686
235 Ga0495652_0000053 3300046529 Eukaryota 117054
236 Ga0495652_0009635 3300046529 Eukaryota 8771
237 Ga0495652_0221926 3300046529 Bacteria 1420
238 Ga0495587_0201926 3300046536 Bacteria 1124
239 Ga0495645_0010992 3300046543 Eukaryota 6359
240 Ga0495645_0037382 3300046543 Eukaryota 3539
241 Ga0495645_0495745 3300046543 Bacteria 764
242 Ga0495633_0075845 3300046558 Bacteria 1566
243 Ga0495634_0011785 3300046642 Eukaryota 6356
244 Ga0495635_0176118 3300046663 Eukaryota 1454
245 Ga0495661_0177929 3300046665 Bacteria 1129
246 Ga0495588_0003287 3300046674 Bacteria 7026
247 Ga0495657_0061092 3300046675 Eukaryota 2493
248 Ga0495599_0084534 3300046678 Bacteria 1982
249 Ga0495599_0284172 3300046678 Eukaryota 1001
250 Ga0495623_0001410 3300046679 Eukaryota 16310
251 Ga0495623_0096610 3300046679 Bacteria 1805
252 Ga0495646_0015109 3300046680 Eukaryota 4904
253 Ga0495613_0054088 3300046689 Bacteria 2952
254 Ga0495613_0094665 3300046689 Bacteria 2161
255 Ga0495613_0166574 3300046689 Bacteria 1565
256 Ga0495624_0004836 3300046690 Eukaryota 9792
257 Ga0495624_0048884 3300046690 Eukaryota 2683
258 Ga0495671_0184172 3300046692 Bacteria 1014
259 Ga0495581_0369793 3300047315 Unclassified 837
260 Ga0495604_0132366 3300047317 Eukaryota 1791
261 Ga0495604_0189451 3300047317 Eukaryota 1434
262 Ga0495674_0015137 3300047319 Eukaryota 7214
263 Ga0495676_0001237 3300047321 Eukaryota 21913
264 Ga0495675_0149057 3300047444 Eukaryota 1446
265 Ga0495681_0012041 3300047470 Bacteria 5104
266 Ga0495686_0071873 3300047472 Bacteria 2129
267 Ga0495602_0106222 3300048088 Eukaryota 2292
268 Ga0495602_0118523 3300048088 Bacteria 2135
269 Ga0495602_0310159 3300048088 Eukaryota 1151
270 Ga0496100_0169376 3300048903 Bacteria 1571
271 Ga0496101_0165897 3300048904 Bacteria 1695
272 Ga0496104_0013977 3300048907 Bacteria 7242
273 Ga0496104_0086766 3300048907 Bacteria 2988
274 Ga0496110_0177801 3300048913 Bacteria 1932
275 Ga0496114_0029133 3300048917 Bacteria 4535
276 Ga0496114_0875835 3300048917 Bacteria 779
277 Ga0496115_0313389 3300048918 Unclassified 1284
278 Ga0496116_0053491 3300048919 Bacteria 2666
279 Ga0496116_0139057 3300048919 Bacteria 1369
280 Ga0496117_0000030 3300048920 Bacteria 389141
281 Ga0496117_0019077 3300048920 Bacteria 5650
282 Ga0496118_0006241 3300048921 Bacteria 13173
283 Ga0496118_0089340 3300048921 Bacteria 2127
284 Ga0496119_0099494 3300048922 Bacteria 1635
285 Ga0496119_0210901 3300048922 Bacteria 999
286 Ga0496120_0000148 3300048923 Bacteria 116605
287 Ga0496120_0031096 3300048923 Bacteria 3237
288 Ga0496121_0000003 3300048924 Bacteria 1191431
289 Ga0496121_0000309 3300048924 Bacteria 101723
290 Ga0496121_0002286 3300048924 Bacteria 29803
291 Ga0496122_0000050 3300048925 Bacteria 267874
292 Ga0496122_0058335 3300048925 Bacteria 2858
293 Ga0496122_0063546 3300048925 Bacteria 2692
294 Ga0496123_0000023 3300048926 Bacteria 346894
295 Ga0496123_0022285 3300048926 Bacteria 4887
296 Ga0496123_0144665 3300048926 Bacteria 1293
297 Ga0496124_0022502 3300048927 Bacteria 5775
298 Ga0496124_0026686 3300048927 Bacteria 5204
299 Ga0496124_0397823 3300048927 Bacteria 957
300 Ga0496125_0000963 3300048928 Bacteria 45208
301 Ga0496125_0012350 3300048928 Bacteria 8485
302 Ga0496125_0145781 3300048928 Bacteria 1636
303 Ga0496126_0001902 3300048929 Bacteria 30020
304 Ga0496126_0087119 3300048929 Bacteria 2751
305 Ga0496126_0092113 3300048929 Bacteria 2663
306 Ga0501033_0002041 3300049570 Bacteria 17553
307 Ga0501034_0484881 3300049571 Bacteria 1151
308 Ga0501037_0229766 3300049573 Bacteria 1303
309 Ga0501043_0158558 3300049579 Bacteria 1769
310 Ga0501047_0127539 3300049581 Bacteria 2424
311 Ga0501047_0238481 3300049581 Bacteria 1670
312 Ga0501067_0104671 3300049583 Bacteria 1572
313 Ga0501069_0181658 3300049585 Bacteria 1216
314 Ga0501070_0032337 3300049586 Bacteria 4378
315 Ga0501238_029492 3300049671 Bacteria 791
316 Ga0501035_0000348 3300049822 Bacteria 53279
317 Ga0501035_0008605 3300049822 Bacteria 9496
318 Ga0501044_0001837 3300049823 Bacteria 24716
319 Ga0501044_0005039 3300049823 Bacteria 14755
320 Ga0501044_0041746 3300049823 Bacteria 4775
321 Ga0501044_0045036 3300049823 Bacteria 4575
322 nmdc:mga03683_88426_c1 3300050489 Bacteria 1348
323 nmdc:mga00v17_181126_c1 3300050491 Bacteria 1359
324 nmdc:mga00v17_2487_c1 3300050491 Bacteria 9423
325 nmdc:mga00v17_8179_c1 3300050491 Bacteria 5621
326 nmdc:mga0yw44_16347_c1 3300050492 Bacteria 4006
327 nmdc:mga0yw44_309966_c1 3300050492 Bacteria 1059
328 nmdc:mga06z11_279984_c1 3300050494 Bacteria 988
329 nmdc:mga07m45_74297_c1 3300050496 Bacteria 1937
330 nmdc:mga0sz30_219112_c1 3300050516 Bacteria 846
331 nmdc:mga0sz30_74_c2 3300050516 Bacteria 23106
332 Ga0500560_003483 3300053107 Bacteria 3189
333 Ga0500560_010072 3300053107 Bacteria 2352
334 Ga0500559_0059377 3300053136 Bacteria 1702
335 Ga0500561_0000206 3300053137 Bacteria 10696
336 Ga0500624_000672 3300053157 Bacteria 8822
337 Ga0500634_0012014 3300053161 Bacteria 4494
338 Ga0587072_001615 3300059643 Bacteria 2843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10066334 Ga0157378_100663342 195
2 3300025913 Ga0207695_10039835 Ga0207695_100398352 195
3 3300031711 Ga0265314_10089371 Ga0265314_100893712 199
4 3300046529 Ga0495652_0221926 Ga0495652_0221926_489_1130 199
5 3300046536 Ga0495587_0201926 Ga0495587_0201926_409_1050 199
6 3300046543 Ga0495645_0495745 Ga0495645_0495745_97_738 199
7 3300046678 Ga0495599_0084534 Ga0495599_0084534_190_831 199
8 3300046679 Ga0495623_0096610 Ga0495623_0096610_783_1424 199
9 3300046689 Ga0495613_0054088 Ga0495613_0054088_1104_1745 199
10 3300036401 Ga0373937_1092730 Ga0373937_1092730_67_675 200
11 3300046689 Ga0495613_0094665 Ga0495613_0094665_1477_2085 200
12 3300049823 Ga0501044_0001837 Ga0501044_0001837_21018_21638 200
13 3300046517 Ga0495630_0067632 Ga0495630_0067632_59_667 202
14 3300046529 Ga0495652_0009635 Ga0495652_0009635_3033_3641 202
15 3300053107 Ga0500560_010072 Ga0500560_010072_18_644 202
16 3300009093 Ga0105240_10267471 Ga0105240_102674713 205
17 iso_pu_bacteria 2537561587 2537876156 205
18 3300005548 Ga0070665_100015285 Ga0070665_1000152852 206
19 3300013296 Ga0157374_10033254 Ga0157374_100332542 206
20 3300013306 Ga0163162_10298964 Ga0163162_102989642 206
21 3300014969 Ga0157376_10187504 Ga0157376_101875042 206
22 3300046459 Ga0495629_0026039 Ga0495629_0026039_172_798 206
23 3300046689 Ga0495613_0166574 Ga0495613_0166574_572_1198 206
24 3300047315 Ga0495581_0369793 Ga0495581_0369793_162_788 206
25 3300048903 Ga0496100_0169376 Ga0496100_0169376_613_1239 206
26 3300048904 Ga0496101_0165897 Ga0496101_0165897_853_1479 206
27 3300048907 Ga0496104_0013977 Ga0496104_0013977_952_1578 206
28 3300048913 Ga0496110_0177801 Ga0496110_0177801_225_851 206
29 3300048917 Ga0496114_0029133 Ga0496114_0029133_3578_4204 206
30 3300048918 Ga0496115_0313389 Ga0496115_0313389_338_964 206
31 3300049671 Ga0501238_029492 Ga0501238_029492_124_759 207
32 3300048917 Ga0496114_0875835 Ga0496114_0875835_21_668 209
33 3300005535 Ga0070684_100124389 Ga0070684_1001243893 212
34 3300025944 Ga0207661_10260276 Ga0207661_102602762 212
35 3300037471 Ga0395905_0000453 Ga0395905_0000453_54503_55243 217
36 3300005262 Ga0065165_1006467 Ga0065165_10064677 218
37 3300047444 Ga0495675_0149057 Ga0495675_0149057_16_675 219
38 iso_pu_bacteria 2513237159 2513998127 219
39 iso_pu_bacteria 2791355253 2793281595 219
40 iso_pu_bacteria 2821123053 2821126194 219
41 iso_pu_bacteria 2837651117 2837654176 219
42 iso_pu_bacteria 2838736955 2838737331 219
43 iso_pu_bacteria 2841840854 2841842300 219
44 iso_pu_bacteria 2842140634 2842142079 219
45 iso_pu_bacteria 2842521101 2842523232 219
46 iso_pu_bacteria 2857531043 2857532755 219
47 3300049571 Ga0501034_0484881 Ga0501034_0484881_425_1096 220
48 3300049581 Ga0501047_0127539 Ga0501047_0127539_1215_1886 220
49 3300049823 Ga0501044_0005039 Ga0501044_0005039_4995_5666 220
50 iso_pu_bacteria 2508501122 2509110225 220
51 iso_pu_bacteria 2509276019 2509378959 220
52 iso_pu_bacteria 2516143018 2516205290 220
53 iso_pu_bacteria 2554235003 2554244524 220
54 iso_pu_bacteria 2558860100 2558860445 220
55 iso_pu_bacteria 2558860242 2559297634 220
56 iso_pu_bacteria 2599185210 2599606219 220
57 iso_pu_bacteria 2643221582 2643917539 220
58 iso_pu_bacteria 2643221693 2644522712 220
59 iso_pu_bacteria 2657244999 2657684454 220
60 iso_pu_bacteria 2690316117 2692314462 220
61 iso_pu_bacteria 2751185821 2753461046 220
62 iso_pu_bacteria 2775507049 2776914599 220
63 iso_pu_bacteria 2791355082 2792582514 220
64 iso_pu_bacteria 2791355091 2792624317 220
65 iso_pu_bacteria 2791355092 2792625681 220
66 iso_pu_bacteria 2791355094 2792642760 220
67 iso_pu_bacteria 2802429268 2804753357 220
68 iso_pu_bacteria 2808606387 2808989143 220
69 iso_pu_bacteria 2818991439 2819557682 220
70 iso_pu_bacteria 2838074704 2838077476 220
71 iso_pu_bacteria 2838675328 2838679934 220
72 iso_pu_bacteria 2838714209 2838717731 220
73 iso_pu_bacteria 2838719591 2838724505 220
74 iso_pu_bacteria 2838724970 2838729553 220
75 iso_pu_bacteria 2841846520 2841849991 220
76 iso_pu_bacteria 2841859092 2841861221 220
77 iso_pu_bacteria 2842124991 2842128463 220
78 iso_pu_bacteria 2842130223 2842134616 220
79 iso_pu_bacteria 2842152218 2842156552 220
80 iso_pu_bacteria 2842170452 2842173976 220
81 iso_pu_bacteria 2842175837 2842180173 220
82 iso_pu_bacteria 2842187318 2842192172 220
83 iso_pu_bacteria 2842211629 2842216548 220
84 iso_pu_bacteria 2842224351 2842229208 220
85 iso_pu_bacteria 2842515876 2842518512 220
86 iso_pu_bacteria 2847417321 2847420485 220
87 iso_pu_bacteria 2848992105 2848995357 220
88 iso_pu_bacteria 2850079185 2850082343 220
89 iso_pu_bacteria 2855872281 2855878388 220
90 iso_pu_bacteria 2896384573 2896387678 220
91 iso_pu_bacteria 2899792073 2899793127 220
92 iso_pu_bacteria 2899845264 2899849669 220
93 iso_pu_bacteria 2913295892 2913299874 220
94 iso_pu_bacteria 2919114240 2919118012 220
95 iso_pu_bacteria 2920760137 2920760716 220
96 iso_pu_bacteria 2926754445 2926757779 220
97 iso_pu_bacteria 2926760298 2926764595 220
98 iso_pu_bacteria 2929138655 2929141407 220
99 iso_pu_bacteria 2933006813 2933010394 220
100 iso_pu_bacteria 2933011516 2933014138 220
101 iso_pu_bacteria 2979089926 2979090295 220
102 iso_pu_bacteria 2979095461 2979095824 220
103 iso_pu_bacteria 2979100975 2979102722 220
104 iso_pu_bacteria 2984509177 2984509390 220
105 iso_pu_bacteria 2984518228 2984519911 220
106 iso_pu_bacteria 2984537506 2984537722 220
107 iso_pu_bacteria 2984601300 2984604467 220
108 iso_pu_bacteria 643692032 643827121 220
109 iso_pu_bacteria 650716007 650844076 220
110 iso_pu_bacteria 8003570095 8003573267 220
111 iso_pu_bacteria 8049293176 8049295974 220
112 3300048927 Ga0496124_0397823 Ga0496124_0397823_208_897 222
113 3300005548 Ga0070665_100067822 Ga0070665_1000678224 223
114 3300006353 Ga0075370_10195688 Ga0075370_101956882 223
115 3300006946 Ga0079104_1000042 Ga0079104_100004260 223
116 3300025284 Ga0209130_1023255 Ga0209130_10232553 223
117 3300027111 Ga0209281_1000194 Ga0209281_100019460 223
118 3300028794 Ga0307515_10003195 Ga0307515_1000319514 223
119 3300037471 Ga0395905_0006639 Ga0395905_0006639_4921_5604 223
120 3300041404 Ga0439436_0029201 Ga0439436_0029201_507_1199 223
121 3300041406 Ga0439439_0008505 Ga0439439_0008505_372_1064 223
122 3300042145 Ga0450906_005939 Ga0450906_005939_945_1637 223
123 3300042146 Ga0450907_014897 Ga0450907_014897_101_793 223
124 3300042147 Ga0450910_006854 Ga0450910_006854_100_792 223
125 3300044901 Ga0466960_0099066 Ga0466960_0099066_100_795 223
126 3300046460 Ga0495638_0016205 Ga0495638_0016205_838_1518 223
127 3300046692 Ga0495671_0184172 Ga0495671_0184172_175_864 223
128 3300047470 Ga0495681_0012041 Ga0495681_0012041_124_813 223
129 3300048927 Ga0496124_0022502 Ga0496124_0022502_1067_1750 223
130 3300050491 nmdc:mga00v17_181126_c1 nmdc:mga00v17_181126_c1_207_902 223
131 3300053136 Ga0500559_0059377 Ga0500559_0059377_209_892 223
132 3300003856 Ga0058692_1003354 Ga0058692_10033545 224
133 3300003856 Ga0058692_1004428 Ga0058692_10044285 224
134 3300005548 Ga0070665_100074769 Ga0070665_1000747695 224
135 3300006038 Ga0075365_10411665 Ga0075365_104116651 224
136 3300006042 Ga0075368_10005361 Ga0075368_100053614 224
137 3300006051 Ga0075364_10018927 Ga0075364_100189275 224
138 3300006051 Ga0075364_10237848 Ga0075364_102378481 224
139 3300006177 Ga0075362_10010734 Ga0075362_100107343 224
140 3300006948 Ga0099826_10000861 Ga0099826_100008618 224
141 3300006948 Ga0099826_10004209 Ga0099826_1000420913 224
142 3300009148 Ga0105243_10003708 Ga0105243_100037087 224
143 3300013100 Ga0157373_10012347 Ga0157373_100123477 224
144 3300013102 Ga0157371_10000005 Ga0157371_10000005337 224
145 3300013104 Ga0157370_10000036 Ga0157370_1000003643 224
146 3300021320 Ga0214544_1000063 Ga0214544_100006359 224
147 3300021321 Ga0214542_1000095 Ga0214542_100009549 224
148 3300021327 Ga0214543_1000008 Ga0214543_1000008255 224
149 3300021327 Ga0214543_1000026 Ga0214543_100002649 224
150 3300025923 Ga0207681_10172828 Ga0207681_101728282 224
151 3300025935 Ga0207709_10594217 Ga0207709_105942172 224
152 3300027312 Ga0209371_1000003 Ga0209371_1000003291 224
153 3300027312 Ga0209371_1006428 Ga0209371_10064284 224
154 3300027666 Ga0209282_1000245 Ga0209282_100024512 224
155 3300027866 Ga0209813_10035098 Ga0209813_100350983 224
156 3300028379 Ga0268266_10013845 Ga0268266_100138456 224
157 3300030500 Ga0268256_1000004 Ga0268256_1000004760 224
158 3300030500 Ga0268256_1001786 Ga0268256_10017866 224
159 3300031239 Ga0265328_10074687 Ga0265328_100746872 224
160 3300031249 Ga0265339_10000136 Ga0265339_1000013631 224
161 3300031712 Ga0265342_10002511 Ga0265342_100025113 224
162 3300041411 Ga0439466_0027444 Ga0439466_0027444_147_833 224
163 3300042015 Ga0439462_0076410 Ga0439462_0076410_94_792 224
164 3300046558 Ga0495633_0075845 Ga0495633_0075845_180_872 224
165 3300046665 Ga0495661_0177929 Ga0495661_0177929_225_917 224
166 3300046674 Ga0495588_0003287 Ga0495588_0003287_2805_3497 224
167 3300048907 Ga0496104_0086766 Ga0496104_0086766_91_783 224
168 3300048919 Ga0496116_0053491 Ga0496116_0053491_353_1045 224
169 3300048919 Ga0496116_0139057 Ga0496116_0139057_12_695 224
170 3300048920 Ga0496117_0000030 Ga0496117_0000030_111404_112096 224
171 3300048921 Ga0496118_0006241 Ga0496118_0006241_4969_5661 224
172 3300048922 Ga0496119_0099494 Ga0496119_0099494_221_913 224
173 3300048923 Ga0496120_0000148 Ga0496120_0000148_68968_69660 224
174 3300048925 Ga0496122_0000050 Ga0496122_0000050_59476_60168 224
175 3300048926 Ga0496123_0000023 Ga0496123_0000023_68164_68856 224
176 3300048928 Ga0496125_0145781 Ga0496125_0145781_478_1170 224
177 3300048929 Ga0496126_0087119 Ga0496126_0087119_1348_2031 224
178 3300048929 Ga0496126_0092113 Ga0496126_0092113_1676_2368 224
179 3300050489 nmdc:mga03683_88426_c1 nmdc:mga03683_88426_c1_286_978 224
180 3300050491 nmdc:mga00v17_2487_c1 nmdc:mga00v17_2487_c1_2790_3482 224
181 3300050492 nmdc:mga0yw44_16347_c1 nmdc:mga0yw44_16347_c1_3304_3996 224
182 3300050492 nmdc:mga0yw44_309966_c1 nmdc:mga0yw44_309966_c1_54_740 224
183 3300050494 nmdc:mga06z11_279984_c1 nmdc:mga06z11_279984_c1_273_959 224
184 3300050496 nmdc:mga07m45_74297_c1 nmdc:mga07m45_74297_c1_11_703 224
185 3300050516 nmdc:mga0sz30_219112_c1 nmdc:mga0sz30_219112_c1_117_803 224
186 3300050516 nmdc:mga0sz30_74_c2 nmdc:mga0sz30_74_c2_8310_9002 224
187 3300053107 Ga0500560_003483 Ga0500560_003483_157_849 224
188 3300053137 Ga0500561_0000206 Ga0500561_0000206_1326_2018 224
189 3300053157 Ga0500624_000672 Ga0500624_000672_7582_8274 224
190 3300053161 Ga0500634_0012014 Ga0500634_0012014_2681_3373 224
191 3300059643 Ga0587072_001615 Ga0587072_001615_172_864 224
192 3300003320 rootH2_10167087 rootH2_101670873 225
193 3300005327 Ga0070658_10039403 Ga0070658_100394032 225
194 3300005329 Ga0070683_100063026 Ga0070683_1000630263 225
195 3300005329 Ga0070683_100510905 Ga0070683_1005109051 225
196 3300005344 Ga0070661_100004402 Ga0070661_1000044021 225
197 3300005344 Ga0070661_100184507 Ga0070661_1001845071 225
198 3300005535 Ga0070684_100066433 Ga0070684_1000664331 225
199 3300005535 Ga0070684_100299856 Ga0070684_1002998561 225
200 3300005535 Ga0070684_100553982 Ga0070684_1005539821 225
201 3300005539 Ga0068853_100000129 Ga0068853_1000001298 225
202 3300005563 Ga0068855_100006201 Ga0068855_1000062015 225
203 3300005563 Ga0068855_100035755 Ga0068855_1000357552 225
204 3300005563 Ga0068855_100546240 Ga0068855_1005462401 225
205 3300005577 Ga0068857_100066268 Ga0068857_1000662682 225
206 3300005578 Ga0068854_100337496 Ga0068854_1003374961 225
207 3300005614 Ga0068856_100010629 Ga0068856_1000106294 225
208 3300005614 Ga0068856_100010811 Ga0068856_1000108114 225
209 3300005614 Ga0068856_100031396 Ga0068856_1000313963 225
210 3300005616 Ga0068852_100000536 Ga0068852_10000053615 225
211 3300005616 Ga0068852_100001819 Ga0068852_1000018192 225
212 3300005616 Ga0068852_100185165 Ga0068852_1001851652 225
213 3300005616 Ga0068852_100313826 Ga0068852_1003138261 225
214 3300005834 Ga0068851_10009756 Ga0068851_100097563 225
215 3300005834 Ga0068851_10127603 Ga0068851_101276032 225
216 3300009093 Ga0105240_10000213 Ga0105240_1000021375 225
217 3300009093 Ga0105240_10002018 Ga0105240_100020187 225
218 3300009093 Ga0105240_11285972 Ga0105240_112859721 225
219 3300009174 Ga0105241_10002373 Ga0105241_100023733 225
220 3300009174 Ga0105241_10209569 Ga0105241_102095691 225
221 3300009545 Ga0105237_10013022 Ga0105237_100130221 225
222 3300009551 Ga0105238_10000345 Ga0105238_1000034531 225
223 3300009551 Ga0105238_10079759 Ga0105238_100797592 225
224 3300009551 Ga0105238_10300709 Ga0105238_103007092 225
225 3300010375 Ga0105239_10042500 Ga0105239_100425002 225
226 3300010375 Ga0105239_10212388 Ga0105239_102123881 225
227 3300010375 Ga0105239_10454525 Ga0105239_104545252 225
228 3300010375 Ga0105239_10619758 Ga0105239_106197581 225
229 3300013100 Ga0157373_10328237 Ga0157373_103282372 225
230 3300013104 Ga0157370_10000058 Ga0157370_1000005874 225
231 3300013105 Ga0157369_10000381 Ga0157369_1000038125 225
232 3300013105 Ga0157369_10003113 Ga0157369_100031136 225
233 3300013105 Ga0157369_10050763 Ga0157369_100507633 225
234 3300013296 Ga0157374_10124567 Ga0157374_101245674 225
235 3300013296 Ga0157374_10222351 Ga0157374_102223512 225
236 3300013307 Ga0157372_10000622 Ga0157372_100006228 225
237 3300013307 Ga0157372_10007772 Ga0157372_100077723 225
238 3300013307 Ga0157372_10081099 Ga0157372_100810992 225
239 3300013307 Ga0157372_10662389 Ga0157372_106623892 225
240 3300025321 Ga0207656_10012920 Ga0207656_100129203 225
241 3300025321 Ga0207656_10309095 Ga0207656_103090951 225
242 3300025909 Ga0207705_10149086 Ga0207705_101490862 225
243 3300025911 Ga0207654_10000646 Ga0207654_1000064610 225
244 3300025911 Ga0207654_10001631 Ga0207654_100016313 225
245 3300025913 Ga0207695_10000191 Ga0207695_10000191123 225
246 3300025913 Ga0207695_10015595 Ga0207695_100155952 225
247 3300025920 Ga0207649_10004837 Ga0207649_100048374 225
248 3300025920 Ga0207649_10006190 Ga0207649_100061901 225
249 3300025924 Ga0207694_10106033 Ga0207694_101060331 225
250 3300025944 Ga0207661_10021867 Ga0207661_100218673 225
251 3300025944 Ga0207661_10304216 Ga0207661_103042162 225
252 3300025949 Ga0207667_10003449 Ga0207667_1000344913 225
253 3300025949 Ga0207667_10131723 Ga0207667_101317231 225
254 3300025949 Ga0207667_10182955 Ga0207667_101829552 225
255 3300025981 Ga0207640_10050984 Ga0207640_100509841 225
256 3300026041 Ga0207639_10065128 Ga0207639_100651283 225
257 3300026078 Ga0207702_10006400 Ga0207702_100064002 225
258 3300026078 Ga0207702_10011820 Ga0207702_100118202 225
259 3300026116 Ga0207674_10021380 Ga0207674_100213805 225
260 3300026142 Ga0207698_10000070 Ga0207698_1000007035 225
261 3300026142 Ga0207698_10002613 Ga0207698_100026138 225
262 3300026142 Ga0207698_10017575 Ga0207698_100175754 225
263 3300026142 Ga0207698_10634495 Ga0207698_106344952 225
264 3300044694 Ga0466963_0033273 Ga0466963_0033273_318_1007 225
265 3300045976 Ga0466967_0000525 Ga0466967_0000525_2786_3475 225
266 3300005436 Ga0070713_100125145 Ga0070713_1001251452 226
267 3300013307 Ga0157372_10029594 Ga0157372_100295943 226
268 3300025928 Ga0207700_10093762 Ga0207700_100937622 226
269 3300025929 Ga0207664_10180364 Ga0207664_101803642 226
270 3300031711 Ga0265314_10029340 Ga0265314_100293402 226
271 3300048088 Ga0495602_0118523 Ga0495602_0118523_810_1496 226
272 3300046454 Ga0495592_0014756 Ga0495592_0014756_4389_5072 227
273 3300046511 Ga0495608_0027355 Ga0495608_0027355_2022_2705 227
274 3300046514 Ga0495618_0151260 Ga0495618_0151260_603_1286 227
275 3300046516 Ga0495628_0008711 Ga0495628_0008711_797_1480 227
276 3300046529 Ga0495652_0000053 Ga0495652_0000053_57337_58020 227
277 3300046543 Ga0495645_0010992 Ga0495645_0010992_3379_4062 227
278 3300046543 Ga0495645_0037382 Ga0495645_0037382_309_992 227
279 3300046642 Ga0495634_0011785 Ga0495634_0011785_292_975 227
280 3300046663 Ga0495635_0176118 Ga0495635_0176118_73_756 227
281 3300046675 Ga0495657_0061092 Ga0495657_0061092_1484_2167 227
282 3300046678 Ga0495599_0284172 Ga0495599_0284172_73_756 227
283 3300046679 Ga0495623_0001410 Ga0495623_0001410_5643_6326 227
284 3300046680 Ga0495646_0015109 Ga0495646_0015109_762_1445 227
285 3300046690 Ga0495624_0004836 Ga0495624_0004836_4189_4872 227
286 3300046690 Ga0495624_0048884 Ga0495624_0048884_265_948 227
287 3300047317 Ga0495604_0132366 Ga0495604_0132366_1014_1697 227
288 3300047317 Ga0495604_0189451 Ga0495604_0189451_452_1135 227
289 3300047319 Ga0495674_0015137 Ga0495674_0015137_6261_6944 227
290 3300047321 Ga0495676_0001237 Ga0495676_0001237_20964_21647 227
291 3300048088 Ga0495602_0106222 Ga0495602_0106222_194_877 227
292 3300048088 Ga0495602_0310159 Ga0495602_0310159_453_1136 227
293 3300049583 Ga0501067_0104671 Ga0501067_0104671_232_927 227
294 3300049585 Ga0501069_0181658 Ga0501069_0181658_62_757 227
295 iso_pu_bacteria 2582581306 2585269722 227
296 iso_pu_bacteria 2582581865 2585388617 227
297 iso_pu_bacteria 2854601825 2854605781 228
298 3300049570 Ga0501033_0002041 Ga0501033_0002041_9455_10165 229
299 3300049822 Ga0501035_0000348 Ga0501035_0000348_39830_40540 229
300 3300035695 Ga0373927_0000047 Ga0373927_0000047_13247_13987 230
301 3300037068 Ga0373925_0009566 Ga0373925_0009566_6273_7013 230
302 iso_pu_bacteria 2904434214 2904437134 230
303 3300041413 Ga0439465_0122919 Ga0439465_0122919_159_881 231
304 iso_pu_bacteria 2900577576 2900579094 231
305 3300005563 Ga0068855_100004818 Ga0068855_1000048188 232
306 3300005614 Ga0068856_100010971 Ga0068856_1000109716 232
307 3300006028 Ga0070717_10305875 Ga0070717_103058751 232
308 3300025913 Ga0207695_10032361 Ga0207695_100323614 232
309 3300025924 Ga0207694_10011526 Ga0207694_100115263 232
310 3300025949 Ga0207667_10003339 Ga0207667_1000333910 232
311 3300049573 Ga0501037_0229766 Ga0501037_0229766_491_1213 232
312 3300049579 Ga0501043_0158558 Ga0501043_0158558_426_1148 232
313 3300049822 Ga0501035_0008605 Ga0501035_0008605_8597_9319 232
314 3300049823 Ga0501044_0041746 Ga0501044_0041746_2468_3190 232
315 iso_pu_bacteria 2721755763 2723878281 232
316 3300003756 Ga0055533_1006624 Ga0055533_10066241 233
317 3300006173 Ga0070716_100070971 Ga0070716_1000709712 233
318 3300006173 Ga0070716_100139794 Ga0070716_1001397943 233
319 3300025939 Ga0207665_10005483 Ga0207665_100054832 233
320 3300049581 Ga0501047_0238481 Ga0501047_0238481_48_773 233
321 3300049586 Ga0501070_0032337 Ga0501070_0032337_871_1596 233
322 3300005436 Ga0070713_100667138 Ga0070713_1006671381 234
323 3300005441 Ga0070700_100442416 Ga0070700_1004424162 234
324 3300005445 Ga0070708_100007774 Ga0070708_1000077742 234
325 3300005518 Ga0070699_100173829 Ga0070699_1001738291 234
326 3300005536 Ga0070697_100210428 Ga0070697_1002104282 234
327 3300026075 Ga0207708_10486924 Ga0207708_104869242 234
328 3300044656 Ga0466969_0049506 Ga0466969_0049506_632_1336 234
329 3300044672 Ga0466982_0285798 Ga0466982_0285798_224_928 234
330 3300044693 Ga0466961_0000673 Ga0466961_0000673_9926_10630 234
331 3300044694 Ga0466963_0212098 Ga0466963_0212098_585_1289 234
332 3300049823 Ga0501044_0045036 Ga0501044_0045036_331_1044 234
333 iso_pu_bacteria 2521172590 2521558750 234
334 iso_pu_bacteria 2904439833 2904443955 234
335 iso_pu_bacteria 2904530477 2904534496 234
336 iso_pu_bacteria 2904584206 2904584387 234
337 iso_pu_bacteria 2904589729 2904590855 234
338 iso_pu_bacteria 2904601388 2904603304 234
339 iso_pu_bacteria 2919079590 2919080691 234
340 3300003323 rootH1_10173911 rootH1_101739112 235
341 3300003752 Ga0055539_1000059 Ga0055539_100005929 235
342 3300003758 Ga0055532_1000025 Ga0055532_1000025103 235
343 3300003759 Ga0055525_1000536 Ga0055525_100053611 235
344 3300003761 Ga0055535_1000019 Ga0055535_1000019103 235
345 3300003763 Ga0055529_1000035 Ga0055529_1000035104 235
346 3300005616 Ga0068852_100043167 Ga0068852_1000431675 235
347 3300013100 Ga0157373_10019313 Ga0157373_100193132 235
348 3300013104 Ga0157370_10000010 Ga0157370_10000010101 235
349 3300013105 Ga0157369_10000625 Ga0157369_1000062523 235
350 3300015261 Ga0182006_1006046 Ga0182006_10060464 235
351 3300025224 Ga0209784_100008 Ga0209784_100008328 235
352 3300025225 Ga0209566_100006 Ga0209566_100006328 235
353 3300025226 Ga0209674_100070 Ga0209674_100070204 235
354 3300025230 Ga0209563_100016 Ga0209563_100016328 235
355 3300025253 Ga0209677_100008 Ga0209677_100008364 235
356 3300025256 Ga0209759_1017254 Ga0209759_10172542 235
357 3300026142 Ga0207698_10338582 Ga0207698_103385822 235
358 3300037312 Ga0395899_0303954 Ga0395899_0303954_346_1053 235
359 3300037418 Ga0395900_0001077 Ga0395900_0001077_10471_11178 235
360 3300037471 Ga0395905_0123091 Ga0395905_0123091_1501_2208 235
361 3300044650 Ga0466986_0030856 Ga0466986_0030856_1484_2191 235
362 3300045976 Ga0466967_0181728 Ga0466967_0181728_970_1677 235
363 3300048920 Ga0496117_0019077 Ga0496117_0019077_3043_3789 235
364 3300048921 Ga0496118_0089340 Ga0496118_0089340_871_1617 235
365 3300048922 Ga0496119_0210901 Ga0496119_0210901_146_892 235
366 3300048923 Ga0496120_0031096 Ga0496120_0031096_1336_2082 235
367 3300048924 Ga0496121_0000003 Ga0496121_0000003_1030485_1031231 235
368 3300048924 Ga0496121_0002286 Ga0496121_0002286_14534_15301 235
369 3300048925 Ga0496122_0058335 Ga0496122_0058335_345_1091 235
370 3300048925 Ga0496122_0063546 Ga0496122_0063546_438_1184 235
371 3300048926 Ga0496123_0022285 Ga0496123_0022285_449_1195 235
372 3300048926 Ga0496123_0144665 Ga0496123_0144665_281_1027 235
373 3300048927 Ga0496124_0026686 Ga0496124_0026686_2639_3385 235
374 3300048928 Ga0496125_0000963 Ga0496125_0000963_32697_33443 235
375 3300048928 Ga0496125_0012350 Ga0496125_0012350_3687_4394 235
376 3300050491 nmdc:mga00v17_8179_c1 nmdc:mga00v17_8179_c1_2650_3396 235
377 3300003320 rootH2_10185573 rootH2_101855732 236
378 3300003322 rootL2_10059262 rootL2_1005926212 236
379 3300013105 Ga0157369_10150048 Ga0157369_101500483 236
380 3300031548 Ga0307408_100000831 Ga0307408_1000008314 236
381 3300031548 Ga0307408_100008293 Ga0307408_1000082936 236
382 3300031731 Ga0307405_10046315 Ga0307405_100463152 236
383 3300031911 Ga0307412_10006103 Ga0307412_100061032 236
384 3300031911 Ga0307412_10095490 Ga0307412_100954902 236
385 3300031995 Ga0307409_100229936 Ga0307409_1002299362 236
386 3300032002 Ga0307416_100226237 Ga0307416_1002262372 236
387 3300032005 Ga0307411_10019373 Ga0307411_100193732 236
388 3300037418 Ga0395900_0069770 Ga0395900_0069770_2071_2781 236
389 3300037466 Ga0395898_0116992 Ga0395898_0116992_1037_1747 236
390 3300038443 Ga0395901_0883260 Ga0395901_0883260_153_863 236
391 3300046471 Ga0495650_0011627 Ga0495650_0011627_1367_2104 236
392 3300047472 Ga0495686_0071873 Ga0495686_0071873_344_1081 236
393 3300048924 Ga0496121_0000309 Ga0496121_0000309_57883_58608 236
394 3300048929 Ga0496126_0001902 Ga0496126_0001902_17027_17752 236
395 3300031995 Ga0307409_100328972 Ga0307409_1003289722 238
396 3300032002 Ga0307416_100447416 Ga0307416_1004474162 238
397 iso_pu_bacteria 2599185178 2599446274 240
398 3300003323 rootH1_10224468 rootH1_102244682 242
399 3300005563 Ga0068855_100023839 Ga0068855_1000238392 242
400 3300009093 Ga0105240_10009823 Ga0105240_100098232 242
401 3300009545 Ga0105237_10187540 Ga0105237_101875402 242
402 3300009551 Ga0105238_10000399 Ga0105238_1000039934 242
403 3300010375 Ga0105239_10013829 Ga0105239_100138292 242
404 3300015261 Ga0182006_1000891 Ga0182006_10008917 242
405 3300025913 Ga0207695_10008210 Ga0207695_1000821013 242
406 3300025924 Ga0207694_10002659 Ga0207694_100026597 242
407 3300025949 Ga0207667_10020993 Ga0207667_100209932 242
408 3300025981 Ga0207640_10018590 Ga0207640_100185905 242
409 3300002705 JGI25156J39149_1003237 JGI25156J39149_10032372 244
410 3300003323 rootH1_10224467 rootH1_102244672 244
411 3300003760 Ga0055527_1001075 Ga0055527_10010754 244
412 3300005577 Ga0068857_100005170 Ga0068857_1000051708 244
413 3300005578 Ga0068854_100000017 Ga0068854_10000001726 244
414 3300009093 Ga0105240_10073090 Ga0105240_100730902 244
415 3300020077 Ga0206351_10908646 Ga0206351_109086464 244
416 3300025224 Ga0209784_102582 Ga0209784_1025822 244
417 3300025228 Ga0209672_100150 Ga0209672_10015029 244
418 3300025229 Ga0209147_100005 Ga0209147_100005323 244
419 3300025242 Ga0209258_100007 Ga0209258_100007323 244
420 3300025256 Ga0209759_1001668 Ga0209759_100166811 244
421 3300025272 Ga0209455_1000011 Ga0209455_1000011248 244
422 3300025913 Ga0207695_10001192 Ga0207695_100011927 244
423 3300025981 Ga0207640_10000610 Ga0207640_1000061020 244
424 3300026116 Ga0207674_10015986 Ga0207674_100159862 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

64

204

0.79

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

76

203

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9797 24 244
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9753 24 244
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.9156 18 213
2zxv-assembly6.cif.gz_D crystal structure of putative acetyltransferase from t. thermophilus hb8 0.9109 34 224
2z0z-assembly1.cif.gz_A-2 crystal structure of putative acetyltransferase 0.901 34 224
ID Description Score Start End Superfamily
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9797 24 244 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9765 24 244 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9753 24 244 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9722 24 244 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9115 143 211 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Q3GZJ6-F1-model_v4 N-acetyltransferase 0.992 135 244 GO:0005737
GO:0008999
GO:1990189
AF-A0A7H9VA42-F1-model_v4 N-acetyltransferase 0.9891 151 222 GO:0008999
GO:1990189
AF-A0A535NEY3-F1-model_v4 GNAT family N-acetyltransferase 0.9841 94 243 GO:0008999
GO:1990189
AF-A0A1Y5G7C7-F1-model_v4 GNAT family N-acetyltransferase 0.9823 104 243 GO:0005737
GO:0008999
GO:1990189
AF-A0A7Y2NS43-F1-model_v4 GNAT family N-acetyltransferase 0.982 69 243 GO:0005737
GO:0008999
GO:1990189

Feature Viewer

pLDDT pTM Quality
94.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map