F440567

General Info

Members Datasets Scaffolds Average Seq Length
423 204 846 264

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0081942|Ga0395901_0081942_1348_2151
Length 261
Sequence MGVVNVTPDSFSDGGVNFEADVAIASARRMVADGAALVDVGGESTRPGSAGVSLDEELRRVQPVLEAIAGELPVSIDTTKAEVARRALELGAELVNDVTALRGEPALAEVVAEADAYLCLMHTMQVDPTYDDVVSEVAAFLEQRLRFAVAAGIPEERICLDPGIGFGKSAQHNLELVRRLDVLLGLGRPVVIGFSRKRTLGRLLGDADATTGPLAASIGAAVAAYERGASILRVHDVREHVEALAAAHAVADPTAAALSPP

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 7.33
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0081942 3300038443 Bacteria 3370
2 Ga0070658_10015901 3300005327 Bacteria 6017
3 Ga0070658_10130858 3300005327 Bacteria 2091
4 Ga0070658_10226672 3300005327 Bacteria 1581
5 Ga0070683_100185937 3300005329 Bacteria 1972
6 Ga0070680_100036657 3300005336 Bacteria 3962
7 Ga0070680_100217623 3300005336 Bacteria 1612
8 Ga0070680_100404726 3300005336 Bacteria 1163
9 Ga0070682_100016719 3300005337 Bacteria 4269
10 Ga0070682_100038907 3300005337 Bacteria 2920
11 Ga0068868_100322666 3300005338 Bacteria 1316
12 Ga0070660_100173085 3300005339 Bacteria 1744
13 Ga0070691_10110509 3300005341 Bacteria 1374
14 Ga0070668_100221542 3300005347 Bacteria 1560
15 Ga0070659_100088836 3300005366 Bacteria 2475
16 Ga0070659_100118982 3300005366 Bacteria 2138
17 Ga0070709_10026446 3300005434 Bacteria 3439
18 Ga0070709_10284637 3300005434 Bacteria 1202
19 Ga0070714_100015594 3300005435 Bacteria 6113
20 Ga0070714_100195779 3300005435 Bacteria 1846
21 Ga0070714_100424822 3300005435 Bacteria 1259
22 Ga0070713_100264556 3300005436 Bacteria 1573
23 Ga0070710_10033394 3300005437 Bacteria 2794
24 Ga0070711_100055015 3300005439 Bacteria 2747
25 Ga0070678_100431139 3300005456 Bacteria 1151
26 Ga0070662_100032872 3300005457 Bacteria 3649
27 Ga0070681_10030451 3300005458 Bacteria 5414
28 Ga0070681_10046021 3300005458 Bacteria 4363
29 Ga0070681_10058968 3300005458 Bacteria 3818
30 Ga0070681_10163151 3300005458 Bacteria 2152
31 Ga0070681_10486520 3300005458 Bacteria 1147
32 Ga0070707_100001944 3300005468 Bacteria 19823
33 Ga0070707_100227333 3300005468 Bacteria 1817
34 Ga0070698_100298839 3300005471 Bacteria 1541
35 Ga0070679_100018487 3300005530 Bacteria 6764
36 Ga0070679_100030742 3300005530 Bacteria 5304
37 Ga0070679_100050974 3300005530 Bacteria 4123
38 Ga0070679_100080265 3300005530 Bacteria 3251
39 Ga0070679_100255287 3300005530 Bacteria 1709
40 Ga0070684_100036290 3300005535 Bacteria 4224
41 Ga0070684_100439734 3300005535 Bacteria 1205
42 Ga0070686_100175445 3300005544 Bacteria 1519
43 Ga0070704_100171147 3300005549 Bacteria 1728
44 Ga0068855_100049563 3300005563 Bacteria 4953
45 Ga0068855_100588558 3300005563 Bacteria 1201
46 Ga0068856_100056227 3300005614 Bacteria 3882
47 Ga0070702_100240072 3300005615 Bacteria 1222
48 Ga0081455_10040705 3300005937 Bacteria 4096
49 Ga0081455_10138530 3300005937 Bacteria 1893
50 Ga0081538_10023392 3300005981 Bacteria 4443
51 Ga0081539_10002473 3300005985 Bacteria 26001
52 Ga0070717_10012990 3300006028 Bacteria 6361
53 Ga0070717_10231332 3300006028 Bacteria 1628
54 Ga0075432_10000155 3300006058 Bacteria 16542
55 Ga0070712_100272552 3300006175 Bacteria 1360
56 Ga0075433_10305358 3300006852 Bacteria 1409
57 Ga0075434_100035225 3300006871 Bacteria 4947
58 Ga0075434_100076724 3300006871 Bacteria 3337
59 Ga0075434_100126776 3300006871 Bacteria 2569
60 Ga0075435_100008272 3300007076 Bacteria 7453
61 Ga0105240_10042640 3300009093 Bacteria 5781
62 Ga0105240_10064362 3300009093 Bacteria 4556
63 Ga0111539_10011406 3300009094 Bacteria 11154
64 Ga0111539_10071104 3300009094 Bacteria 4106
65 Ga0111539_10298380 3300009094 Bacteria 1875
66 Ga0105245_10391009 3300009098 Bacteria 1387
67 Ga0114129_10138970 3300009147 Bacteria 3331
68 Ga0114129_10198708 3300009147 Bacteria 2717
69 Ga0105237_10085979 3300009545 Bacteria 3135
70 Ga0105239_10209341 3300010375 Bacteria 2186
71 Ga0157370_10050164 3300013104 Bacteria 3990
72 Ga0157369_10043133 3300013105 Bacteria 4918
73 Ga0157369_10051784 3300013105 Bacteria 4442
74 Ga0157369_10054649 3300013105 Bacteria 4311
75 Ga0163162_10397913 3300013306 Bacteria 1510
76 Ga0157372_10030767 3300013307 Bacteria 5874
77 Ga0157372_10074121 3300013307 Bacteria 3837
78 Ga0157372_10555008 3300013307 Bacteria 1339
79 Ga0157375_10153417 3300013308 Bacteria 2440
80 Ga0182008_10178396 3300014497 Bacteria 1074
81 Ga0157377_10365817 3300014745 Bacteria 972
82 Ga0157376_10025246 3300014969 Bacteria 4679
83 Ga0206356_10036998 3300020070 Bacteria 5117
84 Ga0206356_10915091 3300020070 Bacteria 1327
85 Ga0206354_11466558 3300020081 Bacteria 2973
86 Ga0206353_11502198 3300020082 Bacteria 3848
87 Ga0207653_10139747 3300025885 Bacteria 885
88 Ga0207692_10132203 3300025898 Bacteria 1411
89 Ga0207699_10043154 3300025906 Bacteria 2618
90 Ga0207705_10067348 3300025909 Bacteria 2591
91 Ga0207705_10298978 3300025909 Bacteria 1234
92 Ga0207684_10235802 3300025910 Bacteria 1578
93 Ga0207707_10040068 3300025912 Bacteria 4093
94 Ga0207707_10105817 3300025912 Bacteria 2459
95 Ga0207707_10182237 3300025912 Bacteria 1833
96 Ga0207707_10184049 3300025912 Bacteria 1823
97 Ga0207695_10031637 3300025913 Bacteria 5799
98 Ga0207671_10076949 3300025914 Bacteria 2497
99 Ga0207693_10005483 3300025915 Bacteria 10577
100 Ga0207693_10012161 3300025915 Bacteria 6953
101 Ga0207693_10141972 3300025915 Bacteria 1888
102 Ga0207663_10014250 3300025916 Bacteria 4346
103 Ga0207663_10122812 3300025916 Bacteria 1781
104 Ga0207660_10085626 3300025917 Bacteria 2325
105 Ga0207660_10340112 3300025917 Bacteria 1201
106 Ga0207657_10004793 3300025919 Bacteria 14276
107 Ga0207657_10018436 3300025919 Bacteria 6662
108 Ga0207649_10053418 3300025920 Bacteria 2511
109 Ga0207652_10023102 3300025921 Bacteria 5150
110 Ga0207652_10165026 3300025921 Bacteria 1986
111 Ga0207652_10172506 3300025921 Bacteria 1941
112 Ga0207652_10225823 3300025921 Bacteria 1687
113 Ga0207652_10254761 3300025921 Bacteria 1583
114 Ga0207652_10650998 3300025921 Bacteria 942
115 Ga0207646_10007075 3300025922 Bacteria 11476
116 Ga0207646_10065462 3300025922 Bacteria 3245
117 Ga0207687_10066428 3300025927 Bacteria 2563
118 Ga0207700_10281067 3300025928 Bacteria 1432
119 Ga0207700_10295309 3300025928 Bacteria 1398
120 Ga0207664_10014835 3300025929 Bacteria 5641
121 Ga0207664_10053550 3300025929 Bacteria 3195
122 Ga0207664_10090418 3300025929 Bacteria 2508
123 Ga0207706_10015841 3300025933 Bacteria 6817
124 Ga0207709_10028776 3300025935 Bacteria 3215
125 Ga0207661_10037822 3300025944 Bacteria 3777
126 Ga0207667_10158444 3300025949 Bacteria 2329
127 Ga0207712_10098340 3300025961 Bacteria 2170
128 Ga0207668_10063415 3300025972 Bacteria 2607
129 Ga0207639_10458217 3300026041 Bacteria 1159
130 Ga0207648_10156052 3300026089 Bacteria 2015
131 Ga0207675_100000456 3300026118 Bacteria 39658
132 Ga0207675_100303300 3300026118 Bacteria 1556
133 Ga0207683_10244141 3300026121 Bacteria 1638
134 Ga0207698_10132928 3300026142 Bacteria 2130
135 Ga0207698_10320484 3300026142 Bacteria 1451
136 Ga0207428_10169385 3300027907 Bacteria 1655
137 Ga0265334_10026168 3300028573 Bacteria 2356
138 Ga0265336_10000866 3300028666 Bacteria 15669
139 Ga0265338_10003469 3300028800 Bacteria 22183
140 Ga0265338_10005798 3300028800 Bacteria 15945
141 Ga0265338_10089991 3300028800 Bacteria 2541
142 Ga0265325_10026134 3300031241 Bacteria 3165
143 Ga0307409_100286774 3300031995 Bacteria 1525
144 Ga0373926_0003671 3300035083 Bacteria 4988
145 Ga0373923_0085847 3300035111 Bacteria 1371
146 Ga0373945_0060642 3300035116 Bacteria 1411
147 Ga0373943_0001785 3300035170 Bacteria 9742
148 Ga0373924_0037414 3300035410 Bacteria 1976
149 Ga0373935_0081553 3300035692 Bacteria 2103
150 Ga0373927_0049069 3300035695 Bacteria 2730
151 Ga0373933_0101264 3300035724 Bacteria 1788
152 Ga0373925_0190810 3300037068 Bacteria 1626
153 Ga0395899_0105108 3300037312 Bacteria 2034
154 Ga0395900_0037086 3300037418 Bacteria 5027
155 Ga0395900_0183243 3300037418 Bacteria 2126
156 Ga0395900_0621165 3300037418 Bacteria 1019
157 Ga0395898_0013091 3300037466 Bacteria 8553
158 Ga0395898_0013174 3300037466 Bacteria 8519
159 Ga0395898_0027945 3300037466 Bacteria 5657
160 Ga0395898_0030451 3300037466 Bacteria 5399
161 Ga0395898_0046681 3300037466 Bacteria 4254
162 Ga0395898_0386100 3300037466 Bacteria 1335
163 Ga0395905_0008518 3300037471 Bacteria 10111
164 Ga0395905_0017680 3300037471 Bacteria 6768
165 Ga0395905_0053433 3300037471 Bacteria 3781
166 Ga0395905_0078052 3300037471 Bacteria 3103
167 Ga0395905_0142147 3300037471 Bacteria 2257
168 Ga0395905_0176809 3300037471 Bacteria 2004
169 Ga0395901_0004052 3300038443 Bacteria 14756
170 Ga0395901_0005367 3300038443 Bacteria 12957
171 Ga0395901_0013531 3300038443 Bacteria 8298
172 Ga0395901_0015304 3300038443 Bacteria 7806
173 Ga0395901_0070092 3300038443 Bacteria 3652
174 Ga0395901_0155601 3300038443 Bacteria 2401
175 Ga0395901_0298062 3300038443 Bacteria 1672
176 Ga0466965_0222694 3300044683 Bacteria 1006
177 Ga0466966_0004699 3300044684 Bacteria 8986
178 Ga0466961_0019503 3300044693 Bacteria 4361
179 Ga0466963_0000851 3300044694 Bacteria 15387
180 Ga0466963_0004118 3300044694 Bacteria 8411
181 Ga0466963_0008142 3300044694 Bacteria 6277
182 Ga0466963_0012627 3300044694 Bacteria 5173
183 Ga0466963_0017740 3300044694 Bacteria 4439
184 Ga0466963_0018129 3300044694 Bacteria 4396
185 Ga0466963_0026649 3300044694 Bacteria 3697
186 Ga0466963_0041044 3300044694 Bacteria 3033
187 Ga0466963_0051237 3300044694 Bacteria 2735
188 Ga0466963_0057717 3300044694 Bacteria 2585
189 Ga0466963_0115947 3300044694 Bacteria 1841
190 Ga0466963_0139697 3300044694 Bacteria 1677
191 Ga0466963_0200207 3300044694 Bacteria 1397
192 Ga0466964_0001364 3300044706 Bacteria 8336
193 Ga0466964_0003348 3300044706 Bacteria 5841
194 Ga0466964_0052347 3300044706 Bacteria 1678
195 Ga0466971_0005803 3300044719 Bacteria 5372
196 Ga0466968_0020786 3300044735 Bacteria 2653
197 Ga0466968_0078112 3300044735 Bacteria 1450
198 Ga0466968_0114927 3300044735 Bacteria 1213
199 Ga0466957_0002697 3300044842 Bacteria 9597
200 Ga0466957_0007742 3300044842 Bacteria 6078
201 Ga0466957_0027087 3300044842 Bacteria 3404
202 Ga0466957_0034668 3300044842 Bacteria 3027
203 Ga0466957_0072096 3300044842 Bacteria 2138
204 Ga0466957_0078128 3300044842 Bacteria 2057
205 Ga0466957_0109430 3300044842 Bacteria 1751
206 Ga0466957_0149113 3300044842 Bacteria 1511
207 Ga0466960_0009082 3300044901 Bacteria 4088
208 Ga0466960_0039848 3300044901 Bacteria 2218
209 Ga0466959_0007658 3300045049 Bacteria 7591
210 Ga0466959_0015102 3300045049 Bacteria 5626
211 Ga0466959_0046544 3300045049 Bacteria 3191
212 Ga0466959_0124040 3300045049 Bacteria 1834
213 Ga0466959_0126288 3300045049 Bacteria 1815
214 Ga0466958_0001637 3300045836 Bacteria 10783
215 Ga0466958_0018707 3300045836 Bacteria 4025
216 Ga0466958_0024203 3300045836 Bacteria 3572
217 Ga0466958_0047713 3300045836 Bacteria 2585
218 Ga0466958_0069488 3300045836 Bacteria 2153
219 Ga0466958_0187469 3300045836 Bacteria 1314
220 Ga0466958_0212679 3300045836 Bacteria 1232
221 Ga0466967_0003101 3300045976 Bacteria 10687
222 Ga0466967_0007502 3300045976 Bacteria 7875
223 Ga0466967_0014671 3300045976 Bacteria 6116
224 Ga0466967_0015023 3300045976 Bacteria 6056
225 Ga0466967_0032145 3300045976 Bacteria 4427
226 Ga0466967_0032790 3300045976 Bacteria 4390
227 Ga0466967_0034599 3300045976 Bacteria 4290
228 Ga0466967_0054438 3300045976 Bacteria 3521
229 Ga0466967_0069415 3300045976 Bacteria 3149
230 Ga0466967_0069942 3300045976 Bacteria 3139
231 Ga0466967_0077957 3300045976 Bacteria 2984
232 Ga0466967_0112554 3300045976 Bacteria 2502
233 Ga0466967_0119653 3300045976 Bacteria 2431
234 Ga0466967_0129055 3300045976 Bacteria 2345
235 Ga0466967_0148071 3300045976 Bacteria 2191
236 Ga0466967_0199500 3300045976 Bacteria 1894
237 Ga0466967_0394131 3300045976 Bacteria 1346
238 Ga0495592_0000048 3300046454 Bacteria 114599
239 Ga0495592_0011699 3300046454 Bacteria 6647
240 Ga0495592_0058361 3300046454 Bacteria 2846
241 Ga0495629_0009637 3300046459 Bacteria 7054
242 Ga0495629_0024290 3300046459 Bacteria 4315
243 Ga0495641_0001416 3300046461 Bacteria 20387
244 Ga0495641_0050104 3300046461 Bacteria 1910
245 Ga0495651_0000049 3300046462 Bacteria 88249
246 Ga0495651_0063410 3300046462 Bacteria 2825
247 Ga0495651_0074588 3300046462 Bacteria 2573
248 Ga0495653_0011777 3300046463 Bacteria 7143
249 Ga0495653_0034322 3300046463 Bacteria 4013
250 Ga0495653_0074341 3300046463 Bacteria 2532
251 Ga0495653_0188760 3300046463 Bacteria 1408
252 Ga0495580_0138957 3300046472 Bacteria 1684
253 Ga0495582_0008083 3300046473 Bacteria 5806
254 Ga0495582_0019661 3300046473 Bacteria 3693
255 Ga0495582_0205253 3300046473 Bacteria 1126
256 Ga0495639_0000180 3300046475 Bacteria 33280
257 Ga0495664_0006830 3300046477 Bacteria 6317
258 Ga0495664_0019218 3300046477 Bacteria 3925
259 Ga0495664_0209517 3300046477 Bacteria 1180
260 Ga0495664_0217390 3300046477 Bacteria 1157
261 Ga0495584_0013077 3300046491 Bacteria 4233
262 Ga0495608_0003399 3300046511 Bacteria 11397
263 Ga0495608_0036577 3300046511 Bacteria 3305
264 Ga0495608_0164443 3300046511 Bacteria 1410
265 Ga0495608_0243652 3300046511 Bacteria 1122
266 Ga0495618_0001916 3300046514 Bacteria 13671
267 Ga0495618_0028805 3300046514 Bacteria 3462
268 Ga0495628_0000026 3300046516 Bacteria 127398
269 Ga0495628_0027227 3300046516 Bacteria 4654
270 Ga0495628_0038864 3300046516 Bacteria 3807
271 Ga0495628_0067168 3300046516 Bacteria 2801
272 Ga0495628_0129695 3300046516 Bacteria 1929
273 Ga0495630_0089815 3300046517 Bacteria 2321
274 Ga0495630_0252226 3300046517 Bacteria 1348
275 Ga0495630_0314275 3300046517 Bacteria 1198
276 Ga0495644_0003843 3300046523 Bacteria 5912
277 Ga0495663_0031084 3300046525 Bacteria 1585
278 Ga0495666_0024265 3300046526 Bacteria 2996
279 Ga0495652_0000172 3300046529 Bacteria 74042
280 Ga0495652_0012745 3300046529 Bacteria 7573
281 Ga0495652_0034510 3300046529 Bacteria 4408
282 Ga0495652_0082929 3300046529 Bacteria 2640
283 Ga0495652_0090898 3300046529 Bacteria 2497
284 Ga0495652_0133818 3300046529 Bacteria 1958
285 Ga0495665_0004638 3300046531 Bacteria 7416
286 Ga0495640_0160111 3300046533 Bacteria 1443
287 Ga0495586_0165313 3300046535 Bacteria 1249
288 Ga0495587_0000362 3300046536 Bacteria 32677
289 Ga0495598_0019384 3300046537 Bacteria 1783
290 Ga0495609_0045030 3300046538 Bacteria 1978
291 Ga0495645_0000016 3300046543 Bacteria 158415
292 Ga0495645_0037692 3300046543 Bacteria 3525
293 Ga0495645_0120375 3300046543 Bacteria 1848
294 Ga0495645_0150074 3300046543 Bacteria 1620
295 Ga0495667_0003656 3300046559 Bacteria 10350
296 Ga0495667_0084957 3300046559 Bacteria 2054
297 Ga0495667_0333805 3300046559 Bacteria 959
298 Ga0495656_0028018 3300046615 Bacteria 2256
299 Ga0495611_0032920 3300046648 Bacteria 2286
300 Ga0495635_0012666 3300046663 Bacteria 5915
301 Ga0495635_0179821 3300046663 Bacteria 1438
302 Ga0495635_0184942 3300046663 Bacteria 1415
303 Ga0495657_0012305 3300046675 Bacteria 6359
304 Ga0495657_0093336 3300046675 Bacteria 1927
305 Ga0495599_0000016 3300046678 Bacteria 169605
306 Ga0495599_0028174 3300046678 Bacteria 3520
307 Ga0495599_0048424 3300046678 Bacteria 2664
308 Ga0495599_0332012 3300046678 Bacteria 914
309 Ga0495623_0000046 3300046679 Bacteria 74571
310 Ga0495646_0002059 3300046680 Bacteria 12196
311 Ga0495646_0134474 3300046680 Bacteria 1389
312 Ga0495658_0005661 3300046683 Bacteria 6141
313 Ga0495658_0011166 3300046683 Bacteria 4509
314 Ga0495613_0013505 3300046689 Bacteria 6065
315 Ga0495613_0049737 3300046689 Bacteria 3092
316 Ga0495624_0010787 3300046690 Bacteria 6298
317 Ga0495624_0051212 3300046690 Bacteria 2614
318 Ga0495670_0096593 3300046691 Bacteria 1517
319 Ga0495589_0051778 3300046794 Bacteria 2029
320 Ga0495600_0110732 3300046809 Bacteria 1788
321 Ga0495600_0148299 3300046809 Bacteria 1520
322 Ga0495600_0159510 3300046809 Bacteria 1458
323 Ga0495581_0022524 3300047315 Bacteria 3650
324 Ga0495604_0000004 3300047317 Bacteria 456385
325 Ga0495604_0078930 3300047317 Bacteria 2469
326 Ga0495674_0149643 3300047319 Bacteria 1958
327 Ga0495676_0000766 3300047321 Bacteria 26783
328 Ga0495676_0133063 3300047321 Bacteria 1792
329 Ga0495680_0003633 3300047322 Bacteria 15069
330 Ga0495680_0013308 3300047322 Bacteria 7184
331 Ga0495680_0030539 3300047322 Bacteria 4399
332 Ga0495680_0053917 3300047322 Bacteria 3125
333 Ga0495680_0093687 3300047322 Bacteria 2248
334 Ga0495680_0185824 3300047322 Bacteria 1497
335 Ga0495675_0000079 3300047444 Bacteria 68947
336 Ga0495675_0149628 3300047444 Bacteria 1443
337 Ga0495679_036931 3300047446 Bacteria 1540
338 Ga0495684_0003487 3300047471 Bacteria 12313
339 Ga0495684_0026751 3300047471 Bacteria 4432
340 Ga0495684_0098211 3300047471 Bacteria 2214
341 Ga0495684_0249314 3300047471 Bacteria 1292
342 Ga0495684_0452033 3300047471 Bacteria 892
343 Ga0495593_0012047 3300047673 Bacteria 4956
344 Ga0495602_0003737 3300048088 Bacteria 15807
345 Ga0495614_0000786 3300048089 Bacteria 13431
346 Ga0496100_0174513 3300048903 Bacteria 1551
347 Ga0496100_0314173 3300048903 Bacteria 1175
348 Ga0496101_0232046 3300048904 Bacteria 1435
349 Ga0496102_0011255 3300048905 Bacteria 7708
350 Ga0496102_0449855 3300048905 Bacteria 1208
351 Ga0496103_0045275 3300048906 Bacteria 2715
352 Ga0496103_0179179 3300048906 Bacteria 1362
353 Ga0496104_0000931 3300048907 Bacteria 25124
354 Ga0496104_0012667 3300048907 Bacteria 7593
355 Ga0496105_0004484 3300048908 Bacteria 10513
356 Ga0496105_0008481 3300048908 Bacteria 7986
357 Ga0496105_0079795 3300048908 Bacteria 2702
358 Ga0496106_0097806 3300048909 Bacteria 2273
359 Ga0496106_0313401 3300048909 Bacteria 1259
360 Ga0496107_0133269 3300048910 Bacteria 1835
361 Ga0496107_0207526 3300048910 Bacteria 1456
362 Ga0496108_0003668 3300048911 Bacteria 12319
363 Ga0496108_0040200 3300048911 Bacteria 3897
364 Ga0496109_0003288 3300048912 Bacteria 13492
365 Ga0496109_0051434 3300048912 Bacteria 3752
366 Ga0496110_0198224 3300048913 Bacteria 1824
367 Ga0496111_0291177 3300048914 Bacteria 1211
368 Ga0496111_0296615 3300048914 Bacteria 1198
369 Ga0496111_0326988 3300048914 Bacteria 1135
370 Ga0496112_0080760 3300048915 Bacteria 3216
371 Ga0496113_0054788 3300048916 Bacteria 2987
372 Ga0496113_0130240 3300048916 Bacteria 1973
373 Ga0496114_0152642 3300048917 Bacteria 2004
374 Ga0496114_0175296 3300048917 Bacteria 1871
375 Ga0496115_0032746 3300048918 Bacteria 4102
376 Ga0496115_0056909 3300048918 Bacteria 3144
377 Ga0501034_0030052 3300049571 Bacteria 5524
378 Ga0501047_0081984 3300049581 Bacteria 3101
379 Ga0501067_0038408 3300049583 Bacteria 2658
380 Ga0501069_0023626 3300049585 Bacteria 3352
381 Ga0501070_0013585 3300049586 Bacteria 6862
382 Ga0501070_0016244 3300049586 Bacteria 6255
383 Ga0501072_0022311 3300049588 Bacteria 4911
384 Ga0501074_0025563 3300049590 Bacteria 4286
385 Ga0501074_0043147 3300049590 Bacteria 3264
386 Ga0501079_0009950 3300049741 Bacteria 7219
387 Ga0501080_0026160 3300049742 Bacteria 5420
388 Ga0501080_0063175 3300049742 Bacteria 3446
389 Ga0501083_0000362 3300049744 Bacteria 28821
390 nmdc:mga05p37_221368_c1 3300050507 Bacteria 2284
391 nmdc:mga05p37_927583_c1 3300050507 Bacteria 935
392 nmdc:mga06r32_42931_c1 3300050510 Bacteria 4301
393 nmdc:mga08y16_31720_c1 3300050511 Bacteria 5556
394 nmdc:mga08y16_691576_c1 3300050511 Bacteria 1021
395 nmdc:mga0n895_65797_c1 3300050512 Bacteria 3589
396 nmdc:mga0n895_97304_c1 3300050512 Bacteria 2949
397 nmdc:mga0rr50_58320_c1 3300050513 Bacteria 2893
398 nmdc:mga0rr50_74384_c1 3300050513 Bacteria 2600
399 nmdc:mga08x19_209264_c1 3300050514 Bacteria 1339
400 nmdc:mga0a205_38145_c1 3300050515 Bacteria 4622
401 Ga0495601_0001391 3300053077 Bacteria 13315
402 Ga0495601_0010171 3300053077 Bacteria 5591
403 Ga0495601_0104890 3300053077 Bacteria 1827
404 Ga0495612_0042105 3300053078 Bacteria 1863
405 Ga0495612_0069803 3300053078 Bacteria 1464
406 Ga0495612_0083386 3300053078 Bacteria 1345
407 Ga0495612_0142885 3300053078 Bacteria 1039
408 Ga0495595_0016850 3300053084 Bacteria 3134
409 Ga0495595_0022005 3300053084 Bacteria 2794
410 Ga0495595_0038682 3300053084 Bacteria 2174
411 Ga0495619_0002372 3300053085 Bacteria 12385
412 Ga0495619_0010642 3300053085 Bacteria 5789
413 Ga0495619_0070364 3300053085 Bacteria 2340
414 Ga0495619_0071703 3300053085 Bacteria 2318
415 Ga0495619_0087509 3300053085 Bacteria 2106
416 Ga0500566_0111949 3300053094 Bacteria 1483
417 Ga0501084_0634854 3300054114 Bacteria 902
418 Ga0466962_0000230 3300061719 Bacteria 23282
419 Ga0466962_0006516 3300061719 Bacteria 5604
420 Ga0466962_0014405 3300061719 Bacteria 3810
421 Ga0530510_0033600 3300061734 Bacteria 3692
422 Ga0530510_0046836 3300061734 Bacteria 3124
423 Ga0530510_0052053 3300061734 Bacteria 2959
424 Ga0395901_0081942
425 Ga0070658_10015901
426 Ga0070658_10130858
427 Ga0070658_10226672
428 Ga0070683_100185937
429 Ga0070680_100036657
430 Ga0070680_100217623
431 Ga0070680_100404726
432 Ga0070682_100016719
433 Ga0070682_100038907
434 Ga0068868_100322666
435 Ga0070660_100173085
436 Ga0070691_10110509
437 Ga0070668_100221542
438 Ga0070659_100088836
439 Ga0070659_100118982
440 Ga0070709_10026446
441 Ga0070709_10284637
442 Ga0070714_100015594
443 Ga0070714_100195779
444 Ga0070714_100424822
445 Ga0070713_100264556
446 Ga0070710_10033394
447 Ga0070711_100055015
448 Ga0070678_100431139
449 Ga0070662_100032872
450 Ga0070681_10030451
451 Ga0070681_10046021
452 Ga0070681_10058968
453 Ga0070681_10163151
454 Ga0070681_10486520
455 Ga0070707_100001944
456 Ga0070707_100227333
457 Ga0070698_100298839
458 Ga0070679_100018487
459 Ga0070679_100030742
460 Ga0070679_100050974
461 Ga0070679_100080265
462 Ga0070679_100255287
463 Ga0070684_100036290
464 Ga0070684_100439734
465 Ga0070686_100175445
466 Ga0070704_100171147
467 Ga0068855_100049563
468 Ga0068855_100588558
469 Ga0068856_100056227
470 Ga0070702_100240072
471 Ga0081455_10040705
472 Ga0081455_10138530
473 Ga0081538_10023392
474 Ga0081539_10002473
475 Ga0070717_10012990
476 Ga0070717_10231332
477 Ga0075432_10000155
478 Ga0070712_100272552
479 Ga0075433_10305358
480 Ga0075434_100035225
481 Ga0075434_100076724
482 Ga0075434_100126776
483 Ga0075435_100008272
484 Ga0105240_10042640
485 Ga0105240_10064362
486 Ga0111539_10011406
487 Ga0111539_10071104
488 Ga0111539_10298380
489 Ga0105245_10391009
490 Ga0114129_10138970
491 Ga0114129_10198708
492 Ga0105237_10085979
493 Ga0105239_10209341
494 Ga0157370_10050164
495 Ga0157369_10043133
496 Ga0157369_10051784
497 Ga0157369_10054649
498 Ga0163162_10397913
499 Ga0157372_10030767
500 Ga0157372_10074121
501 Ga0157372_10555008
502 Ga0157375_10153417
503 Ga0182008_10178396
504 Ga0157377_10365817
505 Ga0157376_10025246
506 Ga0206356_10036998
507 Ga0206356_10915091
508 Ga0206354_11466558
509 Ga0206353_11502198
510 Ga0207653_10139747
511 Ga0207692_10132203
512 Ga0207699_10043154
513 Ga0207705_10067348
514 Ga0207705_10298978
515 Ga0207684_10235802
516 Ga0207707_10040068
517 Ga0207707_10105817
518 Ga0207707_10182237
519 Ga0207707_10184049
520 Ga0207695_10031637
521 Ga0207671_10076949
522 Ga0207693_10005483
523 Ga0207693_10012161
524 Ga0207693_10141972
525 Ga0207663_10014250
526 Ga0207663_10122812
527 Ga0207660_10085626
528 Ga0207660_10340112
529 Ga0207657_10004793
530 Ga0207657_10018436
531 Ga0207649_10053418
532 Ga0207652_10023102
533 Ga0207652_10165026
534 Ga0207652_10172506
535 Ga0207652_10225823
536 Ga0207652_10254761
537 Ga0207652_10650998
538 Ga0207646_10007075
539 Ga0207646_10065462
540 Ga0207687_10066428
541 Ga0207700_10281067
542 Ga0207700_10295309
543 Ga0207664_10014835
544 Ga0207664_10053550
545 Ga0207664_10090418
546 Ga0207706_10015841
547 Ga0207709_10028776
548 Ga0207661_10037822
549 Ga0207667_10158444
550 Ga0207712_10098340
551 Ga0207668_10063415
552 Ga0207639_10458217
553 Ga0207648_10156052
554 Ga0207675_100000456
555 Ga0207675_100303300
556 Ga0207683_10244141
557 Ga0207698_10132928
558 Ga0207698_10320484
559 Ga0207428_10169385
560 Ga0265334_10026168
561 Ga0265336_10000866
562 Ga0265338_10003469
563 Ga0265338_10005798
564 Ga0265338_10089991
565 Ga0265325_10026134
566 Ga0307409_100286774
567 Ga0373926_0003671
568 Ga0373923_0085847
569 Ga0373945_0060642
570 Ga0373943_0001785
571 Ga0373924_0037414
572 Ga0373935_0081553
573 Ga0373927_0049069
574 Ga0373933_0101264
575 Ga0373925_0190810
576 Ga0395899_0105108
577 Ga0395900_0037086
578 Ga0395900_0183243
579 Ga0395900_0621165
580 Ga0395898_0013091
581 Ga0395898_0013174
582 Ga0395898_0027945
583 Ga0395898_0030451
584 Ga0395898_0046681
585 Ga0395898_0386100
586 Ga0395905_0008518
587 Ga0395905_0017680
588 Ga0395905_0053433
589 Ga0395905_0078052
590 Ga0395905_0142147
591 Ga0395905_0176809
592 Ga0395901_0004052
593 Ga0395901_0005367
594 Ga0395901_0013531
595 Ga0395901_0015304
596 Ga0395901_0070092
597 Ga0395901_0155601
598 Ga0395901_0298062
599 Ga0466965_0222694
600 Ga0466966_0004699
601 Ga0466961_0019503
602 Ga0466963_0000851
603 Ga0466963_0004118
604 Ga0466963_0008142
605 Ga0466963_0012627
606 Ga0466963_0017740
607 Ga0466963_0018129
608 Ga0466963_0026649
609 Ga0466963_0041044
610 Ga0466963_0051237
611 Ga0466963_0057717
612 Ga0466963_0115947
613 Ga0466963_0139697
614 Ga0466963_0200207
615 Ga0466964_0001364
616 Ga0466964_0003348
617 Ga0466964_0052347
618 Ga0466971_0005803
619 Ga0466968_0020786
620 Ga0466968_0078112
621 Ga0466968_0114927
622 Ga0466957_0002697
623 Ga0466957_0007742
624 Ga0466957_0027087
625 Ga0466957_0034668
626 Ga0466957_0072096
627 Ga0466957_0078128
628 Ga0466957_0109430
629 Ga0466957_0149113
630 Ga0466960_0009082
631 Ga0466960_0039848
632 Ga0466959_0007658
633 Ga0466959_0015102
634 Ga0466959_0046544
635 Ga0466959_0124040
636 Ga0466959_0126288
637 Ga0466958_0001637
638 Ga0466958_0018707
639 Ga0466958_0024203
640 Ga0466958_0047713
641 Ga0466958_0069488
642 Ga0466958_0187469
643 Ga0466958_0212679
644 Ga0466967_0003101
645 Ga0466967_0007502
646 Ga0466967_0014671
647 Ga0466967_0015023
648 Ga0466967_0032145
649 Ga0466967_0032790
650 Ga0466967_0034599
651 Ga0466967_0054438
652 Ga0466967_0069415
653 Ga0466967_0069942
654 Ga0466967_0077957
655 Ga0466967_0112554
656 Ga0466967_0119653
657 Ga0466967_0129055
658 Ga0466967_0148071
659 Ga0466967_0199500
660 Ga0466967_0394131
661 Ga0495592_0000048
662 Ga0495592_0011699
663 Ga0495592_0058361
664 Ga0495629_0009637
665 Ga0495629_0024290
666 Ga0495641_0001416
667 Ga0495641_0050104
668 Ga0495651_0000049
669 Ga0495651_0063410
670 Ga0495651_0074588
671 Ga0495653_0011777
672 Ga0495653_0034322
673 Ga0495653_0074341
674 Ga0495653_0188760
675 Ga0495580_0138957
676 Ga0495582_0008083
677 Ga0495582_0019661
678 Ga0495582_0205253
679 Ga0495639_0000180
680 Ga0495664_0006830
681 Ga0495664_0019218
682 Ga0495664_0209517
683 Ga0495664_0217390
684 Ga0495584_0013077
685 Ga0495608_0003399
686 Ga0495608_0036577
687 Ga0495608_0164443
688 Ga0495608_0243652
689 Ga0495618_0001916
690 Ga0495618_0028805
691 Ga0495628_0000026
692 Ga0495628_0027227
693 Ga0495628_0038864
694 Ga0495628_0067168
695 Ga0495628_0129695
696 Ga0495630_0089815
697 Ga0495630_0252226
698 Ga0495630_0314275
699 Ga0495644_0003843
700 Ga0495663_0031084
701 Ga0495666_0024265
702 Ga0495652_0000172
703 Ga0495652_0012745
704 Ga0495652_0034510
705 Ga0495652_0082929
706 Ga0495652_0090898
707 Ga0495652_0133818
708 Ga0495665_0004638
709 Ga0495640_0160111
710 Ga0495586_0165313
711 Ga0495587_0000362
712 Ga0495598_0019384
713 Ga0495609_0045030
714 Ga0495645_0000016
715 Ga0495645_0037692
716 Ga0495645_0120375
717 Ga0495645_0150074
718 Ga0495667_0003656
719 Ga0495667_0084957
720 Ga0495667_0333805
721 Ga0495656_0028018
722 Ga0495611_0032920
723 Ga0495635_0012666
724 Ga0495635_0179821
725 Ga0495635_0184942
726 Ga0495657_0012305
727 Ga0495657_0093336
728 Ga0495599_0000016
729 Ga0495599_0028174
730 Ga0495599_0048424
731 Ga0495599_0332012
732 Ga0495623_0000046
733 Ga0495646_0002059
734 Ga0495646_0134474
735 Ga0495658_0005661
736 Ga0495658_0011166
737 Ga0495613_0013505
738 Ga0495613_0049737
739 Ga0495624_0010787
740 Ga0495624_0051212
741 Ga0495670_0096593
742 Ga0495589_0051778
743 Ga0495600_0110732
744 Ga0495600_0148299
745 Ga0495600_0159510
746 Ga0495581_0022524
747 Ga0495604_0000004
748 Ga0495604_0078930
749 Ga0495674_0149643
750 Ga0495676_0000766
751 Ga0495676_0133063
752 Ga0495680_0003633
753 Ga0495680_0013308
754 Ga0495680_0030539
755 Ga0495680_0053917
756 Ga0495680_0093687
757 Ga0495680_0185824
758 Ga0495675_0000079
759 Ga0495675_0149628
760 Ga0495679_036931
761 Ga0495684_0003487
762 Ga0495684_0026751
763 Ga0495684_0098211
764 Ga0495684_0249314
765 Ga0495684_0452033
766 Ga0495593_0012047
767 Ga0495602_0003737
768 Ga0495614_0000786
769 Ga0496100_0174513
770 Ga0496100_0314173
771 Ga0496101_0232046
772 Ga0496102_0011255
773 Ga0496102_0449855
774 Ga0496103_0045275
775 Ga0496103_0179179
776 Ga0496104_0000931
777 Ga0496104_0012667
778 Ga0496105_0004484
779 Ga0496105_0008481
780 Ga0496105_0079795
781 Ga0496106_0097806
782 Ga0496106_0313401
783 Ga0496107_0133269
784 Ga0496107_0207526
785 Ga0496108_0003668
786 Ga0496108_0040200
787 Ga0496109_0003288
788 Ga0496109_0051434
789 Ga0496110_0198224
790 Ga0496111_0291177
791 Ga0496111_0296615
792 Ga0496111_0326988
793 Ga0496112_0080760
794 Ga0496113_0054788
795 Ga0496113_0130240
796 Ga0496114_0152642
797 Ga0496114_0175296
798 Ga0496115_0032746
799 Ga0496115_0056909
800 Ga0501034_0030052
801 Ga0501047_0081984
802 Ga0501067_0038408
803 Ga0501069_0023626
804 Ga0501070_0013585
805 Ga0501070_0016244
806 Ga0501072_0022311
807 Ga0501074_0025563
808 Ga0501074_0043147
809 Ga0501079_0009950
810 Ga0501080_0026160
811 Ga0501080_0063175
812 Ga0501083_0000362
813 nmdc:mga05p37_221368_c1
814 nmdc:mga05p37_927583_c1
815 nmdc:mga06r32_42931_c1
816 nmdc:mga08y16_31720_c1
817 nmdc:mga08y16_691576_c1
818 nmdc:mga0n895_65797_c1
819 nmdc:mga0n895_97304_c1
820 nmdc:mga0rr50_58320_c1
821 nmdc:mga0rr50_74384_c1
822 nmdc:mga08x19_209264_c1
823 nmdc:mga0a205_38145_c1
824 Ga0495601_0001391
825 Ga0495601_0010171
826 Ga0495601_0104890
827 Ga0495612_0042105
828 Ga0495612_0069803
829 Ga0495612_0083386
830 Ga0495612_0142885
831 Ga0495595_0016850
832 Ga0495595_0022005
833 Ga0495595_0038682
834 Ga0495619_0002372
835 Ga0495619_0010642
836 Ga0495619_0070364
837 Ga0495619_0071703
838 Ga0495619_0087509
839 Ga0500566_0111949
840 Ga0501084_0634854
841 Ga0466962_0000230
842 Ga0466962_0006516
843 Ga0466962_0014405
844 Ga0530510_0033600
845 Ga0530510_0046836
846 Ga0530510_0052053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00809

Pterin_bind

Pterin binding enzyme

1

235

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dzb-assembly1.cif.gz_B crystal structure of dihydropteroate synthase from thermus thermophilus hb8 in complex with 6hmppp 0.9457 1 253
3tzf-assembly1.cif.gz_A crystal structure of the yersinia pestis dihydropteroate synthase with sulfonamide drug complex. 0.9434 1 252
3tzn-assembly1.cif.gz_A crystal structure of the yersinia pestis dihydropteroate synthase. 0.9409 1 252
5jq9-assembly1.cif.gz_A yersinia pestis dhps with pterine-sulfa conjugate compound 16 0.9395 1 252
6q62-assembly2.cif.gz_D xanthomonas albilineans dihydropteroate synthase in complex with (indole-2-carboxylic acid) and (6-chloroguanine) 0.9389 1 252
ID Description Score Start End Superfamily
5jq9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9395 1 252 3.20.20.20
1eyeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9223 1 252 3.20.20.20
2bmbA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9211 1 252 3.20.20.20
6dayA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9185 1 252 3.20.20.20
4hb7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9169 1 252 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A524MYP3-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9724 73 252 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A1W9S4U1-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9708 81 252 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A538KT60-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9696 20 252 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A7C7L0H9-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9689 64 252 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A1V5H2B0-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9685 72 252 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872

Map