F440607

General Info

Members Datasets Scaffolds Average Seq Length
423 211 846 88

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0860892|Ga0501033_0860892_276_578
Length 100
Sequence MHSTYRQKKDDCMRDMTWFSTLSTVAAVLAIAIGTLGPAIAMGRAITQALEALARQPEAEKAIMRTLFIGLAMIESLAIYCLVIVLIVLFRNPLLEYLLK

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
119 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
120 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
121 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
140 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
210 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
211 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.24
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 2.13
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0860892 3300049570 Bacteria 611
2 JGI25157J39369_1003562 3300002741 Bacteria 3128
3 Ga0055527_1001855 3300003760 Bacteria 3981
4 Ga0055535_1001648 3300003761 Bacteria 10404
5 Ga0055542_1000569 3300003762 Bacteria 32484
6 Ga0055529_1000258 3300003763 Bacteria 63488
7 Ga0065712_10291531 3300005290 Bacteria 876
8 Ga0065715_10779383 3300005293 Bacteria 618
9 Ga0065707_10870863 3300005295 Bacteria 576
10 Ga0070658_10697741 3300005327 Bacteria 881
11 Ga0070658_11136943 3300005327 Bacteria 679
12 Ga0070676_10005219 3300005328 Bacteria 6907
13 Ga0070683_100077717 3300005329 Bacteria 3104
14 Ga0070683_100783260 3300005329 Bacteria 914
15 Ga0070670_100172769 3300005331 Bacteria 1875
16 Ga0070670_102003761 3300005331 Unclassified 533
17 Ga0070666_10002582 3300005335 Bacteria 10940
18 Ga0070682_101933404 3300005337 Bacteria 517
19 Ga0068868_100038109 3300005338 Bacteria 3730
20 Ga0068868_100125511 3300005338 Bacteria 2096
21 Ga0070661_100314738 3300005344 Bacteria 1221
22 Ga0070661_101019109 3300005344 Bacteria 687
23 Ga0070692_10267660 3300005345 Bacteria 1030
24 Ga0070668_101422395 3300005347 Bacteria 633
25 Ga0070669_100461009 3300005353 Bacteria 1049
26 Ga0070669_100616587 3300005353 Bacteria 910
27 Ga0070675_100532021 3300005354 Bacteria 1061
28 Ga0070675_100668713 3300005354 Bacteria 944
29 Ga0070671_100032207 3300005355 Bacteria 4335
30 Ga0070671_100044367 3300005355 Bacteria 3695
31 Ga0070671_100715074 3300005355 Unclassified 869
32 Ga0070674_100218494 3300005356 Bacteria 1481
33 Ga0070673_100007939 3300005364 Bacteria 7035
34 Ga0070659_101956787 3300005366 Bacteria 526
35 Ga0070667_100380414 3300005367 Bacteria 1282
36 Ga0070667_100450915 3300005367 Bacteria 1175
37 Ga0070667_102168659 3300005367 Bacteria 523
38 Ga0070714_100769038 3300005435 Unclassified 932
39 Ga0070711_100198159 3300005439 Bacteria 1548
40 Ga0070700_100550212 3300005441 Bacteria 896
41 Ga0070678_100023669 3300005456 Bacteria 4097
42 Ga0070662_100316007 3300005457 Bacteria 1273
43 Ga0070662_101485628 3300005457 Bacteria 584
44 Ga0068867_100023589 3300005459 Bacteria 4405
45 Ga0070684_100682079 3300005535 Bacteria 957
46 Ga0068853_101373784 3300005539 Bacteria 683
47 Ga0070672_100000254 3300005543 Bacteria 30164
48 Ga0070672_100031065 3300005543 Bacteria 4018
49 Ga0070672_100496695 3300005543 Bacteria 1055
50 Ga0070672_101085302 3300005543 Bacteria 711
51 Ga0070665_100129777 3300005548 Bacteria 2523
52 Ga0070704_100923761 3300005549 Unclassified 786
53 Ga0070664_100035794 3300005564 Bacteria 4168
54 Ga0070664_100556037 3300005564 Bacteria 1061
55 Ga0068856_102506929 3300005614 Bacteria 522
56 Ga0068852_100023007 3300005616 Bacteria 5008
57 Ga0068864_101650113 3300005618 Bacteria 645
58 Ga0068866_10446349 3300005718 Bacteria 845
59 Ga0068861_101545965 3300005719 Bacteria 652
60 Ga0068863_102499481 3300005841 Bacteria 526
61 Ga0070712_100303284 3300006175 Unclassified 1293
62 Ga0097621_100205380 3300006237 Bacteria 1712
63 Ga0097621_100937155 3300006237 Bacteria 808
64 Ga0068871_100027968 3300006358 Bacteria 4416
65 Ga0068871_100069403 3300006358 Bacteria 2894
66 Ga0075428_100276998 3300006844 Bacteria 1805
67 Ga0068865_100026962 3300006881 Bacteria 3792
68 Ga0075436_100038327 3300006914 Bacteria 3308
69 Ga0075435_100412024 3300007076 Bacteria 1163
70 Ga0111539_10019210 3300009094 Bacteria 8441
71 Ga0105242_10214371 3300009176 Bacteria 1717
72 Ga0105248_10362033 3300009177 Bacteria 1633
73 Ga0105248_10443164 3300009177 Bacteria 1463
74 Ga0105248_11450998 3300009177 Bacteria 777
75 Ga0105239_12368143 3300010375 Bacteria 618
76 Ga0157371_10022839 3300013102 Bacteria 4577
77 Ga0157370_11328412 3300013104 Bacteria 648
78 Ga0157374_10003378 3300013296 Bacteria 13410
79 Ga0157374_10439572 3300013296 Bacteria 1305
80 Ga0157378_10027856 3300013297 Bacteria 4983
81 Ga0163162_10142808 3300013306 Bacteria 2508
82 Ga0163162_10187670 3300013306 Bacteria 2195
83 Ga0157375_10014716 3300013308 Bacteria 6990
84 Ga0157377_10222407 3300014745 Bacteria 1209
85 Ga0157377_10810647 3300014745 Bacteria 691
86 Ga0157376_10042931 3300014969 Bacteria 3709
87 Ga0182005_1063684 3300015265 Bacteria 1008
88 Ga0163161_10110247 3300017792 Bacteria 2057
89 Ga0209672_100163 3300025228 Bacteria 57341
90 Ga0209258_100155 3300025242 Bacteria 157847
91 Ga0209646_1000535 3300025246 Bacteria 16572
92 Ga0209026_1000829 3300025250 Bacteria 16442
93 Ga0209148_1000125 3300025254 Bacteria 184380
94 Ga0209759_1001078 3300025256 Bacteria 17835
95 Ga0209233_1033263 3300025261 Bacteria 1185
96 Ga0209455_1000077 3300025272 Bacteria 279165
97 Ga0207692_10489147 3300025898 Bacteria 779
98 Ga0207680_10002544 3300025903 Bacteria 8505
99 Ga0207705_10578235 3300025909 Bacteria 873
100 Ga0207693_10286020 3300025915 Unclassified 1292
101 Ga0207693_10619435 3300025915 Unclassified 842
102 Ga0207663_10168672 3300025916 Bacteria 1553
103 Ga0207649_10894337 3300025920 Bacteria 696
104 Ga0207681_10202301 3300025923 Bacteria 1526
105 Ga0207650_10005064 3300025925 Bacteria 8994
106 Ga0207650_11654464 3300025925 Bacteria 543
107 Ga0207659_10001136 3300025926 Bacteria 15801
108 Ga0207659_10357862 3300025926 Bacteria 1212
109 Ga0207659_11020426 3300025926 Bacteria 712
110 Ga0207664_10338084 3300025929 Bacteria 1331
111 Ga0207644_10050778 3300025931 Bacteria 2974
112 Ga0207644_10056006 3300025931 Bacteria 2844
113 Ga0207690_10900996 3300025932 Bacteria 734
114 Ga0207706_10248831 3300025933 Bacteria 1553
115 Ga0207669_10006795 3300025937 Bacteria 5258
116 Ga0207691_10000218 3300025940 Bacteria 55649
117 Ga0207691_10805890 3300025940 Bacteria 789
118 Ga0207711_10315179 3300025941 Bacteria 1444
119 Ga0207711_10480888 3300025941 Bacteria 1157
120 Ga0207711_12004076 3300025941 Bacteria 522
121 Ga0207679_10116076 3300025945 Bacteria 2122
122 Ga0207679_10611976 3300025945 Bacteria 983
123 Ga0207679_12159475 3300025945 Unclassified 505
124 Ga0207667_10162277 3300025949 Bacteria 2298
125 Ga0207651_10000305 3300025960 Bacteria 21056
126 Ga0207651_10775912 3300025960 Bacteria 848
127 Ga0207651_11351989 3300025960 Bacteria 641
128 Ga0207651_12087816 3300025960 Unclassified 509
129 Ga0207668_11359034 3300025972 Bacteria 640
130 Ga0207640_11258856 3300025981 Bacteria 659
131 Ga0207658_10141177 3300025986 Bacteria 1949
132 Ga0207658_12028708 3300025986 Bacteria 523
133 Ga0207677_10012694 3300026023 Bacteria 4854
134 Ga0207677_12085315 3300026023 Bacteria 527
135 Ga0207639_11096919 3300026041 Bacteria 746
136 Ga0207708_10619252 3300026075 Bacteria 919
137 Ga0207648_10121983 3300026089 Bacteria 2292
138 Ga0207676_11620485 3300026095 Bacteria 645
139 Ga0207675_101590528 3300026118 Bacteria 674
140 Ga0207683_10003034 3300026121 Bacteria 14674
141 Ga0207698_10050552 3300026142 Bacteria 3172
142 Ga0207428_10454334 3300027907 Bacteria 934
143 Ga0268266_10658031 3300028379 Bacteria 1008
144 Ga0268266_10829623 3300028379 Bacteria 893
145 Ga0265336_10041803 3300028666 Bacteria 1400
146 Ga0265338_10146782 3300028800 Bacteria 1839
147 Ga0265330_10496961 3300031235 Bacteria 519
148 Ga0265329_10056425 3300031242 Bacteria 1245
149 Ga0265331_10015268 3300031250 Bacteria 4060
150 Ga0265327_10000599 3300031251 Bacteria 59784
151 Ga0265327_10001014 3300031251 Bacteria 39680
152 Ga0265327_10013654 3300031251 Bacteria 5380
153 Ga0265327_10019287 3300031251 Bacteria 4198
154 Ga0265327_10133955 3300031251 Bacteria 1163
155 Ga0265327_10396592 3300031251 Bacteria 599
156 Ga0265316_10000263 3300031344 Bacteria 60136
157 Ga0265316_10566196 3300031344 Bacteria 808
158 Ga0265316_10873721 3300031344 Bacteria 629
159 Ga0316575_10012084 3300031665 Bacteria 3205
160 Ga0316575_10026325 3300031665 Unclassified 2260
161 Ga0316575_10032534 3300031665 Bacteria 2043
162 Ga0316575_10067186 3300031665 Bacteria 1437
163 Ga0316575_10100409 3300031665 Bacteria 1176
164 Ga0316575_10102047 3300031665 Bacteria 1167
165 Ga0316575_10147457 3300031665 Bacteria 970
166 Ga0316575_10170507 3300031665 Bacteria 902
167 Ga0316575_10189695 3300031665 Bacteria 855
168 Ga0316579_10002046 3300031691 Bacteria 7555
169 Ga0316579_10002653 3300031691 Bacteria 6792
170 Ga0316579_10095505 3300031691 Unclassified 1421
171 Ga0316579_10125451 3300031691 Bacteria 1235
172 Ga0316579_10147931 3300031691 Bacteria 1133
173 Ga0316579_10181069 3300031691 Bacteria 1019
174 Ga0316579_10324296 3300031691 Bacteria 745
175 Ga0316579_10485807 3300031691 Bacteria 597
176 Ga0316579_10577328 3300031691 Bacteria 544
177 Ga0316579_10611590 3300031691 Bacteria 528
178 Ga0316576_10012965 3300031727 Bacteria 5520
179 Ga0316576_10026297 3300031727 Bacteria 4084
180 Ga0316576_10032664 3300031727 Bacteria 3699
181 Ga0316576_10040203 3300031727 Bacteria 3360
182 Ga0316576_10046769 3300031727 Bacteria 3133
183 Ga0316576_10057952 3300031727 Bacteria 2832
184 Ga0316576_10071663 3300031727 Bacteria 2556
185 Ga0316576_10147599 3300031727 Bacteria 1772
186 Ga0316576_10148490 3300031727 Unclassified 1766
187 Ga0316576_10297205 3300031727 Bacteria 1207
188 Ga0316576_10321560 3300031727 Bacteria 1154
189 Ga0316576_10324517 3300031727 Bacteria 1148
190 Ga0316576_10543930 3300031727 Bacteria 851
191 Ga0316576_10595244 3300031727 Bacteria 807
192 Ga0316576_10748343 3300031727 Unclassified 706
193 Ga0316578_10007768 3300031728 Bacteria 5410
194 Ga0316578_10008816 3300031728 Bacteria 5155
195 Ga0316578_10024686 3300031728 Bacteria 3373
196 Ga0316578_10034170 3300031728 Bacteria 2918
197 Ga0316578_10056219 3300031728 Bacteria 2311
198 Ga0316578_10057706 3300031728 Bacteria 2281
199 Ga0316578_10076183 3300031728 Bacteria 1991
200 Ga0316578_10128509 3300031728 Bacteria 1524
201 Ga0316578_10177792 3300031728 Bacteria 1283
202 Ga0316578_10195132 3300031728 Bacteria 1219
203 Ga0316578_10277382 3300031728 Bacteria 1004
204 Ga0316578_10281714 3300031728 Bacteria 995
205 Ga0316577_10005467 3300031733 Bacteria 6665
206 Ga0316577_10006364 3300031733 Bacteria 6230
207 Ga0316577_10007076 3300031733 Bacteria 5970
208 Ga0316577_10031169 3300031733 Bacteria 2979
209 Ga0316577_10037201 3300031733 Bacteria 2722
210 Ga0316577_10037800 3300031733 Bacteria 2699
211 Ga0316577_10037898 3300031733 Bacteria 2695
212 Ga0316577_10282398 3300031733 Bacteria 940
213 Ga0316577_10294388 3300031733 Bacteria 919
214 Ga0316577_10366872 3300031733 Bacteria 818
215 Ga0316577_10465603 3300031733 Bacteria 718
216 Ga0316577_10561120 3300031733 Unclassified 649
217 Ga0316583_10002801 3300032133 Bacteria 6095
218 Ga0316583_10003641 3300032133 Bacteria 5443
219 Ga0316583_10004015 3300032133 Bacteria 5229
220 Ga0316583_10046557 3300032133 Bacteria 1530
221 Ga0316583_10105956 3300032133 Unclassified 980
222 Ga0316583_10112619 3300032133 Bacteria 948
223 Ga0316585_10000037 3300032137 Bacteria 20432
224 Ga0316585_10061116 3300032137 Bacteria 1217
225 Ga0316585_10145773 3300032137 Bacteria 781
226 Ga0316580_10038356 3300032139 Bacteria 1481
227 Ga0316580_10081067 3300032139 Bacteria 992
228 Ga0316580_10093469 3300032139 Bacteria 920
229 Ga0316580_10279931 3300032139 Bacteria 517
230 Ga0316586_1049458 3300033527 Bacteria 751
231 Ga0373926_0027431 3300035083 Unclassified 1996
232 Ga0373923_0192108 3300035111 Archaea 941
233 Ga0373957_0394228 3300035120 Archaea 595
234 Ga0373955_1026645 3300035172 Bacteria 508
235 Ga0316574_0000300 3300035398 Bacteria 18658
236 Ga0316574_0001825 3300035398 Bacteria 10360
237 Ga0316574_0008693 3300035398 Bacteria 5650
238 Ga0316574_0009347 3300035398 Bacteria 5488
239 Ga0316574_0017224 3300035398 Bacteria 4225
240 Ga0316574_0025256 3300035398 Bacteria 3565
241 Ga0316574_0047742 3300035398 Bacteria 2658
242 Ga0316574_0062256 3300035398 Bacteria 2345
243 Ga0316574_0101820 3300035398 Bacteria 1839
244 Ga0316574_0103336 3300035398 Bacteria 1824
245 Ga0316574_0158390 3300035398 Bacteria 1459
246 Ga0316574_0173148 3300035398 Bacteria 1389
247 Ga0316574_0187970 3300035398 Bacteria 1328
248 Ga0316574_0224135 3300035398 Bacteria 1204
249 Ga0316574_0374020 3300035398 Bacteria 899
250 Ga0316574_0436325 3300035398 Bacteria 822
251 Ga0316574_0571977 3300035398 Bacteria 700
252 Ga0316574_0668540 3300035398 Bacteria 638
253 Ga0316574_0681376 3300035398 Bacteria 631
254 Ga0316574_0882567 3300035398 Bacteria 542
255 Ga0373924_0456131 3300035410 Archaea 573
256 Ga0373935_0016153 3300035692 Bacteria 4518
257 Ga0373927_0106387 3300035695 Unclassified 1827
258 Ga0373933_0369253 3300035724 Bacteria 934
259 Ga0373947_0046221 3300035725 Bacteria 2607
260 Ga0373937_0809701 3300036401 Bacteria 885
261 Ga0373937_1147388 3300036401 Bacteria 726
262 Ga0316582_0002270 3300036647 Bacteria 8963
263 Ga0316582_0002955 3300036647 Bacteria 8187
264 Ga0316582_0005131 3300036647 Bacteria 6700
265 Ga0316582_0006464 3300036647 Bacteria 6155
266 Ga0316582_0006867 3300036647 Bacteria 6017
267 Ga0316582_0031189 3300036647 Bacteria 3256
268 Ga0316582_0031793 3300036647 Bacteria 3229
269 Ga0316582_0174289 3300036647 Bacteria 1461
270 Ga0316582_0260866 3300036647 Bacteria 1188
271 Ga0316582_0333308 3300036647 Bacteria 1043
272 Ga0316582_0445319 3300036647 Bacteria 893
273 Ga0316582_0472775 3300036647 Unclassified 864
274 Ga0316582_0499061 3300036647 Bacteria 839
275 Ga0316582_0522404 3300036647 Bacteria 818
276 Ga0316582_0592695 3300036647 Unclassified 763
277 Ga0316582_0790264 3300036647 Bacteria 650
278 Ga0316582_1010797 3300036647 Bacteria 567
279 Ga0316584_0000405 3300036712 Bacteria 22510
280 Ga0316584_0004659 3300036712 Bacteria 9089
281 Ga0316584_0010687 3300036712 Bacteria 6428
282 Ga0316584_0011607 3300036712 Bacteria 6196
283 Ga0316584_0017808 3300036712 Bacteria 5115
284 Ga0316584_0030937 3300036712 Bacteria 3957
285 Ga0316584_0044043 3300036712 Bacteria 3328
286 Ga0316584_0066285 3300036712 Bacteria 2706
287 Ga0316584_0160127 3300036712 Bacteria 1672
288 Ga0316584_0230907 3300036712 Bacteria 1356
289 Ga0316584_0271175 3300036712 Bacteria 1235
290 Ga0316584_0384491 3300036712 Unclassified 1002
291 Ga0316584_0462011 3300036712 Bacteria 896
292 Ga0316584_0908875 3300036712 Bacteria 592
293 Ga0316584_0960815 3300036712 Unclassified 572
294 Ga0373925_0472728 3300037068 Bacteria 1028
295 Ga0395900_0000028 3300037418 Bacteria 285042
296 Ga0316581_0076580 3300037588 Bacteria 1028
297 Ga0316581_0108113 3300037588 Unclassified 856
298 Ga0395901_0000076 3300038443 Bacteria 138169
299 Ga0400484_38180 3300038725 Bacteria 22723
300 Ga0439460_0151888 3300042461 Unclassified 773
301 Ga0451577_0000184 3300042876 Bacteria 132503
302 Ga0451577_0855132 3300042876 Unclassified 820
303 Ga0451577_1509355 3300042876 Bacteria 594
304 Ga0453684_0000738 3300044712 Bacteria 114519
305 Ga0453684_0001455 3300044712 Bacteria 67258
306 Ga0453684_0002053 3300044712 Bacteria 51225
307 Ga0453684_1309567 3300044712 Bacteria 755
308 Ga0453684_1309640 3300044712 Bacteria 755
309 Ga0453684_1579058 3300044712 Unclassified 674
310 Ga0453684_1729807 3300044712 Bacteria 638
311 Ga0453684_1789004 3300044712 Bacteria 625
312 Ga0451576_0605566 3300045051 Unclassified 1151
313 Ga0451576_2432927 3300045051 Unclassified 535
314 Ga0495629_0116150 3300046459 Bacteria 1865
315 Ga0495651_0150561 3300046462 Archaea 1678
316 Ga0495653_0393160 3300046463 Archaea 883
317 Ga0495582_0127400 3300046473 Unclassified 1437
318 Ga0495639_0161715 3300046475 Archaea 1084
319 Ga0495594_0044155 3300046499 Unclassified 2444
320 Ga0495640_0597304 3300046533 Bacteria 667
321 Ga0495635_0014566 3300046663 Bacteria 5500
322 Ga0495588_0228069 3300046674 Archaea 983
323 Ga0495657_0002508 3300046675 Bacteria 15434
324 Ga0495657_0134676 3300046675 Bacteria 1545
325 Ga0495646_0619136 3300046680 Bacteria 549
326 Ga0495658_0181361 3300046683 Bacteria 1306
327 Ga0495658_0432844 3300046683 Archaea 840
328 Ga0495613_0246817 3300046689 Bacteria 1247
329 Ga0495600_0338137 3300046809 Archaea 944
330 Ga0495581_0456764 3300047315 Archaea 744
331 Ga0495604_0236651 3300047317 Bacteria 1251
332 Ga0495676_0272390 3300047321 Archaea 1148
333 Ga0495675_0519960 3300047444 Bacteria 681
334 Ga0495602_0496207 3300048088 Bacteria 854
335 Ga0495614_0220431 3300048089 Archaea 862
336 Ga0496100_0304698 3300048903 Bacteria 1193
337 Ga0496104_0400371 3300048907 Bacteria 1285
338 Ga0496105_0114082 3300048908 Bacteria 2228
339 Ga0496107_0139921 3300048910 Bacteria 1789
340 Ga0496108_0065496 3300048911 Bacteria 3063
341 Ga0496109_0013016 3300048912 Bacteria 7195
342 Ga0496113_0757091 3300048916 Bacteria 773
343 Ga0496114_0004838 3300048917 Bacteria 10493
344 Ga0496115_1394616 3300048918 Bacteria 518
345 Ga0496116_0015164 3300048919 Bacteria 6108
346 Ga0496117_0090150 3300048920 Bacteria 1977
347 Ga0496121_0126382 3300048924 Bacteria 1921
348 Ga0501031_0010742 3300049568 Bacteria 5965
349 Ga0501031_0122890 3300049568 Bacteria 1695
350 Ga0501031_0144714 3300049568 Bacteria 1553
351 Ga0501031_0810925 3300049568 Bacteria 600
352 Ga0501032_0025467 3300049569 Bacteria 4078
353 Ga0501032_0283372 3300049569 Bacteria 1073
354 Ga0501032_0435386 3300049569 Bacteria 841
355 Ga0501033_0309110 3300049570 Bacteria 1112
356 Ga0501034_0377830 3300049571 Bacteria 1342
357 Ga0501036_0020883 3300049572 Bacteria 5500
358 Ga0501036_0207689 3300049572 Bacteria 1646
359 Ga0501036_1696242 3300049572 Bacteria 509
360 Ga0501037_0017819 3300049573 Bacteria 5228
361 Ga0501038_0061028 3300049574 Bacteria 3225
362 Ga0501038_0154889 3300049574 Bacteria 1867
363 Ga0501038_0446727 3300049574 Bacteria 995
364 Ga0501038_0921246 3300049574 Bacteria 644
365 Ga0501039_0029055 3300049575 Bacteria 4257
366 Ga0501039_0171747 3300049575 Bacteria 1704
367 Ga0501039_0659196 3300049575 Bacteria 819
368 Ga0501040_0333769 3300049576 Bacteria 1085
369 Ga0501040_0607082 3300049576 Bacteria 790
370 Ga0501040_0882051 3300049576 Bacteria 648
371 Ga0501041_0045321 3300049577 Bacteria 2673
372 Ga0501041_0267911 3300049577 Bacteria 1074
373 Ga0501041_0713321 3300049577 Bacteria 642
374 Ga0501042_0001747 3300049578 Bacteria 12995
375 Ga0501042_0036877 3300049578 Bacteria 3469
376 Ga0501042_0191924 3300049578 Bacteria 1473
377 Ga0501043_0104576 3300049579 Bacteria 2225
378 Ga0501046_0003332 3300049580 Bacteria 14759
379 Ga0501047_0094655 3300049581 Bacteria 2866
380 Ga0501048_0019045 3300049582 Bacteria 5043
381 Ga0501048_0039579 3300049582 Bacteria 3382
382 Ga0501048_0863442 3300049582 Bacteria 651
383 Ga0501071_0249513 3300049587 Bacteria 1339
384 Ga0501071_1128279 3300049587 Unclassified 606
385 Ga0501071_1449100 3300049587 Bacteria 530
386 Ga0501072_0042191 3300049588 Bacteria 3584
387 Ga0501075_0217400 3300049591 Bacteria 1458
388 Ga0501075_0508864 3300049591 Unclassified 919
389 Ga0501075_0803367 3300049591 Bacteria 716
390 Ga0501075_1541269 3300049591 Bacteria 503
391 Ga0501076_0030079 3300049592 Bacteria 4229
392 Ga0501076_0344362 3300049592 Bacteria 1224
393 Ga0501076_0818464 3300049592 Bacteria 768
394 Ga0501077_0009867 3300049593 Bacteria 5938
395 Ga0501077_0918192 3300049593 Bacteria 563
396 Ga0501257_237606 3300049686 Bacteria 536
397 Ga0501079_0203480 3300049741 Bacteria 1547
398 Ga0501079_1217239 3300049741 Bacteria 593
399 Ga0501079_1319026 3300049741 Bacteria 568
400 Ga0501080_1384826 3300049742 Unclassified 600
401 Ga0501081_0191865 3300049743 Bacteria 1479
402 Ga0501081_0574367 3300049743 Bacteria 843
403 Ga0501081_0603826 3300049743 Bacteria 822
404 Ga0501035_0001960 3300049822 Bacteria 20598
405 Ga0501035_0040908 3300049822 Bacteria 4186
406 Ga0501035_0464190 3300049822 Bacteria 1046
407 Ga0501035_0473685 3300049822 Bacteria 1034
408 Ga0501044_0068388 3300049823 Bacteria 3618
409 Ga0501044_0164933 3300049823 Bacteria 2190
410 Ga0501045_0194542 3300049824 Bacteria 1511
411 Ga0501045_1025383 3300049824 Unclassified 605
412 nmdc:mga08y16_164901_c1 3300050511 Bacteria 2302
413 nmdc:mga0rr50_205791_c1 3300050513 Unclassified 1619
414 nmdc:mga0rr50_351661_c1 3300050513 Bacteria 1239
415 nmdc:mga08x19_36468_c1 3300050514 Bacteria 3114
416 Ga0495601_0810646 3300053077 Bacteria 594
417 Ga0495619_0080421 3300053085 Archaea 2193
418 Ga0501082_0306568 3300060353 Bacteria 1383
419 Ga0501082_0364308 3300060353 Bacteria 1261
420 Ga0530510_0917811 3300061734 Unclassified 669
421 2894513552 2894510363 Bacteria 5121143
422 2989394375 2989392574 Bacteria 4554005
423 8001525213 8001522603 Bacteria 4726425
424 Ga0501033_0860892
425 JGI25157J39369_1003562
426 Ga0055527_1001855
427 Ga0055535_1001648
428 Ga0055542_1000569
429 Ga0055529_1000258
430 Ga0065712_10291531
431 Ga0065715_10779383
432 Ga0065707_10870863
433 Ga0070658_10697741
434 Ga0070658_11136943
435 Ga0070676_10005219
436 Ga0070683_100077717
437 Ga0070683_100783260
438 Ga0070670_100172769
439 Ga0070670_102003761
440 Ga0070666_10002582
441 Ga0070682_101933404
442 Ga0068868_100038109
443 Ga0068868_100125511
444 Ga0070661_100314738
445 Ga0070661_101019109
446 Ga0070692_10267660
447 Ga0070668_101422395
448 Ga0070669_100461009
449 Ga0070669_100616587
450 Ga0070675_100532021
451 Ga0070675_100668713
452 Ga0070671_100032207
453 Ga0070671_100044367
454 Ga0070671_100715074
455 Ga0070674_100218494
456 Ga0070673_100007939
457 Ga0070659_101956787
458 Ga0070667_100380414
459 Ga0070667_100450915
460 Ga0070667_102168659
461 Ga0070714_100769038
462 Ga0070711_100198159
463 Ga0070700_100550212
464 Ga0070678_100023669
465 Ga0070662_100316007
466 Ga0070662_101485628
467 Ga0068867_100023589
468 Ga0070684_100682079
469 Ga0068853_101373784
470 Ga0070672_100000254
471 Ga0070672_100031065
472 Ga0070672_100496695
473 Ga0070672_101085302
474 Ga0070665_100129777
475 Ga0070704_100923761
476 Ga0070664_100035794
477 Ga0070664_100556037
478 Ga0068856_102506929
479 Ga0068852_100023007
480 Ga0068864_101650113
481 Ga0068866_10446349
482 Ga0068861_101545965
483 Ga0068863_102499481
484 Ga0070712_100303284
485 Ga0097621_100205380
486 Ga0097621_100937155
487 Ga0068871_100027968
488 Ga0068871_100069403
489 Ga0075428_100276998
490 Ga0068865_100026962
491 Ga0075436_100038327
492 Ga0075435_100412024
493 Ga0111539_10019210
494 Ga0105242_10214371
495 Ga0105248_10362033
496 Ga0105248_10443164
497 Ga0105248_11450998
498 Ga0105239_12368143
499 Ga0157371_10022839
500 Ga0157370_11328412
501 Ga0157374_10003378
502 Ga0157374_10439572
503 Ga0157378_10027856
504 Ga0163162_10142808
505 Ga0163162_10187670
506 Ga0157375_10014716
507 Ga0157377_10222407
508 Ga0157377_10810647
509 Ga0157376_10042931
510 Ga0182005_1063684
511 Ga0163161_10110247
512 Ga0209672_100163
513 Ga0209258_100155
514 Ga0209646_1000535
515 Ga0209026_1000829
516 Ga0209148_1000125
517 Ga0209759_1001078
518 Ga0209233_1033263
519 Ga0209455_1000077
520 Ga0207692_10489147
521 Ga0207680_10002544
522 Ga0207705_10578235
523 Ga0207693_10286020
524 Ga0207693_10619435
525 Ga0207663_10168672
526 Ga0207649_10894337
527 Ga0207681_10202301
528 Ga0207650_10005064
529 Ga0207650_11654464
530 Ga0207659_10001136
531 Ga0207659_10357862
532 Ga0207659_11020426
533 Ga0207664_10338084
534 Ga0207644_10050778
535 Ga0207644_10056006
536 Ga0207690_10900996
537 Ga0207706_10248831
538 Ga0207669_10006795
539 Ga0207691_10000218
540 Ga0207691_10805890
541 Ga0207711_10315179
542 Ga0207711_10480888
543 Ga0207711_12004076
544 Ga0207679_10116076
545 Ga0207679_10611976
546 Ga0207679_12159475
547 Ga0207667_10162277
548 Ga0207651_10000305
549 Ga0207651_10775912
550 Ga0207651_11351989
551 Ga0207651_12087816
552 Ga0207668_11359034
553 Ga0207640_11258856
554 Ga0207658_10141177
555 Ga0207658_12028708
556 Ga0207677_10012694
557 Ga0207677_12085315
558 Ga0207639_11096919
559 Ga0207708_10619252
560 Ga0207648_10121983
561 Ga0207676_11620485
562 Ga0207675_101590528
563 Ga0207683_10003034
564 Ga0207698_10050552
565 Ga0207428_10454334
566 Ga0268266_10658031
567 Ga0268266_10829623
568 Ga0265336_10041803
569 Ga0265338_10146782
570 Ga0265330_10496961
571 Ga0265329_10056425
572 Ga0265331_10015268
573 Ga0265327_10000599
574 Ga0265327_10001014
575 Ga0265327_10013654
576 Ga0265327_10019287
577 Ga0265327_10133955
578 Ga0265327_10396592
579 Ga0265316_10000263
580 Ga0265316_10566196
581 Ga0265316_10873721
582 Ga0316575_10012084
583 Ga0316575_10026325
584 Ga0316575_10032534
585 Ga0316575_10067186
586 Ga0316575_10100409
587 Ga0316575_10102047
588 Ga0316575_10147457
589 Ga0316575_10170507
590 Ga0316575_10189695
591 Ga0316579_10002046
592 Ga0316579_10002653
593 Ga0316579_10095505
594 Ga0316579_10125451
595 Ga0316579_10147931
596 Ga0316579_10181069
597 Ga0316579_10324296
598 Ga0316579_10485807
599 Ga0316579_10577328
600 Ga0316579_10611590
601 Ga0316576_10012965
602 Ga0316576_10026297
603 Ga0316576_10032664
604 Ga0316576_10040203
605 Ga0316576_10046769
606 Ga0316576_10057952
607 Ga0316576_10071663
608 Ga0316576_10147599
609 Ga0316576_10148490
610 Ga0316576_10297205
611 Ga0316576_10321560
612 Ga0316576_10324517
613 Ga0316576_10543930
614 Ga0316576_10595244
615 Ga0316576_10748343
616 Ga0316578_10007768
617 Ga0316578_10008816
618 Ga0316578_10024686
619 Ga0316578_10034170
620 Ga0316578_10056219
621 Ga0316578_10057706
622 Ga0316578_10076183
623 Ga0316578_10128509
624 Ga0316578_10177792
625 Ga0316578_10195132
626 Ga0316578_10277382
627 Ga0316578_10281714
628 Ga0316577_10005467
629 Ga0316577_10006364
630 Ga0316577_10007076
631 Ga0316577_10031169
632 Ga0316577_10037201
633 Ga0316577_10037800
634 Ga0316577_10037898
635 Ga0316577_10282398
636 Ga0316577_10294388
637 Ga0316577_10366872
638 Ga0316577_10465603
639 Ga0316577_10561120
640 Ga0316583_10002801
641 Ga0316583_10003641
642 Ga0316583_10004015
643 Ga0316583_10046557
644 Ga0316583_10105956
645 Ga0316583_10112619
646 Ga0316585_10000037
647 Ga0316585_10061116
648 Ga0316585_10145773
649 Ga0316580_10038356
650 Ga0316580_10081067
651 Ga0316580_10093469
652 Ga0316580_10279931
653 Ga0316586_1049458
654 Ga0373926_0027431
655 Ga0373923_0192108
656 Ga0373957_0394228
657 Ga0373955_1026645
658 Ga0316574_0000300
659 Ga0316574_0001825
660 Ga0316574_0008693
661 Ga0316574_0009347
662 Ga0316574_0017224
663 Ga0316574_0025256
664 Ga0316574_0047742
665 Ga0316574_0062256
666 Ga0316574_0101820
667 Ga0316574_0103336
668 Ga0316574_0158390
669 Ga0316574_0173148
670 Ga0316574_0187970
671 Ga0316574_0224135
672 Ga0316574_0374020
673 Ga0316574_0436325
674 Ga0316574_0571977
675 Ga0316574_0668540
676 Ga0316574_0681376
677 Ga0316574_0882567
678 Ga0373924_0456131
679 Ga0373935_0016153
680 Ga0373927_0106387
681 Ga0373933_0369253
682 Ga0373947_0046221
683 Ga0373937_0809701
684 Ga0373937_1147388
685 Ga0316582_0002270
686 Ga0316582_0002955
687 Ga0316582_0005131
688 Ga0316582_0006464
689 Ga0316582_0006867
690 Ga0316582_0031189
691 Ga0316582_0031793
692 Ga0316582_0174289
693 Ga0316582_0260866
694 Ga0316582_0333308
695 Ga0316582_0445319
696 Ga0316582_0472775
697 Ga0316582_0499061
698 Ga0316582_0522404
699 Ga0316582_0592695
700 Ga0316582_0790264
701 Ga0316582_1010797
702 Ga0316584_0000405
703 Ga0316584_0004659
704 Ga0316584_0010687
705 Ga0316584_0011607
706 Ga0316584_0017808
707 Ga0316584_0030937
708 Ga0316584_0044043
709 Ga0316584_0066285
710 Ga0316584_0160127
711 Ga0316584_0230907
712 Ga0316584_0271175
713 Ga0316584_0384491
714 Ga0316584_0462011
715 Ga0316584_0908875
716 Ga0316584_0960815
717 Ga0373925_0472728
718 Ga0395900_0000028
719 Ga0316581_0076580
720 Ga0316581_0108113
721 Ga0395901_0000076
722 Ga0400484_38180
723 Ga0439460_0151888
724 Ga0451577_0000184
725 Ga0451577_0855132
726 Ga0451577_1509355
727 Ga0453684_0000738
728 Ga0453684_0001455
729 Ga0453684_0002053
730 Ga0453684_1309567
731 Ga0453684_1309640
732 Ga0453684_1579058
733 Ga0453684_1729807
734 Ga0453684_1789004
735 Ga0451576_0605566
736 Ga0451576_2432927
737 Ga0495629_0116150
738 Ga0495651_0150561
739 Ga0495653_0393160
740 Ga0495582_0127400
741 Ga0495639_0161715
742 Ga0495594_0044155
743 Ga0495640_0597304
744 Ga0495635_0014566
745 Ga0495588_0228069
746 Ga0495657_0002508
747 Ga0495657_0134676
748 Ga0495646_0619136
749 Ga0495658_0181361
750 Ga0495658_0432844
751 Ga0495613_0246817
752 Ga0495600_0338137
753 Ga0495581_0456764
754 Ga0495604_0236651
755 Ga0495676_0272390
756 Ga0495675_0519960
757 Ga0495602_0496207
758 Ga0495614_0220431
759 Ga0496100_0304698
760 Ga0496104_0400371
761 Ga0496105_0114082
762 Ga0496107_0139921
763 Ga0496108_0065496
764 Ga0496109_0013016
765 Ga0496113_0757091
766 Ga0496114_0004838
767 Ga0496115_1394616
768 Ga0496116_0015164
769 Ga0496117_0090150
770 Ga0496121_0126382
771 Ga0501031_0010742
772 Ga0501031_0122890
773 Ga0501031_0144714
774 Ga0501031_0810925
775 Ga0501032_0025467
776 Ga0501032_0283372
777 Ga0501032_0435386
778 Ga0501033_0309110
779 Ga0501034_0377830
780 Ga0501036_0020883
781 Ga0501036_0207689
782 Ga0501036_1696242
783 Ga0501037_0017819
784 Ga0501038_0061028
785 Ga0501038_0154889
786 Ga0501038_0446727
787 Ga0501038_0921246
788 Ga0501039_0029055
789 Ga0501039_0171747
790 Ga0501039_0659196
791 Ga0501040_0333769
792 Ga0501040_0607082
793 Ga0501040_0882051
794 Ga0501041_0045321
795 Ga0501041_0267911
796 Ga0501041_0713321
797 Ga0501042_0001747
798 Ga0501042_0036877
799 Ga0501042_0191924
800 Ga0501043_0104576
801 Ga0501046_0003332
802 Ga0501047_0094655
803 Ga0501048_0019045
804 Ga0501048_0039579
805 Ga0501048_0863442
806 Ga0501071_0249513
807 Ga0501071_1128279
808 Ga0501071_1449100
809 Ga0501072_0042191
810 Ga0501075_0217400
811 Ga0501075_0508864
812 Ga0501075_0803367
813 Ga0501075_1541269
814 Ga0501076_0030079
815 Ga0501076_0344362
816 Ga0501076_0818464
817 Ga0501077_0009867
818 Ga0501077_0918192
819 Ga0501257_237606
820 Ga0501079_0203480
821 Ga0501079_1217239
822 Ga0501079_1319026
823 Ga0501080_1384826
824 Ga0501081_0191865
825 Ga0501081_0574367
826 Ga0501081_0603826
827 Ga0501035_0001960
828 Ga0501035_0040908
829 Ga0501035_0464190
830 Ga0501035_0473685
831 Ga0501044_0068388
832 Ga0501044_0164933
833 Ga0501045_0194542
834 Ga0501045_1025383
835 nmdc:mga08y16_164901_c1
836 nmdc:mga0rr50_205791_c1
837 nmdc:mga0rr50_351661_c1
838 nmdc:mga08x19_36468_c1
839 Ga0495601_0810646
840 Ga0495619_0080421
841 Ga0501082_0306568
842 Ga0501082_0364308
843 Ga0530510_0917811
844 2894513552
845 2989394375
846 8001525213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00137

ATP-synt_C

ATP synthase subunit C

25

88

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8szz-assembly1.cif.gz_V cryoem structure of computationally designed nanocage o32-zl4 0.8758 11 78
5j0i-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8755 12 80
8szz-assembly1.cif.gz_R cryoem structure of computationally designed nanocage o32-zl4 0.8696 16 78
8szz-assembly1.cif.gz_W cryoem structure of computationally designed nanocage o32-zl4 0.8665 16 78
5j10-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8539 16 78
ID Description Score Start End Superfamily
af_Q7GB25_910_1248_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.8069 2 86 1.20.1560.10
3jcuz00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Photosystem II PsbZ, reaction centre 0.8016 23 71 1.10.287.740
af_B9FZ43_44_343_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.7996 3 76 1.20.1560.10
af_Q54P13_245_575_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.7968 2 78 1.20.1560.10
5fl7S00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7899 30 79 1.20.20.10
ID Description Score Start End GO Terms
AF-I0IQ12-F1-model_v4 Uncharacterized protein 0.8737 3 76 GO:0003824
GO:0009288
GO:0050920
AF-X0UNH1-F1-model_v4 Transposase IS204/IS1001/IS1096/IS1165 DDE domain-containing protein 0.8388 15 84
AF-A0A1R7QDS6-F1-model_v4 Uncharacterized protein 0.8192 2 76
AF-A0A7J0D6J5-F1-model_v4 ATP synthase subunit 9, mitochondrial 0.8078 12 79 GO:0003954
GO:0008137
GO:0008289
GO:0009536
GO:0015986
GO:0015990
GO:0042773
GO:0045263
AF-W9GD39-F1-model_v4 Histidine kinase 0.7995 1 87 GO:0016020

Map