F440588

General Info

Members Datasets Scaffolds Average Seq Length
423 219 408 270

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0053859|Ga0495584_0053859_516_1460
Length 314
Sequence MIGAVPATWTCGPTRIALEYPTVATYGESAGTTRLSIPLVSPAVDALRQVEAWPAQTVAVGLLRGGEEVAAHGAREHVFRWASVTKPATALAALVAAEEGILDLDQPAGPPGSTVRHLLAHASGLPFDGDKPIAQPGQRRIYSNTGFEVLAETVGAAAEMPFGKYLTAAVLRSLETSAELRGSPAGGLYGSLDDLLRLGAELQRPRLVAPETLAEATSVQFPGLVGVLPDVGRMDPNDWGLGFELRDSKEPHWTGSRNSPRTFGHFGGSGTFLWVDPEADLVLACLSDLDFGPWALEAWPQLSDAVLAENPGVA

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
4 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
5 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
6 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
7 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
8 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
9 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
10 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
11 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
12 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
13 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
14 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
15 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
119 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
124 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
125 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 0
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 7.8
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10312223 3300003323 Bacteria 2403
2 JGI25407J50210_10009703 3300003373 Bacteria 2443
3 JGI25407J50210_10022522 3300003373 Bacteria 1637
4 Ga0070670_100001270 3300005331 Bacteria 20103
5 Ga0070682_100108365 3300005337 Bacteria 1846
6 Ga0070682_100420934 3300005337 Bacteria 1015
7 Ga0070660_100112427 3300005339 Bacteria 2168
8 Ga0070661_100135201 3300005344 Bacteria 1855
9 Ga0070668_100000484 3300005347 Bacteria 26357
10 Ga0070671_100060988 3300005355 Bacteria 3140
11 Ga0070659_100155606 3300005366 Bacteria 1867
12 Ga0070709_10047717 3300005434 Bacteria 2669
13 Ga0070709_10196646 3300005434 Bacteria 1426
14 Ga0070714_100655970 3300005435 Bacteria 1010
15 Ga0070713_100248517 3300005436 Bacteria 1622
16 Ga0070711_100054581 3300005439 Bacteria 2758
17 Ga0070705_100040414 3300005440 Bacteria 2652
18 Ga0070708_100012197 3300005445 Bacteria 7008
19 Ga0070662_100283327 3300005457 Unclassified 1342
20 Ga0070681_10038348 3300005458 Bacteria 4804
21 Ga0070681_10042382 3300005458 Bacteria 4561
22 Ga0070706_100026484 3300005467 Bacteria 5334
23 Ga0070706_100068686 3300005467 Bacteria 3277
24 Ga0070706_100209372 3300005467 Bacteria 1821
25 Ga0070706_100450018 3300005467 Bacteria 1198
26 Ga0070706_100467956 3300005467 Bacteria 1173
27 Ga0070698_100010129 3300005471 Bacteria 10068
28 Ga0070698_100029428 3300005471 Bacteria 5703
29 Ga0070698_100117130 3300005471 Bacteria 2626
30 Ga0070698_100201049 3300005471 Bacteria 1928
31 Ga0070699_100018189 3300005518 Bacteria 6037
32 Ga0070699_100155300 3300005518 Bacteria 2025
33 Ga0070699_100202724 3300005518 Bacteria 1764
34 Ga0070679_100143356 3300005530 Bacteria 2367
35 Ga0070697_100111363 3300005536 Bacteria 2282
36 Ga0070697_100208895 3300005536 Bacteria 1661
37 Ga0070697_100297694 3300005536 Bacteria 1387
38 Ga0068853_100060180 3300005539 Bacteria 3281
39 Ga0068853_100211779 3300005539 Bacteria 1767
40 Ga0070695_100255776 3300005545 Bacteria 1277
41 Ga0070696_100053476 3300005546 Bacteria 2811
42 Ga0070704_100204112 3300005549 Bacteria 1597
43 Ga0068855_100238118 3300005563 Bacteria 2035
44 Ga0068855_100403402 3300005563 Bacteria 1498
45 Ga0068857_100154831 3300005577 Bacteria 2078
46 Ga0068854_100083320 3300005578 Bacteria 2364
47 Ga0068856_100126920 3300005614 Bacteria 2554
48 Ga0068852_100064049 3300005616 Bacteria 3203
49 Ga0068852_100174593 3300005616 Bacteria 2017
50 Ga0068870_10019941 3300005840 Bacteria 3257
51 Ga0068862_100036462 3300005844 Bacteria 4168
52 Ga0081455_10003300 3300005937 Bacteria 18672
53 Ga0081455_10019732 3300005937 Bacteria 6367
54 Ga0081455_10030834 3300005937 Bacteria 4864
55 Ga0081455_10050187 3300005937 Bacteria 3590
56 Ga0081455_10063620 3300005937 Bacteria 3095
57 Ga0081455_10093693 3300005937 Unclassified 2427
58 Ga0081455_10221913 3300005937 Bacteria 1400
59 Ga0081538_10000183 3300005981 Bacteria 68671
60 Ga0081538_10000198 3300005981 Bacteria 66425
61 Ga0081538_10000634 3300005981 Bacteria 38949
62 Ga0081538_10003336 3300005981 Bacteria 15204
63 Ga0081538_10006917 3300005981 Bacteria 9866
64 Ga0081538_10011646 3300005981 Bacteria 7110
65 Ga0081538_10048210 3300005981 Bacteria 2601
66 Ga0081540_1081706 3300005983 Bacteria 1452
67 Ga0081539_10000335 3300005985 Bacteria 104157
68 Ga0070717_10069372 3300006028 Bacteria 2936
69 Ga0070717_10117315 3300006028 Bacteria 2277
70 Ga0070717_10476942 3300006028 Bacteria 1126
71 Ga0075363_100068694 3300006048 Bacteria 1922
72 Ga0075363_100214494 3300006048 Bacteria 1102
73 Ga0070716_100196326 3300006173 Bacteria 1338
74 Ga0070712_100014641 3300006175 Bacteria 5035
75 Ga0070712_100508678 3300006175 Bacteria 1010
76 Ga0075428_100001265 3300006844 Bacteria 26992
77 Ga0075428_100153268 3300006844 Bacteria 2503
78 Ga0075428_100169713 3300006844 Bacteria 2366
79 Ga0075428_100721951 3300006844 Bacteria 1061
80 Ga0075430_100001370 3300006846 Bacteria 19761
81 Ga0075430_100011088 3300006846 Bacteria 7639
82 Ga0075430_100031633 3300006846 Bacteria 4490
83 Ga0075431_100003514 3300006847 Bacteria 15181
84 Ga0075431_100033467 3300006847 Bacteria 5297
85 Ga0075431_100035642 3300006847 Bacteria 5122
86 Ga0075431_100141782 3300006847 Bacteria 2477
87 Ga0075429_100000141 3300006880 Bacteria 43848
88 Ga0075429_100000284 3300006880 Bacteria 35735
89 Ga0075429_100619633 3300006880 Bacteria 948
90 Ga0111539_10004435 3300009094 Bacteria 18338
91 Ga0111539_10030517 3300009094 Bacteria 6551
92 Ga0111539_10721825 3300009094 Bacteria 1160
93 Ga0105245_10042964 3300009098 Bacteria 4032
94 Ga0105245_10077034 3300009098 Bacteria 3039
95 Ga0105245_10175311 3300009098 Bacteria 2045
96 Ga0105245_10837101 3300009098 Bacteria 960
97 Ga0114129_10001605 3300009147 Bacteria 30735
98 Ga0114129_10202133 3300009147 Bacteria 2690
99 Ga0114129_10368035 3300009147 Bacteria 1901
100 Ga0114129_10447965 3300009147 Bacteria 1693
101 Ga0105243_10001854 3300009148 Bacteria 18042
102 Ga0105243_10063699 3300009148 Bacteria 2955
103 Ga0105242_10168748 3300009176 Bacteria 1921
104 Ga0105238_10073515 3300009551 Bacteria 3413
105 Ga0105249_10039896 3300009553 Bacteria 4263
106 Ga0105239_10054695 3300010375 Bacteria 4379
107 Ga0105246_10022828 3300011119 Bacteria 4043
108 Ga0157374_10299582 3300013296 Bacteria 1590
109 Ga0157374_10727230 3300013296 Bacteria 1006
110 Ga0163162_10063445 3300013306 Bacteria 3737
111 Ga0157372_10078801 3300013307 Bacteria 3724
112 Ga0157375_10758871 3300013308 Bacteria 1121
113 Ga0157379_10493702 3300014968 Bacteria 1134
114 Ga0182007_10066890 3300015262 Bacteria 1177
115 Ga0213875_10000834 3300021388 Bacteria 22865
116 Ga0207653_10023548 3300025885 Bacteria 1962
117 Ga0207688_10015033 3300025901 Bacteria 4199
118 Ga0207684_10213976 3300025910 Bacteria 1662
119 Ga0207707_10068774 3300025912 Bacteria 3086
120 Ga0207693_10007728 3300025915 Bacteria 8828
121 Ga0207663_10004347 3300025916 Bacteria 7034
122 Ga0207663_10337656 3300025916 Bacteria 1137
123 Ga0207663_10351371 3300025916 Bacteria 1116
124 Ga0207657_10374885 3300025919 Bacteria 1121
125 Ga0207646_10092417 3300025922 Bacteria 2708
126 Ga0207694_10119745 3300025924 Bacteria 2101
127 Ga0207650_10032098 3300025925 Bacteria 3798
128 Ga0207700_10000002 3300025928 Bacteria 775978
129 Ga0207664_10195681 3300025929 Bacteria 1742
130 Ga0207706_10142957 3300025933 Bacteria 2105
131 Ga0207709_10001086 3300025935 Bacteria 19966
132 Ga0207709_10173940 3300025935 Bacteria 1514
133 Ga0207665_10007283 3300025939 Bacteria 7321
134 Ga0207665_10291514 3300025939 Bacteria 1217
135 Ga0207661_10001654 3300025944 Bacteria 15194
136 Ga0207712_10012537 3300025961 Bacteria 5416
137 Ga0207712_10083500 3300025961 Bacteria 2332
138 Ga0207668_10000225 3300025972 Bacteria 38175
139 Ga0207668_10010187 3300025972 Bacteria 5672
140 Ga0207668_10017453 3300025972 Bacteria 4497
141 Ga0207639_10078758 3300026041 Bacteria 2602
142 Ga0207708_10011666 3300026075 Bacteria 6546
143 Ga0207674_10022746 3300026116 Bacteria 6726
144 Ga0207675_100081685 3300026118 Bacteria 3031
145 Ga0207698_10062653 3300026142 Bacteria 2905
146 Ga0207698_10350762 3300026142 Bacteria 1394
147 Ga0207428_10062110 3300027907 Bacteria 2955
148 Ga0207428_10118383 3300027907 Bacteria 2033
149 Ga0207428_10305038 3300027907 Bacteria 1178
150 Ga0268264_10137787 3300028381 Bacteria 2172
151 Ga0265334_10048734 3300028573 Bacteria 1631
152 Ga0265322_10012254 3300028654 Bacteria 2479
153 Ga0265338_10030698 3300028800 Bacteria 5286
154 Ga0307511_10021484 3300030521 Bacteria 6076
155 Ga0265327_10039687 3300031251 Bacteria 2554
156 Ga0316579_10001182 3300031691 Bacteria 9329
157 Ga0373923_0184452 3300035111 Bacteria 960
158 Ga0373932_0036796 3300035112 Bacteria 1392
159 Ga0395899_0001477 3300037312 Bacteria 20007
160 Ga0395899_0003284 3300037312 Bacteria 12824
161 Ga0395899_0188857 3300037312 Bacteria 1442
162 Ga0395900_0000728 3300037418 Bacteria 43848
163 Ga0395900_0006264 3300037418 Bacteria 12413
164 Ga0395900_0025682 3300037418 Bacteria 6030
165 Ga0395900_0625590 3300037418 Bacteria 1015
166 Ga0395898_0003893 3300037466 Bacteria 16490
167 Ga0395898_0028763 3300037466 Bacteria 5570
168 Ga0395905_0001505 3300037471 Bacteria 27874
169 Ga0395905_0002846 3300037471 Bacteria 18925
170 Ga0395905_0024474 3300037471 Bacteria 5698
171 Ga0395905_0237965 3300037471 Bacteria 1702
172 Ga0436364_1314068 3300037853 Bacteria 23233
173 Ga0436364_1375687 3300037853 Bacteria 1130
174 Ga0436364_1412283 3300037853 Bacteria 6629
175 Ga0395901_0010720 3300038443 Bacteria 9292
176 Ga0395901_0016291 3300038443 Bacteria 7571
177 Ga0395901_0029610 3300038443 Bacteria 5638
178 Ga0395901_0476801 3300038443 Bacteria 1273
179 Ga0436363_0138385 3300039450 Bacteria 1643
180 Ga0436362_1294900 3300039453 Bacteria 1137
181 Ga0439438_045937 3300041405 Bacteria 1123
182 Ga0439466_0008352 3300041411 Bacteria 3903
183 Ga0439465_0009387 3300041413 Bacteria 3081
184 Ga0451839_1443876 3300041496 Bacteria 2289
185 Ga0451853_0848791 3300041512 Bacteria 3600
186 Ga0439431_0001900 3300041997 Bacteria 4631
187 Ga0439450_002919 3300042008 Bacteria 2761
188 Ga0439463_003992 3300042016 Bacteria 3712
189 Ga0439434_0010205 3300042435 Bacteria 2767
190 Ga0439440_0002650 3300042993 Bacteria 3394
191 Ga0466965_0049942 3300044683 Bacteria 2073
192 Ga0466966_0000559 3300044684 Bacteria 23698
193 Ga0466966_0002619 3300044684 Bacteria 11788
194 Ga0466966_0091629 3300044684 Bacteria 1887
195 Ga0466961_0003301 3300044693 Bacteria 10053
196 Ga0466963_0000999 3300044694 Bacteria 14596
197 Ga0466963_0067314 3300044694 Bacteria 2403
198 Ga0466971_0004255 3300044719 Bacteria 6172
199 Ga0466968_0173712 3300044735 Bacteria 999
200 Ga0466970_0003925 3300044765 Bacteria 7285
201 Ga0466970_0239921 3300044765 Bacteria 1014
202 Ga0466957_0015193 3300044842 Bacteria 4495
203 Ga0466957_0139080 3300044842 Bacteria 1563
204 Ga0466960_0004175 3300044901 Bacteria 5619
205 Ga0466959_0131873 3300045049 Bacteria 1771
206 Ga0466959_0180872 3300045049 Bacteria 1474
207 Ga0466958_0000694 3300045836 Bacteria 14653
208 Ga0466958_0088255 3300045836 Bacteria 1916
209 Ga0466967_0013189 3300045976 Bacteria 6372
210 Ga0466967_0015646 3300045976 Bacteria 5954
211 Ga0466967_0016168 3300045976 Bacteria 5874
212 Ga0495592_0201159 3300046454 Bacteria 1344
213 Ga0495629_0254506 3300046459 Bacteria 1208
214 Ga0495653_0192722 3300046463 Bacteria 1389
215 Ga0495584_0053859 3300046491 Bacteria 2025
216 Ga0495584_0169480 3300046491 Bacteria 1110
217 Ga0495585_0130792 3300046492 Bacteria 1321
218 Ga0495652_0199007 3300046529 Unclassified 1522
219 Ga0495652_0323553 3300046529 Bacteria 1113
220 Ga0495645_0091332 3300046543 Bacteria 2175
221 Ga0495667_0207519 3300046559 Bacteria 1252
222 Ga0495635_0126105 3300046663 Bacteria 1746
223 Ga0495635_0384222 3300046663 Bacteria 934
224 Ga0495657_0050454 3300046675 Bacteria 2797
225 Ga0495599_0039984 3300046678 Bacteria 2946
226 Ga0495623_0116234 3300046679 Bacteria 1616
227 Ga0495646_0282346 3300046680 Bacteria 882
228 Ga0495604_0164800 3300047317 Bacteria 1563
229 Ga0495674_0214986 3300047319 Bacteria 1591
230 Ga0495680_0008808 3300047322 Bacteria 9140
231 Ga0495684_0069762 3300047471 Bacteria 2672
232 Ga0495602_0056714 3300048088 Bacteria 3442
233 Ga0496101_0057778 3300048904 Bacteria 2807
234 Ga0496102_0090551 3300048905 Bacteria 2831
235 Ga0496102_0286550 3300048905 Bacteria 1552
236 Ga0496103_0209660 3300048906 Bacteria 1253
237 Ga0496104_0079750 3300048907 Bacteria 3120
238 Ga0496104_0198145 3300048907 Bacteria 1920
239 Ga0496105_0319058 3300048908 Bacteria 1246
240 Ga0496105_0534021 3300048908 Bacteria 917
241 Ga0496108_0013917 3300048911 Bacteria 6561
242 Ga0496108_0016891 3300048911 Bacteria 5965
243 Ga0496108_0056005 3300048911 Bacteria 3312
244 Ga0496108_0085782 3300048911 Bacteria 2673
245 Ga0496109_0033616 3300048912 Bacteria 4613
246 Ga0496109_0103592 3300048912 Bacteria 2641
247 Ga0496109_0186025 3300048912 Bacteria 1951
248 Ga0496109_0207794 3300048912 Bacteria 1841
249 Ga0496110_0000677 3300048913 Bacteria 23384
250 Ga0496110_0034235 3300048913 Bacteria 4399
251 Ga0496110_0046446 3300048913 Bacteria 3799
252 Ga0496110_0086140 3300048913 Bacteria 2804
253 Ga0496110_0121035 3300048913 Bacteria 2358
254 Ga0496111_0000642 3300048914 Bacteria 18440
255 Ga0496111_0003780 3300048914 Bacteria 9435
256 Ga0496111_0039941 3300048914 Bacteria 3366
257 Ga0496111_0079086 3300048914 Bacteria 2398
258 Ga0496111_0312424 3300048914 Bacteria 1164
259 Ga0496112_0117427 3300048915 Bacteria 2630
260 Ga0496112_0144895 3300048915 Bacteria 2344
261 Ga0496112_0198192 3300048915 Bacteria 1968
262 Ga0496113_0024135 3300048916 Bacteria 4318
263 Ga0496113_0175669 3300048916 Bacteria 1697
264 Ga0496114_0526469 3300048917 Bacteria 1045
265 Ga0496115_0018400 3300048918 Bacteria 5364
266 Ga0496117_0114177 3300048920 Bacteria 1675
267 Ga0496118_0001075 3300048921 Bacteria 42667
268 Ga0501031_0005184 3300049568 Bacteria 8496
269 Ga0501031_0027598 3300049568 Bacteria 3701
270 Ga0501032_0006046 3300049569 Bacteria 8926
271 Ga0501033_0052458 3300049570 Bacteria 3022
272 Ga0501034_0002539 3300049571 Bacteria 21826
273 Ga0501034_0006581 3300049571 Bacteria 12464
274 Ga0501036_0011150 3300049572 Bacteria 7436
275 Ga0501036_0013494 3300049572 Bacteria 6790
276 Ga0501036_0019137 3300049572 Bacteria 5745
277 Ga0501036_0021361 3300049572 Bacteria 5441
278 Ga0501036_0027864 3300049572 Bacteria 4776
279 Ga0501036_0050984 3300049572 Bacteria 3504
280 Ga0501037_0006073 3300049573 Bacteria 8823
281 Ga0501037_0006561 3300049573 Bacteria 8515
282 Ga0501038_0036447 3300049574 Bacteria 4316
283 Ga0501038_0123768 3300049574 Bacteria 2130
284 Ga0501038_0247476 3300049574 Bacteria 1413
285 Ga0501038_0321430 3300049574 Bacteria 1211
286 Ga0501038_0345187 3300049574 Bacteria 1160
287 Ga0501039_0002033 3300049575 Bacteria 14978
288 Ga0501039_0003966 3300049575 Bacteria 11118
289 Ga0501039_0164310 3300049575 Bacteria 1745
290 Ga0501039_0382554 3300049575 Bacteria 1105
291 Ga0501040_0004442 3300049576 Bacteria 9107
292 Ga0501040_0124879 3300049576 Bacteria 1807
293 Ga0501041_0015987 3300049577 Bacteria 4459
294 Ga0501041_0146666 3300049577 Bacteria 1472
295 Ga0501041_0178210 3300049577 Bacteria 1330
296 Ga0501041_0193808 3300049577 Bacteria 1273
297 Ga0501042_0009178 3300049578 Bacteria 6578
298 Ga0501042_0020600 3300049578 Bacteria 4591
299 Ga0501042_0202679 3300049578 Bacteria 1430
300 Ga0501043_0002178 3300049579 Bacteria 16718
301 Ga0501043_0029367 3300049579 Bacteria 4319
302 Ga0501046_0006444 3300049580 Bacteria 10393
303 Ga0501046_0007086 3300049580 Bacteria 9871
304 Ga0501046_0041771 3300049580 Bacteria 3658
305 Ga0501046_0051729 3300049580 Bacteria 3240
306 Ga0501046_0093799 3300049580 Bacteria 2307
307 Ga0501046_0252320 3300049580 Bacteria 1298
308 Ga0501047_0022965 3300049581 Bacteria 5987
309 Ga0501048_0009602 3300049582 Bacteria 7260
310 Ga0501048_0029255 3300049582 Bacteria 3997
311 Ga0501048_0153611 3300049582 Bacteria 1628
312 Ga0501048_0204685 3300049582 Bacteria 1399
313 Ga0501048_0257409 3300049582 Bacteria 1240
314 Ga0501048_0268444 3300049582 Bacteria 1212
315 Ga0501068_0447330 3300049584 Bacteria 836
316 Ga0501069_0111941 3300049585 Bacteria 1555
317 Ga0501070_0000482 3300049586 Bacteria 36204
318 Ga0501070_0000545 3300049586 Bacteria 34467
319 Ga0501071_0014291 3300049587 Bacteria 5430
320 Ga0501071_0032064 3300049587 Bacteria 3729
321 Ga0501071_0033160 3300049587 Bacteria 3670
322 Ga0501071_0048820 3300049587 Bacteria 3045
323 Ga0501071_0183415 3300049587 Bacteria 1568
324 Ga0501072_0015576 3300049588 Bacteria 5827
325 Ga0501072_0054322 3300049588 Bacteria 3155
326 Ga0501072_0064706 3300049588 Bacteria 2883
327 Ga0501072_0072687 3300049588 Bacteria 2718
328 Ga0501072_0302463 3300049588 Bacteria 1271
329 Ga0501073_0023699 3300049589 Bacteria 4406
330 Ga0501073_0042005 3300049589 Bacteria 3229
331 Ga0501073_0292972 3300049589 Bacteria 1123
332 Ga0501075_0044839 3300049591 Bacteria 3317
333 Ga0501075_0046684 3300049591 Bacteria 3253
334 Ga0501075_0129359 3300049591 Bacteria 1923
335 Ga0501075_0208451 3300049591 Bacteria 1491
336 Ga0501075_0275496 3300049591 Bacteria 1282
337 Ga0501076_0004311 3300049592 Bacteria 10094
338 Ga0501076_0009766 3300049592 Bacteria 7088
339 Ga0501076_0024684 3300049592 Bacteria 4648
340 Ga0501076_0090245 3300049592 Bacteria 2464
341 Ga0501076_0149867 3300049592 Bacteria 1897
342 Ga0501076_0191711 3300049592 Bacteria 1668
343 Ga0501077_0001956 3300049593 Bacteria 12463
344 Ga0501077_0004973 3300049593 Bacteria 8062
345 Ga0501077_0223578 3300049593 Bacteria 1196
346 Ga0501077_0340428 3300049593 Bacteria 957
347 Ga0501079_0011242 3300049741 Bacteria 6828
348 Ga0501079_0011334 3300049741 Bacteria 6801
349 Ga0501079_0027763 3300049741 Bacteria 4341
350 Ga0501079_0044271 3300049741 Bacteria 3435
351 Ga0501079_0136962 3300049741 Unclassified 1907
352 Ga0501079_0243505 3300049741 Bacteria 1405
353 Ga0501080_0020090 3300049742 Bacteria 6181
354 Ga0501081_0013869 3300049743 Bacteria 5304
355 Ga0501081_0039555 3300049743 Bacteria 3227
356 Ga0501081_0154953 3300049743 Bacteria 1648
357 Ga0501081_0352806 3300049743 Bacteria 1084
358 Ga0501083_0025767 3300049744 Bacteria 4071
359 Ga0501083_0060957 3300049744 Bacteria 2520
360 Ga0501035_0020032 3300049822 Bacteria 6144
361 Ga0501035_0088261 3300049822 Bacteria 2733
362 Ga0501035_0224234 3300049822 Bacteria 1604
363 Ga0501044_0008986 3300049823 Bacteria 10925
364 Ga0501044_0015695 3300049823 Bacteria 8156
365 Ga0501044_0020993 3300049823 Bacteria 6974
366 Ga0501045_0003111 3300049824 Bacteria 11348
367 Ga0501045_0005758 3300049824 Bacteria 8575
368 Ga0501045_0036333 3300049824 Bacteria 3577
369 Ga0501045_0043265 3300049824 Bacteria 3279
370 Ga0501045_0247274 3300049824 Bacteria 1328
371 Ga0501045_0498166 3300049824 Unclassified 905
372 nmdc:mga00v17_101971_c1 3300050491 Bacteria 1812
373 nmdc:mga05p37_3842_c1 3300050507 Bacteria 17568
374 nmdc:mga09592_102068_c1 3300050508 Bacteria 2458
375 nmdc:mga09592_286_c1 3300050508 Bacteria 36825
376 nmdc:mga09592_584459_c1 3300050508 Bacteria 958
377 nmdc:mga0qj67_114592_c1 3300050509 Bacteria 2177
378 nmdc:mga0qj67_2295_c1 3300050509 Bacteria 13596
379 nmdc:mga0qj67_5089_c1 3300050509 Bacteria 9569
380 nmdc:mga06r32_237706_c1 3300050510 Bacteria 1809
381 nmdc:mga06r32_2925_c1 3300050510 Bacteria 15316
382 nmdc:mga06r32_749_c1 3300050510 Bacteria 28529
383 nmdc:mga08y16_111565_c1 3300050511 Bacteria 2847
384 nmdc:mga08y16_375270_c1 3300050511 Bacteria 1458
385 nmdc:mga08y16_4320_c1 3300050511 Bacteria 14847
386 nmdc:mga0rr50_231770_c1 3300050513 Bacteria 1528
387 nmdc:mga0sz30_46614_c1 3300050516 Bacteria 1830
388 Ga0495601_0371801 3300053077 Bacteria 928
389 Ga0500635_0013496 3300053080 Bacteria 2374
390 Ga0500652_000245 3300053131 Bacteria 20504
391 Ga0501084_0011883 3300054114 Bacteria 7208
392 Ga0501084_0075040 3300054114 Bacteria 2833
393 Ga0501084_0102209 3300054114 Bacteria 2407
394 Ga0501084_0282996 3300054114 Bacteria 1400
395 Ga0501084_0293790 3300054114 Bacteria 1372
396 Ga0590075_007499 3300059424 Bacteria 2595
397 Ga0501082_0007418 3300060353 Bacteria 9464
398 Ga0501082_0068119 3300060353 Bacteria 3065
399 Ga0501082_0076970 3300060353 Bacteria 2876
400 Ga0501082_0217977 3300060353 Bacteria 1660
401 Ga0501082_0582547 3300060353 Unclassified 979
402 Ga0466962_0004593 3300061719 Bacteria 6624
403 Ga0530510_0006197 3300061734 Bacteria 8312
404 Ga0530510_0016054 3300061734 Bacteria 5293
405 Ga0530510_0022179 3300061734 Bacteria 4522
406 Ga0530510_0062165 3300061734 Bacteria 2703
407 Ga0530510_0234797 3300061734 Bacteria 1364
408 Ga0530510_0548959 3300061734 Bacteria 877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0043265 Ga0501045_0043265_28_723 221
2 3300053077 Ga0495601_0371801 Ga0495601_0371801_212_889 225
3 3300049584 Ga0501068_0447330 Ga0501068_0447330_10_708 229
4 3300049593 Ga0501077_0340428 Ga0501077_0340428_25_720 231
5 3300045049 Ga0466959_0131873 Ga0466959_0131873_700_1422 232
6 3300050516 nmdc:mga0sz30_46614_c1 nmdc:mga0sz30_46614_c1_1098_1811 234
7 3300049589 Ga0501073_0292972 Ga0501073_0292972_19_762 237
8 3300061734 Ga0530510_0234797 Ga0530510_0234797_12_755 237
9 3300039453 Ga0436362_1294900 Ga0436362_1294900_351_1088 245
10 3300045976 Ga0466967_0013189 Ga0466967_0013189_5565_6311 245
11 3300046675 Ga0495657_0050454 Ga0495657_0050454_31_768 245
12 3300006844 Ga0075428_100721951 Ga0075428_1007219512 252
13 3300006846 Ga0075430_100031633 Ga0075430_1000316336 252
14 3300006880 Ga0075429_100619633 Ga0075429_1006196331 252
15 3300048912 Ga0496109_0186025 Ga0496109_0186025_883_1644 253
16 3300048914 Ga0496111_0079086 Ga0496111_0079086_441_1202 253
17 3300049582 Ga0501048_0268444 Ga0501048_0268444_431_1192 253
18 3300050513 nmdc:mga0rr50_231770_c1 nmdc:mga0rr50_231770_c1_388_1149 253
19 3300009094 Ga0111539_10721825 Ga0111539_107218252 254
20 3300050511 nmdc:mga08y16_375270_c1 nmdc:mga08y16_375270_c1_573_1382 254
21 3300005981 Ga0081538_10048210 Ga0081538_100482104 255
22 3300014968 Ga0157379_10493702 Ga0157379_104937021 257
23 3300048911 Ga0496108_0056005 Ga0496108_0056005_385_1197 257
24 3300048913 Ga0496110_0034235 Ga0496110_0034235_2629_3441 257
25 3300049582 Ga0501048_0153611 Ga0501048_0153611_818_1591 257
26 3300049591 Ga0501075_0275496 Ga0501075_0275496_244_1017 257
27 iso_pu_bacteria 2738543005 2739203462 257
28 3300037312 Ga0395899_0188857 Ga0395899_0188857_114_938 258
29 3300049743 Ga0501081_0352806 Ga0501081_0352806_164_943 259
30 3300005467 Ga0070706_100026484 Ga0070706_1000264845 261
31 3300005471 Ga0070698_100010129 Ga0070698_1000101295 261
32 3300005518 Ga0070699_100202724 Ga0070699_1002027242 261
33 3300006847 Ga0075431_100035642 Ga0075431_1000356423 261
34 3300027907 Ga0207428_10062110 Ga0207428_100621103 261
35 3300038443 Ga0395901_0476801 Ga0395901_0476801_248_1033 261
36 3300049572 Ga0501036_0019137 Ga0501036_0019137_4855_5685 261
37 3300049574 Ga0501038_0247476 Ga0501038_0247476_196_1026 261
38 3300049575 Ga0501039_0164310 Ga0501039_0164310_406_1236 261
39 3300049577 Ga0501041_0193808 Ga0501041_0193808_414_1244 261
40 3300049580 Ga0501046_0093799 Ga0501046_0093799_356_1186 261
41 3300049582 Ga0501048_0257409 Ga0501048_0257409_211_1041 261
42 3300049587 Ga0501071_0048820 Ga0501071_0048820_1836_2666 261
43 3300049588 Ga0501072_0015576 Ga0501072_0015576_4717_5547 261
44 3300049592 Ga0501076_0004311 Ga0501076_0004311_8894_9724 261
45 3300049741 Ga0501079_0011242 Ga0501079_0011242_3422_4252 261
46 3300054114 Ga0501084_0102209 Ga0501084_0102209_752_1582 261
47 3300060353 Ga0501082_0068119 Ga0501082_0068119_305_1135 261
48 3300005467 Ga0070706_100467956 Ga0070706_1004679562 263
49 3300006028 Ga0070717_10476942 Ga0070717_104769421 263
50 3300025922 Ga0207646_10092417 Ga0207646_100924173 263
51 3300028573 Ga0265334_10048734 Ga0265334_100487342 263
52 3300028654 Ga0265322_10012254 Ga0265322_100122542 263
53 3300028800 Ga0265338_10030698 Ga0265338_100306986 263
54 3300031251 Ga0265327_10039687 Ga0265327_100396872 263
55 3300035111 Ga0373923_0184452 Ga0373923_0184452_84_875 263
56 3300046454 Ga0495592_0201159 Ga0495592_0201159_469_1260 263
57 3300046459 Ga0495629_0254506 Ga0495629_0254506_391_1182 263
58 3300046463 Ga0495653_0192722 Ga0495653_0192722_102_893 263
59 3300046529 Ga0495652_0199007 Ga0495652_0199007_550_1341 263
60 3300046529 Ga0495652_0323553 Ga0495652_0323553_296_1087 263
61 3300046543 Ga0495645_0091332 Ga0495645_0091332_1172_1963 263
62 3300046559 Ga0495667_0207519 Ga0495667_0207519_65_856 263
63 3300046663 Ga0495635_0126105 Ga0495635_0126105_599_1390 263
64 3300046663 Ga0495635_0384222 Ga0495635_0384222_100_912 263
65 3300046678 Ga0495599_0039984 Ga0495599_0039984_540_1331 263
66 3300046679 Ga0495623_0116234 Ga0495623_0116234_504_1295 263
67 3300046680 Ga0495646_0282346 Ga0495646_0282346_67_858 263
68 3300047317 Ga0495604_0164800 Ga0495604_0164800_84_875 263
69 3300047319 Ga0495674_0214986 Ga0495674_0214986_550_1341 263
70 3300047322 Ga0495680_0008808 Ga0495680_0008808_1123_1914 263
71 3300047471 Ga0495684_0069762 Ga0495684_0069762_1184_1975 263
72 3300048088 Ga0495602_0056714 Ga0495602_0056714_2108_2899 263
73 3300048918 Ga0496115_0018400 Ga0496115_0018400_732_1523 263
74 3300054114 Ga0501084_0075040 Ga0501084_0075040_196_1011 263
75 3300006844 Ga0075428_100169713 Ga0075428_1001697132 264
76 3300009094 Ga0111539_10004435 Ga0111539_100044353 264
77 3300027907 Ga0207428_10118383 Ga0207428_101183832 264
78 3300044735 Ga0466968_0173712 Ga0466968_0173712_136_930 264
79 3300050511 nmdc:mga08y16_4320_c1 nmdc:mga08y16_4320_c1_12899_13720 264
80 iso_pu_bacteria 2751185725 2753038232 264
81 iso_pu_bacteria 2751185792 2753326743 264
82 3300005937 Ga0081455_10063620 Ga0081455_100636203 265
83 3300009147 Ga0114129_10368035 Ga0114129_103680353 265
84 3300015262 Ga0182007_10066890 Ga0182007_100668901 265
85 3300048917 Ga0496114_0526469 Ga0496114_0526469_197_1000 265
86 3300050509 nmdc:mga0qj67_114592_c1 nmdc:mga0qj67_114592_c1_735_1547 265
87 3300006175 Ga0070712_100508678 Ga0070712_1005086782 266
88 3300025916 Ga0207663_10337656 Ga0207663_103376562 266
89 iso_pu_bacteria 2738541308 2738889847 266
90 iso_pu_bacteria 2744054611 2744953963 266
91 3300005331 Ga0070670_100001270 Ga0070670_10000127020 267
92 3300005458 Ga0070681_10038348 Ga0070681_100383483 267
93 3300005467 Ga0070706_100209372 Ga0070706_1002093722 267
94 3300005578 Ga0068854_100083320 Ga0068854_1000833204 267
95 3300006028 Ga0070717_10069372 Ga0070717_100693723 267
96 3300006846 Ga0075430_100001370 Ga0075430_1000013703 267
97 3300006847 Ga0075431_100033467 Ga0075431_1000334675 267
98 3300006880 Ga0075429_100000284 Ga0075429_10000028439 267
99 3300009098 Ga0105245_10077034 Ga0105245_100770344 267
100 3300009147 Ga0114129_10447965 Ga0114129_104479652 267
101 3300009553 Ga0105249_10039896 Ga0105249_100398963 267
102 3300010375 Ga0105239_10054695 Ga0105239_100546953 267
103 3300011119 Ga0105246_10022828 Ga0105246_100228283 267
104 3300013306 Ga0163162_10063445 Ga0163162_100634453 267
105 3300013308 Ga0157375_10758871 Ga0157375_107588712 267
106 3300025910 Ga0207684_10213976 Ga0207684_102139762 267
107 3300025925 Ga0207650_10032098 Ga0207650_100320983 267
108 3300025961 Ga0207712_10012537 Ga0207712_100125377 267
109 3300025972 Ga0207668_10017453 Ga0207668_100174532 267
110 3300037312 Ga0395899_0001477 Ga0395899_0001477_3269_4072 267
111 3300037312 Ga0395899_0003284 Ga0395899_0003284_1618_2421 267
112 3300037418 Ga0395900_0000728 Ga0395900_0000728_2057_2860 267
113 3300037418 Ga0395900_0025682 Ga0395900_0025682_63_866 267
114 3300037418 Ga0395900_0625590 Ga0395900_0625590_49_852 267
115 3300037466 Ga0395898_0028763 Ga0395898_0028763_2343_3146 267
116 3300037471 Ga0395905_0001505 Ga0395905_0001505_24049_24852 267
117 3300037471 Ga0395905_0024474 Ga0395905_0024474_2425_3228 267
118 3300037471 Ga0395905_0237965 Ga0395905_0237965_601_1404 267
119 3300038443 Ga0395901_0010720 Ga0395901_0010720_3497_4300 267
120 3300038443 Ga0395901_0016291 Ga0395901_0016291_6518_7321 267
121 3300041512 Ga0451853_0848791 Ga0451853_0848791_1156_1959 267
122 3300048904 Ga0496101_0057778 Ga0496101_0057778_1569_2372 267
123 3300048905 Ga0496102_0286550 Ga0496102_0286550_611_1414 267
124 3300048906 Ga0496103_0209660 Ga0496103_0209660_67_870 267
125 3300048907 Ga0496104_0079750 Ga0496104_0079750_100_903 267
126 3300048913 Ga0496110_0086140 Ga0496110_0086140_321_1124 267
127 3300050508 nmdc:mga09592_286_c1 nmdc:mga09592_286_c1_1887_2690 267
128 3300050509 nmdc:mga0qj67_5089_c1 nmdc:mga0qj67_5089_c1_1745_2548 267
129 3300050510 nmdc:mga06r32_749_c1 nmdc:mga06r32_749_c1_16273_17076 267
130 iso_pu_bacteria 2738543011 2739238351 267
131 iso_pu_bacteria 2889300758 2889302311 267
132 iso_pu_bacteria 2902837492 2902838745 267
133 iso_pu_bacteria 2939743619 2939748262 267
134 3300005337 Ga0070682_100108365 Ga0070682_1001083653 268
135 3300005339 Ga0070660_100112427 Ga0070660_1001124272 268
136 3300005344 Ga0070661_100135201 Ga0070661_1001352012 268
137 3300005366 Ga0070659_100155606 Ga0070659_1001556063 268
138 3300005457 Ga0070662_100283327 Ga0070662_1002833272 268
139 3300005458 Ga0070681_10042382 Ga0070681_100423822 268
140 3300005530 Ga0070679_100143356 Ga0070679_1001433563 268
141 3300005539 Ga0068853_100211779 Ga0068853_1002117793 268
142 3300005545 Ga0070695_100255776 Ga0070695_1002557762 268
143 3300005563 Ga0068855_100403402 Ga0068855_1004034022 268
144 3300005577 Ga0068857_100154831 Ga0068857_1001548312 268
145 3300005614 Ga0068856_100126920 Ga0068856_1001269203 268
146 3300005616 Ga0068852_100174593 Ga0068852_1001745933 268
147 3300005840 Ga0068870_10019941 Ga0068870_100199413 268
148 3300005937 Ga0081455_10093693 Ga0081455_100936932 268
149 3300005985 Ga0081539_10000335 Ga0081539_1000033591 268
150 3300006847 Ga0075431_100141782 Ga0075431_1001417824 268
151 3300009098 Ga0105245_10042964 Ga0105245_100429646 268
152 3300009098 Ga0105245_10837101 Ga0105245_108371011 268
153 3300013296 Ga0157374_10727230 Ga0157374_107272302 268
154 3300013307 Ga0157372_10078801 Ga0157372_100788013 268
155 3300025912 Ga0207707_10068774 Ga0207707_100687742 268
156 3300025919 Ga0207657_10374885 Ga0207657_103748851 268
157 3300025933 Ga0207706_10142957 Ga0207706_101429573 268
158 3300025944 Ga0207661_10001654 Ga0207661_100016547 268
159 3300026075 Ga0207708_10011666 Ga0207708_100116662 268
160 3300026116 Ga0207674_10022746 Ga0207674_100227467 268
161 3300026142 Ga0207698_10350762 Ga0207698_103507623 268
162 3300030521 Ga0307511_10021484 Ga0307511_100214843 268
163 3300048907 Ga0496104_0198145 Ga0496104_0198145_900_1706 268
164 3300048908 Ga0496105_0319058 Ga0496105_0319058_318_1124 268
165 3300048908 Ga0496105_0534021 Ga0496105_0534021_28_834 268
166 3300048911 Ga0496108_0013917 Ga0496108_0013917_893_1735 268
167 3300048911 Ga0496108_0016891 Ga0496108_0016891_315_1121 268
168 3300048912 Ga0496109_0033616 Ga0496109_0033616_2128_2970 268
169 3300048913 Ga0496110_0000677 Ga0496110_0000677_5597_6439 268
170 3300048913 Ga0496110_0046446 Ga0496110_0046446_2454_3260 268
171 3300048914 Ga0496111_0000642 Ga0496111_0000642_4312_5154 268
172 3300048914 Ga0496111_0003780 Ga0496111_0003780_6853_7659 268
173 3300048915 Ga0496112_0117427 Ga0496112_0117427_876_1718 268
174 3300048915 Ga0496112_0198192 Ga0496112_0198192_716_1522 268
175 3300048916 Ga0496113_0024135 Ga0496113_0024135_2570_3412 268
176 3300049580 Ga0501046_0051729 Ga0501046_0051729_1605_2411 268
177 3300049587 Ga0501071_0033160 Ga0501071_0033160_2438_3250 268
178 3300049588 Ga0501072_0064706 Ga0501072_0064706_1988_2794 268
179 3300049593 Ga0501077_0004973 Ga0501077_0004973_540_1346 268
180 3300049741 Ga0501079_0136962 Ga0501079_0136962_880_1686 268
181 3300049822 Ga0501035_0088261 Ga0501035_0088261_1779_2585 268
182 3300049822 Ga0501035_0224234 Ga0501035_0224234_182_994 268
183 3300049824 Ga0501045_0005758 Ga0501045_0005758_2611_3423 268
184 3300049824 Ga0501045_0498166 Ga0501045_0498166_10_816 268
185 3300054114 Ga0501084_0282996 Ga0501084_0282996_64_870 268
186 3300061734 Ga0530510_0016054 Ga0530510_0016054_3866_4672 268
187 iso_pu_bacteria 2547132424 2548694342 268
188 iso_pu_bacteria 2675903059 2676480921 268
189 iso_pu_bacteria 2902810491 2902812541 268
190 iso_pu_bacteria 2919713450 2919716543 268
191 iso_pu_bacteria 2928142448 2928146186 268
192 3300005937 Ga0081455_10030834 Ga0081455_100308345 269
193 3300005983 Ga0081540_1081706 Ga0081540_10817062 269
194 3300025928 Ga0207700_10000002 Ga0207700_10000002828 269
195 3300025929 Ga0207664_10195681 Ga0207664_101956812 269
196 3300025939 Ga0207665_10007283 Ga0207665_100072839 269
197 3300037418 Ga0395900_0006264 Ga0395900_0006264_1087_1902 269
198 3300037466 Ga0395898_0003893 Ga0395898_0003893_1751_2566 269
199 3300037471 Ga0395905_0002846 Ga0395905_0002846_16250_17065 269
200 3300044694 Ga0466963_0067314 Ga0466963_0067314_955_1773 269
201 3300044842 Ga0466957_0139080 Ga0466957_0139080_74_892 269
202 3300044901 Ga0466960_0004175 Ga0466960_0004175_3363_4181 269
203 3300045976 Ga0466967_0016168 Ga0466967_0016168_707_1525 269
204 3300048914 Ga0496111_0039941 Ga0496111_0039941_298_1107 269
205 3300049568 Ga0501031_0005184 Ga0501031_0005184_5088_5897 269
206 3300049569 Ga0501032_0006046 Ga0501032_0006046_5445_6272 269
207 3300049570 Ga0501033_0052458 Ga0501033_0052458_1382_2209 269
208 3300049571 Ga0501034_0006581 Ga0501034_0006581_2044_2871 269
209 3300049572 Ga0501036_0011150 Ga0501036_0011150_3400_4227 269
210 3300049572 Ga0501036_0027864 Ga0501036_0027864_536_1345 269
211 3300049573 Ga0501037_0006073 Ga0501037_0006073_946_1773 269
212 3300049574 Ga0501038_0123768 Ga0501038_0123768_435_1244 269
213 3300049574 Ga0501038_0345187 Ga0501038_0345187_92_919 269
214 3300049575 Ga0501039_0003966 Ga0501039_0003966_1567_2376 269
215 3300049576 Ga0501040_0124879 Ga0501040_0124879_959_1768 269
216 3300049577 Ga0501041_0015987 Ga0501041_0015987_2061_2870 269
217 3300049577 Ga0501041_0146666 Ga0501041_0146666_439_1248 269
218 3300049578 Ga0501042_0202679 Ga0501042_0202679_572_1381 269
219 3300049580 Ga0501046_0006444 Ga0501046_0006444_8541_9368 269
220 3300049580 Ga0501046_0041771 Ga0501046_0041771_2108_2917 269
221 3300049581 Ga0501047_0022965 Ga0501047_0022965_3289_4116 269
222 3300049582 Ga0501048_0009602 Ga0501048_0009602_1904_2731 269
223 3300049586 Ga0501070_0000545 Ga0501070_0000545_26565_27392 269
224 3300049587 Ga0501071_0032064 Ga0501071_0032064_1535_2344 269
225 3300049588 Ga0501072_0054322 Ga0501072_0054322_1604_2413 269
226 3300049588 Ga0501072_0072687 Ga0501072_0072687_949_1758 269
227 3300049589 Ga0501073_0042005 Ga0501073_0042005_117_944 269
228 3300049591 Ga0501075_0044839 Ga0501075_0044839_758_1567 269
229 3300049592 Ga0501076_0024684 Ga0501076_0024684_1798_2607 269
230 3300049592 Ga0501076_0149867 Ga0501076_0149867_842_1651 269
231 3300049741 Ga0501079_0027763 Ga0501079_0027763_1356_2165 269
232 3300049741 Ga0501079_0044271 Ga0501079_0044271_1626_2435 269
233 3300049742 Ga0501080_0020090 Ga0501080_0020090_3205_4032 269
234 3300049743 Ga0501081_0039555 Ga0501081_0039555_400_1209 269
235 3300049744 Ga0501083_0060957 Ga0501083_0060957_162_989 269
236 3300049822 Ga0501035_0020032 Ga0501035_0020032_1916_2743 269
237 3300049823 Ga0501044_0008986 Ga0501044_0008986_5618_6445 269
238 3300049824 Ga0501045_0003111 Ga0501045_0003111_9545_10354 269
239 3300060353 Ga0501082_0076970 Ga0501082_0076970_465_1274 269
240 3300060353 Ga0501082_0217977 Ga0501082_0217977_832_1641 269
241 3300061734 Ga0530510_0062165 Ga0530510_0062165_488_1297 269
242 iso_pu_bacteria 2558860280 2559430002 269
243 3300005435 Ga0070714_100655970 Ga0070714_1006559701 270
244 3300038443 Ga0395901_0029610 Ga0395901_0029610_2312_3124 270
245 3300039450 Ga0436363_0138385 Ga0436363_0138385_669_1505 270
246 3300049568 Ga0501031_0027598 Ga0501031_0027598_2815_3627 270
247 3300049572 Ga0501036_0050984 Ga0501036_0050984_142_954 270
248 3300049574 Ga0501038_0321430 Ga0501038_0321430_242_1054 270
249 3300049577 Ga0501041_0178210 Ga0501041_0178210_428_1240 270
250 3300049578 Ga0501042_0020600 Ga0501042_0020600_2166_2978 270
251 3300049580 Ga0501046_0252320 Ga0501046_0252320_421_1233 270
252 3300049582 Ga0501048_0204685 Ga0501048_0204685_456_1268 270
253 3300049587 Ga0501071_0183415 Ga0501071_0183415_447_1259 270
254 3300049588 Ga0501072_0302463 Ga0501072_0302463_128_940 270
255 3300049591 Ga0501075_0129359 Ga0501075_0129359_813_1625 270
256 3300049592 Ga0501076_0090245 Ga0501076_0090245_525_1337 270
257 3300049593 Ga0501077_0223578 Ga0501077_0223578_247_1059 270
258 3300049823 Ga0501044_0020993 Ga0501044_0020993_2291_3133 270
259 3300049824 Ga0501045_0036333 Ga0501045_0036333_1216_2028 270
260 3300050508 nmdc:mga09592_584459_c1 nmdc:mga09592_584459_c1_122_940 270
261 3300061734 Ga0530510_0006197 Ga0530510_0006197_1870_2682 270
262 3300003373 JGI25407J50210_10022522 JGI25407J50210_100225221 271
263 3300005347 Ga0070668_100000484 Ga0070668_10000048416 271
264 3300005355 Ga0070671_100060988 Ga0070671_1000609882 271
265 3300005434 Ga0070709_10047717 Ga0070709_100477173 271
266 3300005434 Ga0070709_10196646 Ga0070709_101966461 271
267 3300005436 Ga0070713_100248517 Ga0070713_1002485172 271
268 3300005439 Ga0070711_100054581 Ga0070711_1000545812 271
269 3300005440 Ga0070705_100040414 Ga0070705_1000404142 271
270 3300005445 Ga0070708_100012197 Ga0070708_1000121974 271
271 3300005467 Ga0070706_100068686 Ga0070706_1000686862 271
272 3300005471 Ga0070698_100029428 Ga0070698_1000294285 271
273 3300005471 Ga0070698_100201049 Ga0070698_1002010492 271
274 3300005518 Ga0070699_100155300 Ga0070699_1001553002 271
275 3300005536 Ga0070697_100111363 Ga0070697_1001113631 271
276 3300005536 Ga0070697_100208895 Ga0070697_1002088952 271
277 3300005563 Ga0068855_100238118 Ga0068855_1002381183 271
278 3300005844 Ga0068862_100036462 Ga0068862_1000364623 271
279 3300005937 Ga0081455_10003300 Ga0081455_100033005 271
280 3300005937 Ga0081455_10019732 Ga0081455_100197322 271
281 3300005937 Ga0081455_10221913 Ga0081455_102219132 271
282 3300005981 Ga0081538_10000634 Ga0081538_1000063413 271
283 3300005981 Ga0081538_10003336 Ga0081538_100033366 271
284 3300005981 Ga0081538_10011646 Ga0081538_100116464 271
285 3300006028 Ga0070717_10117315 Ga0070717_101173152 271
286 3300006048 Ga0075363_100068694 Ga0075363_1000686943 271
287 3300006048 Ga0075363_100214494 Ga0075363_1002144941 271
288 3300006173 Ga0070716_100196326 Ga0070716_1001963262 271
289 3300006175 Ga0070712_100014641 Ga0070712_1000146413 271
290 3300006844 Ga0075428_100153268 Ga0075428_1001532683 271
291 3300009094 Ga0111539_10030517 Ga0111539_100305175 271
292 3300009098 Ga0105245_10175311 Ga0105245_101753111 271
293 3300009147 Ga0114129_10202133 Ga0114129_102021333 271
294 3300009148 Ga0105243_10001854 Ga0105243_1000185413 271
295 3300009148 Ga0105243_10063699 Ga0105243_100636992 271
296 3300009176 Ga0105242_10168748 Ga0105242_101687481 271
297 3300013296 Ga0157374_10299582 Ga0157374_102995823 271
298 3300025885 Ga0207653_10023548 Ga0207653_100235482 271
299 3300025901 Ga0207688_10015033 Ga0207688_100150332 271
300 3300025915 Ga0207693_10007728 Ga0207693_100077287 271
301 3300025916 Ga0207663_10004347 Ga0207663_100043472 271
302 3300025916 Ga0207663_10351371 Ga0207663_103513712 271
303 3300025935 Ga0207709_10001086 Ga0207709_100010863 271
304 3300025935 Ga0207709_10173940 Ga0207709_101739402 271
305 3300025939 Ga0207665_10291514 Ga0207665_102915142 271
306 3300025961 Ga0207712_10083500 Ga0207712_100835001 271
307 3300025972 Ga0207668_10000225 Ga0207668_1000022518 271
308 3300025972 Ga0207668_10010187 Ga0207668_100101874 271
309 3300026118 Ga0207675_100081685 Ga0207675_1000816853 271
310 3300027907 Ga0207428_10305038 Ga0207428_103050381 271
311 3300028381 Ga0268264_10137787 Ga0268264_101377873 271
312 3300037853 Ga0436364_1375687 Ga0436364_1375687_298_1113 271
313 3300037853 Ga0436364_1412283 Ga0436364_1412283_3723_4547 271
314 3300041405 Ga0439438_045937 Ga0439438_045937_15_845 271
315 3300041496 Ga0451839_1443876 Ga0451839_1443876_236_1054 271
316 3300042008 Ga0439450_002919 Ga0439450_002919_75_890 271
317 3300042016 Ga0439463_003992 Ga0439463_003992_46_930 271
318 3300042993 Ga0439440_0002650 Ga0439440_0002650_2015_2899 271
319 3300046491 Ga0495584_0053859 Ga0495584_0053859_516_1460 271
320 3300046492 Ga0495585_0130792 Ga0495585_0130792_359_1303 271
321 3300048905 Ga0496102_0090551 Ga0496102_0090551_299_1123 271
322 3300048911 Ga0496108_0085782 Ga0496108_0085782_412_1236 271
323 3300048912 Ga0496109_0103592 Ga0496109_0103592_1624_2448 271
324 3300048912 Ga0496109_0207794 Ga0496109_0207794_256_1080 271
325 3300048913 Ga0496110_0121035 Ga0496110_0121035_612_1436 271
326 3300048914 Ga0496111_0312424 Ga0496111_0312424_122_946 271
327 3300048915 Ga0496112_0144895 Ga0496112_0144895_237_1061 271
328 3300048916 Ga0496113_0175669 Ga0496113_0175669_109_933 271
329 3300048920 Ga0496117_0114177 Ga0496117_0114177_813_1637 271
330 3300048921 Ga0496118_0001075 Ga0496118_0001075_16424_17248 271
331 3300049571 Ga0501034_0002539 Ga0501034_0002539_11975_12817 271
332 3300049572 Ga0501036_0013494 Ga0501036_0013494_5807_6649 271
333 3300049572 Ga0501036_0021361 Ga0501036_0021361_2578_3393 271
334 3300049573 Ga0501037_0006561 Ga0501037_0006561_2203_3045 271
335 3300049574 Ga0501038_0036447 Ga0501038_0036447_964_1806 271
336 3300049575 Ga0501039_0002033 Ga0501039_0002033_14122_14964 271
337 3300049575 Ga0501039_0382554 Ga0501039_0382554_105_920 271
338 3300049576 Ga0501040_0004442 Ga0501040_0004442_4025_4840 271
339 3300049578 Ga0501042_0009178 Ga0501042_0009178_5236_6051 271
340 3300049579 Ga0501043_0002178 Ga0501043_0002178_9213_10055 271
341 3300049579 Ga0501043_0029367 Ga0501043_0029367_2142_2957 271
342 3300049580 Ga0501046_0007086 Ga0501046_0007086_242_1057 271
343 3300049582 Ga0501048_0029255 Ga0501048_0029255_2430_3245 271
344 3300049585 Ga0501069_0111941 Ga0501069_0111941_653_1486 271
345 3300049586 Ga0501070_0000482 Ga0501070_0000482_21241_22083 271
346 3300049587 Ga0501071_0014291 Ga0501071_0014291_2606_3421 271
347 3300049589 Ga0501073_0023699 Ga0501073_0023699_664_1506 271
348 3300049591 Ga0501075_0046684 Ga0501075_0046684_107_922 271
349 3300049591 Ga0501075_0208451 Ga0501075_0208451_548_1363 271
350 3300049592 Ga0501076_0009766 Ga0501076_0009766_6121_6936 271
351 3300049592 Ga0501076_0191711 Ga0501076_0191711_463_1278 271
352 3300049593 Ga0501077_0001956 Ga0501077_0001956_4495_5310 271
353 3300049741 Ga0501079_0011334 Ga0501079_0011334_1850_2665 271
354 3300049741 Ga0501079_0243505 Ga0501079_0243505_43_858 271
355 3300049743 Ga0501081_0013869 Ga0501081_0013869_4337_5152 271
356 3300049743 Ga0501081_0154953 Ga0501081_0154953_670_1485 271
357 3300049744 Ga0501083_0025767 Ga0501083_0025767_1326_2141 271
358 3300049823 Ga0501044_0015695 Ga0501044_0015695_2053_2895 271
359 3300049824 Ga0501045_0247274 Ga0501045_0247274_494_1309 271
360 3300050491 nmdc:mga00v17_101971_c1 nmdc:mga00v17_101971_c1_21_845 271
361 3300050511 nmdc:mga08y16_111565_c1 nmdc:mga08y16_111565_c1_1688_2503 271
362 3300053080 Ga0500635_0013496 Ga0500635_0013496_1480_2304 271
363 3300053131 Ga0500652_000245 Ga0500652_000245_12538_13362 271
364 3300054114 Ga0501084_0011883 Ga0501084_0011883_5117_5932 271
365 3300054114 Ga0501084_0293790 Ga0501084_0293790_536_1351 271
366 3300059424 Ga0590075_007499 Ga0590075_007499_1388_2209 271
367 3300060353 Ga0501082_0007418 Ga0501082_0007418_6402_7217 271
368 3300060353 Ga0501082_0582547 Ga0501082_0582547_93_923 271
369 3300061734 Ga0530510_0022179 Ga0530510_0022179_153_968 271
370 3300061734 Ga0530510_0548959 Ga0530510_0548959_23_838 271
371 3300003373 JGI25407J50210_10009703 JGI25407J50210_100097033 272
372 3300005337 Ga0070682_100420934 Ga0070682_1004209341 272
373 3300005467 Ga0070706_100450018 Ga0070706_1004500181 272
374 3300005471 Ga0070698_100117130 Ga0070698_1001171302 272
375 3300005518 Ga0070699_100018189 Ga0070699_1000181897 272
376 3300005536 Ga0070697_100297694 Ga0070697_1002976942 272
377 3300005546 Ga0070696_100053476 Ga0070696_1000534762 272
378 3300005549 Ga0070704_100204112 Ga0070704_1002041122 272
379 3300005937 Ga0081455_10050187 Ga0081455_100501873 272
380 3300005981 Ga0081538_10000183 Ga0081538_1000018310 272
381 3300005981 Ga0081538_10000198 Ga0081538_100001984 272
382 3300005981 Ga0081538_10006917 Ga0081538_100069177 272
383 3300006844 Ga0075428_100001265 Ga0075428_10000126528 272
384 3300006846 Ga0075430_100011088 Ga0075430_1000110886 272
385 3300006847 Ga0075431_100003514 Ga0075431_1000035146 272
386 3300006880 Ga0075429_100000141 Ga0075429_10000014146 272
387 3300009147 Ga0114129_10001605 Ga0114129_1000160534 272
388 3300021388 Ga0213875_10000834 Ga0213875_100008342 272
389 3300031691 Ga0316579_10001182 Ga0316579_100011829 272
390 3300035112 Ga0373932_0036796 Ga0373932_0036796_439_1368 272
391 3300037853 Ga0436364_1314068 Ga0436364_1314068_1291_2118 272
392 3300041411 Ga0439466_0008352 Ga0439466_0008352_610_1464 272
393 3300041413 Ga0439465_0009387 Ga0439465_0009387_837_1721 272
394 3300041997 Ga0439431_0001900 Ga0439431_0001900_2720_3574 272
395 3300042435 Ga0439434_0010205 Ga0439434_0010205_1176_2060 272
396 3300044683 Ga0466965_0049942 Ga0466965_0049942_440_1258 272
397 3300044684 Ga0466966_0000559 Ga0466966_0000559_11744_12562 272
398 3300044694 Ga0466963_0000999 Ga0466963_0000999_12463_13281 272
399 3300044719 Ga0466971_0004255 Ga0466971_0004255_5084_5902 272
400 3300044842 Ga0466957_0015193 Ga0466957_0015193_2848_3666 272
401 3300045836 Ga0466958_0000694 Ga0466958_0000694_2111_2929 272
402 3300045836 Ga0466958_0088255 Ga0466958_0088255_845_1678 272
403 3300045976 Ga0466967_0015646 Ga0466967_0015646_1825_2643 272
404 3300046491 Ga0495584_0169480 Ga0495584_0169480_29_901 272
405 3300050507 nmdc:mga05p37_3842_c1 nmdc:mga05p37_3842_c1_1001_1825 272
406 3300050508 nmdc:mga09592_102068_c1 nmdc:mga09592_102068_c1_634_1458 272
407 3300050509 nmdc:mga0qj67_2295_c1 nmdc:mga0qj67_2295_c1_11037_11861 272
408 3300050510 nmdc:mga06r32_237706_c1 nmdc:mga06r32_237706_c1_737_1561 272
409 3300050510 nmdc:mga06r32_2925_c1 nmdc:mga06r32_2925_c1_10190_11014 272
410 3300061719 Ga0466962_0004593 Ga0466962_0004593_112_930 272
411 3300003323 rootH1_10312223 rootH1_103122231 273
412 3300005539 Ga0068853_100060180 Ga0068853_1000601802 273
413 3300005616 Ga0068852_100064049 Ga0068852_1000640493 273
414 3300009551 Ga0105238_10073515 Ga0105238_100735152 273
415 3300025924 Ga0207694_10119745 Ga0207694_101197452 273
416 3300026041 Ga0207639_10078758 Ga0207639_100787582 273
417 3300026142 Ga0207698_10062653 Ga0207698_100626533 273
418 3300044684 Ga0466966_0002619 Ga0466966_0002619_174_995 273
419 3300044684 Ga0466966_0091629 Ga0466966_0091629_757_1584 273
420 3300044693 Ga0466961_0003301 Ga0466961_0003301_3830_4651 273
421 3300044765 Ga0466970_0003925 Ga0466970_0003925_4094_4915 273
422 3300044765 Ga0466970_0239921 Ga0466970_0239921_70_897 273
423 3300045049 Ga0466959_0180872 Ga0466959_0180872_512_1333 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

48

307

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7j-assembly2.cif.gz_B crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246 0.9863 3 268
3i7j-assembly2.cif.gz_B crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246 0.9612 3 268
7u1b-assembly1.cif.gz_A crystal structure of estg in complex with tantalum cluster 0.849 2 267
7u1c-assembly1.cif.gz_A structure of estg crystalized with so4 and tris 0.8446 2 267
4lcl-assembly1.cif.gz_A simvastatin synthase (lovd), from aspergillus terreus, lovd6 mutant (simh6208) 0.8438 2 271
ID Description Score Start End Superfamily
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9763 3 268 3.40.710.10
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9583 3 268 3.40.710.10
af_Q99186_1_139_3.30.450.60 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8612 16 31 3.30.450.60
af_A0A1D8PKX8_25_403_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8453 11 262 3.40.710.10
af_P72041_31_410_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.841 2 268 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A4R7V012-F1-model_v4 CubicO group peptidase (Beta-lactamase class C family) 0.9963 1 268
AF-A0A6B3HZ91-F1-model_v4 Beta-lactamase family protein 0.9963 49 270
AF-A0A427SWK7-F1-model_v4 Class A beta-lactamase-related serine hydrolase 0.9962 1 270 GO:0016787
AF-A0A5P2UVG1-F1-model_v4 Class A beta-lactamase-related serine hydrolase 0.9962 1 268 GO:0016787
AF-A0A399H8R5-F1-model_v4 Penicillin-binding protein 4 0.9956 1 268

Feature Viewer

pLDDT pTM Quality
96.83 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map