F440511

General Info

Members Datasets Scaffolds Average Seq Length
423 221 846 133

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10061371|Ga0105241_100613712
Length 161
Sequence MAAGLSAAVASRVQGLRRSGLLSFGERRHMGRMTSFPTVRSDEALEQGNTLAPRFDANGLIAAVATHAETGEVLMLAWMNAEALGKTLETGEAHYFSRSRNELWHKGATSGQVQVIEELRVDCDQDAVWLKVWPQGDGGACHTGARSCFYRVVEGGKLVRK

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
137 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
189 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
210 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
211 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
218 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
219 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
220 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
221 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.35
Nodule 0
Rhizoplane 5.91
Rhizosphere 79.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10061371 3300009174 Bacteria 2895
2 Ga0055531_10065654 3300003794 Bacteria 861
3 Ga0065165_1031597 3300005262 Bacteria 1671
4 Ga0070658_10109373 3300005327 Bacteria 2288
5 Ga0070658_10112431 3300005327 Bacteria 2257
6 Ga0070658_10301379 3300005327 Bacteria 1366
7 Ga0070658_10890168 3300005327 Bacteria 774
8 Ga0070670_100000426 3300005331 Bacteria 34748
9 Ga0070670_100023099 3300005331 Bacteria 5352
10 Ga0070666_10137684 3300005335 Bacteria 1699
11 Ga0070666_10344425 3300005335 Bacteria 1066
12 Ga0070680_100074360 3300005336 Bacteria 2796
13 Ga0070680_100537289 3300005336 Bacteria 1001
14 Ga0070680_101472987 3300005336 Bacteria 590
15 Ga0068868_100840529 3300005338 Bacteria 831
16 Ga0070660_100242810 3300005339 Bacteria 1467
17 Ga0070660_100285622 3300005339 Bacteria 1351
18 Ga0070660_100888755 3300005339 Bacteria 751
19 Ga0070668_100000042 3300005347 Bacteria 78694
20 Ga0070668_100001654 3300005347 Bacteria 16174
21 Ga0070669_100095034 3300005353 Bacteria 2240
22 Ga0070671_100002773 3300005355 Bacteria 13608
23 Ga0070671_100146593 3300005355 Bacteria 1992
24 Ga0070671_100179738 3300005355 Bacteria 1791
25 Ga0070659_100000428 3300005366 Bacteria 31806
26 Ga0070659_100023788 3300005366 Bacteria 4690
27 Ga0070667_100000168 3300005367 Bacteria 81935
28 Ga0070667_100001255 3300005367 Bacteria 23018
29 Ga0070667_100018214 3300005367 Bacteria 5822
30 Ga0070667_100070820 3300005367 Bacteria 2969
31 Ga0070667_100687603 3300005367 Bacteria 946
32 Ga0070678_100964927 3300005456 Bacteria 782
33 Ga0070662_100445785 3300005457 Bacteria 1074
34 Ga0070681_10178729 3300005458 Bacteria 2044
35 Ga0070681_11252838 3300005458 Bacteria 664
36 Ga0068867_100795523 3300005459 Bacteria 843
37 Ga0070698_101311804 3300005471 Bacteria 674
38 Ga0070679_100104932 3300005530 Bacteria 2812
39 Ga0070679_100198518 3300005530 Bacteria 1973
40 Ga0070679_100198601 3300005530 Bacteria 1972
41 Ga0070679_100752972 3300005530 Bacteria 917
42 Ga0070684_100489444 3300005535 Bacteria 1139
43 Ga0068853_100195007 3300005539 Bacteria 1841
44 Ga0070672_101085389 3300005543 Bacteria 711
45 Ga0070686_100958999 3300005544 Bacteria 699
46 Ga0070665_100000363 3300005548 Bacteria 67699
47 Ga0070665_100000593 3300005548 Bacteria 50386
48 Ga0070665_100000674 3300005548 Bacteria 45861
49 Ga0070665_100146343 3300005548 Bacteria 2365
50 Ga0068855_100011377 3300005563 Bacteria 10744
51 Ga0068855_100066245 3300005563 Bacteria 4211
52 Ga0068855_100084544 3300005563 Bacteria 3673
53 Ga0068855_100090428 3300005563 Bacteria 3533
54 Ga0068855_100506449 3300005563 Bacteria 1311
55 Ga0070664_100280338 3300005564 Bacteria 1503
56 Ga0068854_101079690 3300005578 Bacteria 714
57 Ga0068856_100174994 3300005614 Bacteria 2159
58 Ga0068852_100239527 3300005616 Bacteria 1733
59 Ga0068852_100440256 3300005616 Bacteria 1288
60 Ga0068859_100000230 3300005617 Bacteria 55064
61 Ga0068859_100028218 3300005617 Bacteria 5626
62 Ga0068859_101183396 3300005617 Bacteria 842
63 Ga0068864_100000135 3300005618 Bacteria 71759
64 Ga0068864_100007315 3300005618 Bacteria 9084
65 Ga0068864_100256714 3300005618 Bacteria 1625
66 Ga0068861_101892376 3300005719 Bacteria 593
67 Ga0068870_10997424 3300005840 Bacteria 597
68 Ga0068863_100000735 3300005841 Bacteria 32827
69 Ga0068863_100003612 3300005841 Bacteria 15273
70 Ga0068863_100033274 3300005841 Bacteria 4911
71 Ga0068863_100033622 3300005841 Bacteria 4885
72 Ga0068863_100218595 3300005841 Bacteria 1835
73 Ga0068858_100000020 3300005842 Bacteria 175896
74 Ga0068858_100002621 3300005842 Bacteria 18119
75 Ga0068858_100019958 3300005842 Bacteria 6267
76 Ga0068858_100801418 3300005842 Bacteria 919
77 Ga0068860_100000133 3300005843 Bacteria 120382
78 Ga0068860_100054816 3300005843 Bacteria 3789
79 Ga0068862_100009611 3300005844 Bacteria 7992
80 Ga0068862_100025208 3300005844 Bacteria 4992
81 Ga0068862_100029609 3300005844 Bacteria 4614
82 Ga0068862_100576759 3300005844 Bacteria 1077
83 Ga0070717_10016497 3300006028 Bacteria 5727
84 Ga0075368_10001453 3300006042 Bacteria 7577
85 Ga0075363_100298309 3300006048 Bacteria 935
86 Ga0075363_100348525 3300006048 Bacteria 864
87 Ga0075364_10000647 3300006051 Bacteria 17958
88 Ga0075362_10117252 3300006177 Bacteria 1257
89 Ga0075366_10117451 3300006195 Bacteria 1602
90 Ga0068871_100567518 3300006358 Bacteria 1029
91 Ga0068865_100084452 3300006881 Bacteria 2288
92 Ga0097620_100000230 3300006931 Bacteria 55064
93 Ga0097620_100028219 3300006931 Bacteria 5626
94 Ga0097620_101183363 3300006931 Bacteria 842
95 Ga0105250_10016327 3300009092 Bacteria 3028
96 Ga0105240_10000970 3300009093 Bacteria 51122
97 Ga0105240_10052130 3300009093 Bacteria 5144
98 Ga0105240_10093193 3300009093 Bacteria 3677
99 Ga0105240_10102623 3300009093 Bacteria 3476
100 Ga0105240_10128594 3300009093 Bacteria 3041
101 Ga0105240_12799136 3300009093 Bacteria 501
102 Ga0105247_10104294 3300009101 Bacteria 1816
103 Ga0105247_10530729 3300009101 Bacteria 862
104 Ga0105247_10922827 3300009101 Bacteria 676
105 Ga0105248_10007113 3300009177 Bacteria 12260
106 Ga0105248_10015057 3300009177 Bacteria 8517
107 Ga0105248_10184585 3300009177 Bacteria 2350
108 Ga0105248_10310476 3300009177 Bacteria 1776
109 Ga0105248_10362335 3300009177 Bacteria 1632
110 Ga0105237_12712144 3300009545 Bacteria 506
111 Ga0105238_10010874 3300009551 Bacteria 9146
112 Ga0105238_10013458 3300009551 Bacteria 8258
113 Ga0105238_10069642 3300009551 Bacteria 3518
114 Ga0105238_10387927 3300009551 Bacteria 1389
115 Ga0105238_10392353 3300009551 Bacteria 1380
116 Ga0105238_10496207 3300009551 Bacteria 1221
117 Ga0105238_12216466 3300009551 Bacteria 584
118 Ga0105249_10031347 3300009553 Bacteria 4808
119 Ga0105249_10111245 3300009553 Bacteria 2590
120 Ga0105249_11174429 3300009553 Bacteria 838
121 Ga0105249_11673447 3300009553 Bacteria 709
122 Ga0105239_10921704 3300010375 Bacteria 1003
123 Ga0157370_10168673 3300013104 Bacteria 2035
124 Ga0157370_10554443 3300013104 Bacteria 1053
125 Ga0157369_10662364 3300013105 Bacteria 1076
126 Ga0157374_10125151 3300013296 Bacteria 2484
127 Ga0157374_12642713 3300013296 Bacteria 530
128 Ga0163162_10108855 3300013306 Bacteria 2868
129 Ga0163162_10330000 3300013306 Bacteria 1658
130 Ga0163162_11234774 3300013306 Bacteria 848
131 Ga0157372_10631682 3300013307 Bacteria 1248
132 Ga0157375_11067682 3300013308 Bacteria 944
133 Ga0157375_11072458 3300013308 Bacteria 942
134 Ga0163163_10006261 3300014325 Bacteria 10389
135 Ga0163163_10051200 3300014325 Bacteria 4072
136 Ga0163163_10066509 3300014325 Bacteria 3580
137 Ga0163163_10196921 3300014325 Bacteria 2063
138 Ga0163163_10307936 3300014325 Bacteria 1637
139 Ga0163163_10585246 3300014325 Bacteria 1179
140 Ga0163163_11799762 3300014325 Bacteria 673
141 Ga0157380_13077172 3300014326 Bacteria 532
142 Ga0157377_10229982 3300014745 Bacteria 1192
143 Ga0157379_10018770 3300014968 Bacteria 6097
144 Ga0157379_10019437 3300014968 Bacteria 6000
145 Ga0157379_10261406 3300014968 Bacteria 1573
146 Ga0157379_12671096 3300014968 Bacteria 500
147 Ga0157376_10697903 3300014969 Bacteria 1020
148 Ga0157376_11822647 3300014969 Bacteria 645
149 Ga0157376_12538060 3300014969 Bacteria 552
150 Ga0197907_10496706 3300020069 Bacteria 504
151 Ga0206356_11263106 3300020070 Bacteria 1250
152 Ga0213876_10478082 3300021384 Bacteria 663
153 Ga0209026_1027835 3300025250 Bacteria 845
154 Ga0209148_1014358 3300025254 Bacteria 1401
155 Ga0209257_1007869 3300025304 Bacteria 6279
156 Ga0207697_10053412 3300025315 Bacteria 1673
157 Ga0207710_10043612 3300025900 Bacteria 1995
158 Ga0207680_10125581 3300025903 Bacteria 1684
159 Ga0207680_10417831 3300025903 Bacteria 949
160 Ga0207680_10704372 3300025903 Bacteria 724
161 Ga0207705_10004624 3300025909 Bacteria 10384
162 Ga0207705_10291791 3300025909 Bacteria 1250
163 Ga0207705_10436609 3300025909 Bacteria 1014
164 Ga0207705_10448300 3300025909 Bacteria 1000
165 Ga0207705_11408766 3300025909 Bacteria 530
166 Ga0207654_10092319 3300025911 Bacteria 1848
167 Ga0207707_10013146 3300025912 Bacteria 7213
168 Ga0207707_10161119 3300025912 Bacteria 1961
169 Ga0207707_10164915 3300025912 Bacteria 1936
170 Ga0207695_10001235 3300025913 Bacteria 43771
171 Ga0207695_10029689 3300025913 Bacteria 6034
172 Ga0207695_10039728 3300025913 Bacteria 5054
173 Ga0207695_10102554 3300025913 Bacteria 2854
174 Ga0207695_10106883 3300025913 Bacteria 2784
175 Ga0207660_10017814 3300025917 Bacteria 4726
176 Ga0207660_10439731 3300025917 Bacteria 1054
177 Ga0207657_10021713 3300025919 Bacteria 6034
178 Ga0207657_10073841 3300025919 Bacteria 2881
179 Ga0207657_10102315 3300025919 Bacteria 2376
180 Ga0207657_10312491 3300025919 Bacteria 1244
181 Ga0207652_10005105 3300025921 Bacteria 10656
182 Ga0207652_10328933 3300025921 Bacteria 1380
183 Ga0207652_10604697 3300025921 Bacteria 983
184 Ga0207681_10005512 3300025923 Bacteria 7773
185 Ga0207694_10008112 3300025924 Bacteria 7936
186 Ga0207694_10192972 3300025924 Bacteria 1655
187 Ga0207694_10789645 3300025924 Bacteria 802
188 Ga0207650_10000016 3300025925 Bacteria 361958
189 Ga0207650_10039016 3300025925 Bacteria 3471
190 Ga0207644_10000420 3300025931 Bacteria 27556
191 Ga0207644_10132290 3300025931 Bacteria 1911
192 Ga0207644_10175752 3300025931 Bacteria 1675
193 Ga0207644_10451763 3300025931 Bacteria 1056
194 Ga0207644_10790647 3300025931 Bacteria 793
195 Ga0207690_10000373 3300025932 Bacteria 29751
196 Ga0207706_10020181 3300025933 Bacteria 5988
197 Ga0207665_10610732 3300025939 Bacteria 852
198 Ga0207711_10005088 3300025941 Bacteria 11145
199 Ga0207711_10006868 3300025941 Bacteria 9557
200 Ga0207711_10030136 3300025941 Bacteria 4576
201 Ga0207711_10699972 3300025941 Bacteria 945
202 Ga0207711_11185777 3300025941 Bacteria 705
203 Ga0207679_10175432 3300025945 Bacteria 1769
204 Ga0207667_10024987 3300025949 Bacteria 6549
205 Ga0207667_10031003 3300025949 Bacteria 5777
206 Ga0207667_10041095 3300025949 Bacteria 4919
207 Ga0207667_10228158 3300025949 Bacteria 1907
208 Ga0207712_10016310 3300025961 Bacteria 4807
209 Ga0207712_10462926 3300025961 Bacteria 1078
210 Ga0207712_11481894 3300025961 Bacteria 608
211 Ga0207668_10000401 3300025972 Bacteria 27305
212 Ga0207668_10002830 3300025972 Bacteria 10160
213 Ga0207668_10029685 3300025972 Bacteria 3586
214 Ga0207640_10859281 3300025981 Bacteria 790
215 Ga0207658_10000399 3300025986 Bacteria 41904
216 Ga0207658_10003280 3300025986 Bacteria 11494
217 Ga0207658_10003349 3300025986 Bacteria 11367
218 Ga0207658_10017515 3300025986 Bacteria 4938
219 Ga0207658_11771805 3300025986 Bacteria 564
220 Ga0207677_11329328 3300026023 Bacteria 661
221 Ga0207703_10000082 3300026035 Bacteria 110579
222 Ga0207703_10005619 3300026035 Bacteria 10066
223 Ga0207703_10732104 3300026035 Bacteria 942
224 Ga0207639_10058515 3300026041 Bacteria 2965
225 Ga0207639_10338538 3300026041 Bacteria 1341
226 Ga0207639_11590163 3300026041 Bacteria 613
227 Ga0207639_11710076 3300026041 Bacteria 589
228 Ga0207678_10188174 3300026067 Bacteria 1764
229 Ga0207678_11695993 3300026067 Bacteria 555
230 Ga0207641_10000007 3300026088 Bacteria 441443
231 Ga0207641_10023383 3300026088 Bacteria 5092
232 Ga0207641_10025900 3300026088 Bacteria 4837
233 Ga0207641_10042785 3300026088 Bacteria 3801
234 Ga0207641_10046080 3300026088 Bacteria 3675
235 Ga0207676_10000241 3300026095 Bacteria 47707
236 Ga0207676_10000618 3300026095 Bacteria 29046
237 Ga0207676_10238145 3300026095 Bacteria 1631
238 Ga0207676_10335189 3300026095 Bacteria 1393
239 Ga0207675_100063442 3300026118 Bacteria 3452
240 Ga0207675_101140172 3300026118 Bacteria 800
241 Ga0207683_11149192 3300026121 Bacteria 720
242 Ga0207698_10242129 3300026142 Bacteria 1645
243 Ga0268266_10000003 3300028379 Bacteria 1701703
244 Ga0268266_10012561 3300028379 Bacteria 7318
245 Ga0268266_10016531 3300028379 Bacteria 6307
246 Ga0268265_10000836 3300028380 Bacteria 28993
247 Ga0268265_10008007 3300028380 Bacteria 7136
248 Ga0268265_10810277 3300028380 Bacteria 913
249 Ga0268264_10000207 3300028381 Bacteria 120086
250 Ga0268264_10060660 3300028381 Bacteria 3170
251 Ga0268264_10087852 3300028381 Bacteria 2674
252 Ga0268264_11891721 3300028381 Bacteria 606
253 Ga0307517_10023273 3300028786 Bacteria 7708
254 Ga0307517_10081350 3300028786 Bacteria 2762
255 Ga0307517_10370204 3300028786 Bacteria 770
256 Ga0307515_10097865 3300028794 Bacteria 3580
257 Ga0265338_10082030 3300028800 Bacteria 2701
258 Ga0265324_10123856 3300029957 Bacteria 878
259 Ga0307511_10031183 3300030521 Bacteria 4767
260 Ga0265331_10053429 3300031250 Bacteria 1927
261 Ga0265327_10001665 3300031251 Bacteria 26722
262 Ga0307513_10008370 3300031456 Bacteria 13244
263 Ga0307513_10018307 3300031456 Bacteria 8375
264 Ga0265342_10194775 3300031712 Bacteria 1104
265 Ga0307407_10469342 3300031903 Bacteria 917
266 Ga0307414_10026291 3300032004 Bacteria 3745
267 Ga0307510_10002995 3300033180 Bacteria 19438
268 Ga0373944_0019161 3300035089 Bacteria 1961
269 Ga0373936_0051323 3300035113 Bacteria 1669
270 Ga0373939_0194198 3300035114 Bacteria 764
271 Ga0373954_0319206 3300035118 Bacteria 767
272 Ga0373927_0000731 3300035695 Bacteria 25089
273 Ga0373933_0465130 3300035724 Bacteria 828
274 Ga0373937_0334853 3300036401 Bacteria 1433
275 Ga0373937_0871022 3300036401 Bacteria 849
276 Ga0373925_0000049 3300037068 Bacteria 128065
277 Ga0373925_0012468 3300037068 Bacteria 6156
278 Ga0373925_0742105 3300037068 Bacteria 809
279 Ga0395899_0000347 3300037312 Bacteria 57058
280 Ga0395899_0118749 3300037312 Bacteria 1896
281 Ga0395899_0159274 3300037312 Bacteria 1596
282 Ga0395899_0741097 3300037312 Bacteria 612
283 Ga0395900_0000008 3300037418 Bacteria 480459
284 Ga0395900_0217165 3300037418 Bacteria 1929
285 Ga0395900_0735839 3300037418 Bacteria 917
286 Ga0395898_0019949 3300037466 Bacteria 6816
287 Ga0395898_0047433 3300037466 Bacteria 4216
288 Ga0395905_0001727 3300037471 Bacteria 25583
289 Ga0395905_0004530 3300037471 Bacteria 14390
290 Ga0395905_0092692 3300037471 Bacteria 2833
291 Ga0395905_0252801 3300037471 Bacteria 1646
292 Ga0395905_0290091 3300037471 Bacteria 1523
293 Ga0395905_0365049 3300037471 Bacteria 1337
294 Ga0395905_0630923 3300037471 Bacteria 973
295 Ga0395901_0000008 3300038443 Bacteria 495962
296 Ga0395901_0090359 3300038443 Bacteria 3205
297 Ga0395901_0225322 3300038443 Bacteria 1958
298 Ga0436365_1274617 3300039437 Bacteria 3558
299 Ga0451791_0657027 3300041451 Bacteria 619
300 Ga0451804_0669531 3300041463 Bacteria 585
301 Ga0439442_041919 3300042002 Bacteria 962
302 Ga0439446_0166966 3300042156 Bacteria 730
303 Ga0466965_0241479 3300044683 Bacteria 967
304 Ga0466961_0307258 3300044693 Bacteria 968
305 Ga0466963_0478261 3300044694 Bacteria 879
306 Ga0466964_0687168 3300044706 Bacteria 569
307 Ga0466968_0441251 3300044735 Bacteria 643
308 Ga0466958_0518109 3300045836 Bacteria 774
309 Ga0466958_0903423 3300045836 Bacteria 576
310 Ga0466967_0700891 3300045976 Bacteria 1003
311 Ga0495629_0170013 3300046459 Bacteria 1513
312 Ga0495651_0380384 3300046462 Bacteria 926
313 Ga0495651_0650041 3300046462 Bacteria 661
314 Ga0495662_0216156 3300046476 Bacteria 945
315 Ga0495594_0394145 3300046499 Bacteria 788
316 Ga0495594_0455388 3300046499 Bacteria 727
317 Ga0495583_0041391 3300046506 Bacteria 2158
318 Ga0495606_0437301 3300046507 Bacteria 673
319 Ga0495610_0041861 3300046512 Bacteria 2295
320 Ga0495610_0052189 3300046512 Bacteria 1986
321 Ga0495628_0181894 3300046516 Bacteria 1590
322 Ga0495642_0014891 3300046528 Bacteria 3018
323 Ga0495642_0119731 3300046528 Bacteria 1129
324 Ga0495642_0225828 3300046528 Bacteria 818
325 Ga0495665_0062997 3300046531 Bacteria 1958
326 Ga0495621_0325176 3300046539 Bacteria 641
327 Ga0495597_0008222 3300046542 Bacteria 5243
328 Ga0495622_0091506 3300046557 Bacteria 1397
329 Ga0495668_0005630 3300046616 Bacteria 8416
330 Ga0495668_0034768 3300046616 Bacteria 2826
331 Ga0495668_0126940 3300046616 Bacteria 1396
332 Ga0495668_0210011 3300046616 Bacteria 1066
333 Ga0495668_0536904 3300046616 Bacteria 645
334 Ga0495668_0551644 3300046616 Bacteria 636
335 Ga0495611_0003099 3300046648 Bacteria 7385
336 Ga0495625_0145337 3300046660 Bacteria 1597
337 Ga0495625_0418006 3300046660 Bacteria 834
338 Ga0495625_0576445 3300046660 Bacteria 678
339 Ga0495659_0331015 3300046664 Bacteria 648
340 Ga0495588_0404357 3300046674 Bacteria 717
341 Ga0495669_0000002 3300046684 Bacteria 282777
342 Ga0495669_0011834 3300046684 Bacteria 3710
343 Ga0495669_0095151 3300046684 Bacteria 1379
344 Ga0495669_0148126 3300046684 Bacteria 1110
345 Ga0495670_0256864 3300046691 Bacteria 932
346 Ga0495677_0008910 3300047445 Bacteria 3714
347 Ga0495677_0100274 3300047445 Bacteria 1096
348 Ga0495677_0242706 3300047445 Bacteria 704
349 Ga0495593_0221780 3300047673 Bacteria 949
350 Ga0496100_0428318 3300048903 Bacteria 1011
351 Ga0496100_1280959 3300048903 Bacteria 578
352 Ga0496100_1388315 3300048903 Bacteria 554
353 Ga0496101_0352240 3300048904 Bacteria 1157
354 Ga0496101_0411640 3300048904 Bacteria 1065
355 Ga0496101_1246165 3300048904 Bacteria 582
356 Ga0496102_0044032 3300048905 Bacteria 4049
357 Ga0496103_0218890 3300048906 Bacteria 1225
358 Ga0496104_0277505 3300048907 Bacteria 1589
359 Ga0496106_0121057 3300048909 Bacteria 2046
360 Ga0496106_0180240 3300048909 Bacteria 1677
361 Ga0496106_0182934 3300048909 Bacteria 1664
362 Ga0496107_0083123 3300048910 Bacteria 2335
363 Ga0496107_0087820 3300048910 Bacteria 2270
364 Ga0496108_0405690 3300048911 Bacteria 1190
365 Ga0496109_0186633 3300048912 Bacteria 1948
366 Ga0496112_0055583 3300048915 Bacteria 3893
367 Ga0496112_0074703 3300048915 Bacteria 3352
368 Ga0496113_1131629 3300048916 Bacteria 613
369 Ga0496115_0000126 3300048918 Bacteria 69044
370 Ga0496115_0008676 3300048918 Bacteria 7531
371 Ga0496115_0641482 3300048918 Bacteria 840
372 Ga0496115_1404125 3300048918 Bacteria 515
373 Ga0496117_0049553 3300048920 Bacteria 2986
374 Ga0496118_0023311 3300048921 Bacteria 5380
375 Ga0496121_0000035 3300048924 Bacteria 374316
376 Ga0495682_0038602 3300049460 Bacteria 1755
377 Ga0501038_0697050 3300049574 Bacteria 761
378 Ga0501039_1358495 3300049575 Bacteria 547
379 Ga0501047_0100491 3300049581 Bacteria 2771
380 Ga0501047_0118453 3300049581 Bacteria 2530
381 Ga0501047_0305929 3300049581 Bacteria 1431
382 Ga0501048_0096578 3300049582 Bacteria 2084
383 Ga0501207_067864 3300049654 Bacteria 665
384 Ga0501263_047425 3300049760 Bacteria 646
385 Ga0501044_0391742 3300049823 Bacteria 1303
386 nmdc:mga03n38_271155_c1 3300050490 Bacteria 903
387 nmdc:mga00v17_491_c1 3300050491 Bacteria 22189
388 nmdc:mga0k408_6594_c3 3300050493 Bacteria 1331
389 nmdc:mga06z11_9752_c1 3300050494 Bacteria 4058
390 nmdc:mga07m45_3490_c1 3300050496 Bacteria 7581
391 nmdc:mga07m45_543804_c1 3300050496 Bacteria 672
392 nmdc:mga0sz30_129612_c1 3300050516 Bacteria 1111
393 nmdc:mga0sz30_37409_c1 3300050516 Bacteria 2031
394 Ga0500635_0000270 3300053080 Bacteria 20001
395 Ga0500647_0458180 3300053091 Bacteria 503
396 Ga0500583_0465505 3300053092 Bacteria 598
397 Ga0500651_0070734 3300053093 Bacteria 2172
398 Ga0500641_0004329 3300053096 Bacteria 5010
399 Ga0500554_199107 3300053102 Bacteria 670
400 Ga0500556_0020453 3300053104 Bacteria 2118
401 Ga0500562_001239 3300053108 Bacteria 6287
402 Ga0500569_012943 3300053109 Bacteria 2029
403 Ga0500572_002007 3300053111 Bacteria 5072
404 Ga0500594_0234966 3300053118 Bacteria 608
405 Ga0500595_107930 3300053119 Bacteria 793
406 Ga0500597_217574 3300053120 Bacteria 795
407 Ga0500607_099894 3300053121 Bacteria 1443
408 Ga0500607_100392 3300053121 Bacteria 1438
409 Ga0500608_001063 3300053122 Bacteria 9839
410 Ga0500608_031451 3300053122 Bacteria 2519
411 Ga0500642_0077908 3300053130 Bacteria 1518
412 Ga0500642_0266939 3300053130 Bacteria 782
413 Ga0500559_0392170 3300053136 Bacteria 646
414 Ga0500590_058720 3300053148 Bacteria 1937
415 Ga0500639_068560 3300053163 Bacteria 1812
416 Ga0500636_0023444 3300053177 Bacteria 3649
417 Ga0500636_0054760 3300053177 Bacteria 2338
418 Ga0500637_0017203 3300053178 Bacteria 3867
419 Ga0500637_0569351 3300053178 Bacteria 544
420 Ga0500656_003700 3300053732 Bacteria 1441
421 Ga0500596_001648 3300053735 Bacteria 4510
422 Ga0500601_010185 3300053737 Bacteria 1051
423 Ga0500661_017360 3300055283 Bacteria 1286
424 Ga0105241_10061371
425 Ga0055531_10065654
426 Ga0065165_1031597
427 Ga0070658_10109373
428 Ga0070658_10112431
429 Ga0070658_10301379
430 Ga0070658_10890168
431 Ga0070670_100000426
432 Ga0070670_100023099
433 Ga0070666_10137684
434 Ga0070666_10344425
435 Ga0070680_100074360
436 Ga0070680_100537289
437 Ga0070680_101472987
438 Ga0068868_100840529
439 Ga0070660_100242810
440 Ga0070660_100285622
441 Ga0070660_100888755
442 Ga0070668_100000042
443 Ga0070668_100001654
444 Ga0070669_100095034
445 Ga0070671_100002773
446 Ga0070671_100146593
447 Ga0070671_100179738
448 Ga0070659_100000428
449 Ga0070659_100023788
450 Ga0070667_100000168
451 Ga0070667_100001255
452 Ga0070667_100018214
453 Ga0070667_100070820
454 Ga0070667_100687603
455 Ga0070678_100964927
456 Ga0070662_100445785
457 Ga0070681_10178729
458 Ga0070681_11252838
459 Ga0068867_100795523
460 Ga0070698_101311804
461 Ga0070679_100104932
462 Ga0070679_100198518
463 Ga0070679_100198601
464 Ga0070679_100752972
465 Ga0070684_100489444
466 Ga0068853_100195007
467 Ga0070672_101085389
468 Ga0070686_100958999
469 Ga0070665_100000363
470 Ga0070665_100000593
471 Ga0070665_100000674
472 Ga0070665_100146343
473 Ga0068855_100011377
474 Ga0068855_100066245
475 Ga0068855_100084544
476 Ga0068855_100090428
477 Ga0068855_100506449
478 Ga0070664_100280338
479 Ga0068854_101079690
480 Ga0068856_100174994
481 Ga0068852_100239527
482 Ga0068852_100440256
483 Ga0068859_100000230
484 Ga0068859_100028218
485 Ga0068859_101183396
486 Ga0068864_100000135
487 Ga0068864_100007315
488 Ga0068864_100256714
489 Ga0068861_101892376
490 Ga0068870_10997424
491 Ga0068863_100000735
492 Ga0068863_100003612
493 Ga0068863_100033274
494 Ga0068863_100033622
495 Ga0068863_100218595
496 Ga0068858_100000020
497 Ga0068858_100002621
498 Ga0068858_100019958
499 Ga0068858_100801418
500 Ga0068860_100000133
501 Ga0068860_100054816
502 Ga0068862_100009611
503 Ga0068862_100025208
504 Ga0068862_100029609
505 Ga0068862_100576759
506 Ga0070717_10016497
507 Ga0075368_10001453
508 Ga0075363_100298309
509 Ga0075363_100348525
510 Ga0075364_10000647
511 Ga0075362_10117252
512 Ga0075366_10117451
513 Ga0068871_100567518
514 Ga0068865_100084452
515 Ga0097620_100000230
516 Ga0097620_100028219
517 Ga0097620_101183363
518 Ga0105250_10016327
519 Ga0105240_10000970
520 Ga0105240_10052130
521 Ga0105240_10093193
522 Ga0105240_10102623
523 Ga0105240_10128594
524 Ga0105240_12799136
525 Ga0105247_10104294
526 Ga0105247_10530729
527 Ga0105247_10922827
528 Ga0105248_10007113
529 Ga0105248_10015057
530 Ga0105248_10184585
531 Ga0105248_10310476
532 Ga0105248_10362335
533 Ga0105237_12712144
534 Ga0105238_10010874
535 Ga0105238_10013458
536 Ga0105238_10069642
537 Ga0105238_10387927
538 Ga0105238_10392353
539 Ga0105238_10496207
540 Ga0105238_12216466
541 Ga0105249_10031347
542 Ga0105249_10111245
543 Ga0105249_11174429
544 Ga0105249_11673447
545 Ga0105239_10921704
546 Ga0157370_10168673
547 Ga0157370_10554443
548 Ga0157369_10662364
549 Ga0157374_10125151
550 Ga0157374_12642713
551 Ga0163162_10108855
552 Ga0163162_10330000
553 Ga0163162_11234774
554 Ga0157372_10631682
555 Ga0157375_11067682
556 Ga0157375_11072458
557 Ga0163163_10006261
558 Ga0163163_10051200
559 Ga0163163_10066509
560 Ga0163163_10196921
561 Ga0163163_10307936
562 Ga0163163_10585246
563 Ga0163163_11799762
564 Ga0157380_13077172
565 Ga0157377_10229982
566 Ga0157379_10018770
567 Ga0157379_10019437
568 Ga0157379_10261406
569 Ga0157379_12671096
570 Ga0157376_10697903
571 Ga0157376_11822647
572 Ga0157376_12538060
573 Ga0197907_10496706
574 Ga0206356_11263106
575 Ga0213876_10478082
576 Ga0209026_1027835
577 Ga0209148_1014358
578 Ga0209257_1007869
579 Ga0207697_10053412
580 Ga0207710_10043612
581 Ga0207680_10125581
582 Ga0207680_10417831
583 Ga0207680_10704372
584 Ga0207705_10004624
585 Ga0207705_10291791
586 Ga0207705_10436609
587 Ga0207705_10448300
588 Ga0207705_11408766
589 Ga0207654_10092319
590 Ga0207707_10013146
591 Ga0207707_10161119
592 Ga0207707_10164915
593 Ga0207695_10001235
594 Ga0207695_10029689
595 Ga0207695_10039728
596 Ga0207695_10102554
597 Ga0207695_10106883
598 Ga0207660_10017814
599 Ga0207660_10439731
600 Ga0207657_10021713
601 Ga0207657_10073841
602 Ga0207657_10102315
603 Ga0207657_10312491
604 Ga0207652_10005105
605 Ga0207652_10328933
606 Ga0207652_10604697
607 Ga0207681_10005512
608 Ga0207694_10008112
609 Ga0207694_10192972
610 Ga0207694_10789645
611 Ga0207650_10000016
612 Ga0207650_10039016
613 Ga0207644_10000420
614 Ga0207644_10132290
615 Ga0207644_10175752
616 Ga0207644_10451763
617 Ga0207644_10790647
618 Ga0207690_10000373
619 Ga0207706_10020181
620 Ga0207665_10610732
621 Ga0207711_10005088
622 Ga0207711_10006868
623 Ga0207711_10030136
624 Ga0207711_10699972
625 Ga0207711_11185777
626 Ga0207679_10175432
627 Ga0207667_10024987
628 Ga0207667_10031003
629 Ga0207667_10041095
630 Ga0207667_10228158
631 Ga0207712_10016310
632 Ga0207712_10462926
633 Ga0207712_11481894
634 Ga0207668_10000401
635 Ga0207668_10002830
636 Ga0207668_10029685
637 Ga0207640_10859281
638 Ga0207658_10000399
639 Ga0207658_10003280
640 Ga0207658_10003349
641 Ga0207658_10017515
642 Ga0207658_11771805
643 Ga0207677_11329328
644 Ga0207703_10000082
645 Ga0207703_10005619
646 Ga0207703_10732104
647 Ga0207639_10058515
648 Ga0207639_10338538
649 Ga0207639_11590163
650 Ga0207639_11710076
651 Ga0207678_10188174
652 Ga0207678_11695993
653 Ga0207641_10000007
654 Ga0207641_10023383
655 Ga0207641_10025900
656 Ga0207641_10042785
657 Ga0207641_10046080
658 Ga0207676_10000241
659 Ga0207676_10000618
660 Ga0207676_10238145
661 Ga0207676_10335189
662 Ga0207675_100063442
663 Ga0207675_101140172
664 Ga0207683_11149192
665 Ga0207698_10242129
666 Ga0268266_10000003
667 Ga0268266_10012561
668 Ga0268266_10016531
669 Ga0268265_10000836
670 Ga0268265_10008007
671 Ga0268265_10810277
672 Ga0268264_10000207
673 Ga0268264_10060660
674 Ga0268264_10087852
675 Ga0268264_11891721
676 Ga0307517_10023273
677 Ga0307517_10081350
678 Ga0307517_10370204
679 Ga0307515_10097865
680 Ga0265338_10082030
681 Ga0265324_10123856
682 Ga0307511_10031183
683 Ga0265331_10053429
684 Ga0265327_10001665
685 Ga0307513_10008370
686 Ga0307513_10018307
687 Ga0265342_10194775
688 Ga0307407_10469342
689 Ga0307414_10026291
690 Ga0307510_10002995
691 Ga0373944_0019161
692 Ga0373936_0051323
693 Ga0373939_0194198
694 Ga0373954_0319206
695 Ga0373927_0000731
696 Ga0373933_0465130
697 Ga0373937_0334853
698 Ga0373937_0871022
699 Ga0373925_0000049
700 Ga0373925_0012468
701 Ga0373925_0742105
702 Ga0395899_0000347
703 Ga0395899_0118749
704 Ga0395899_0159274
705 Ga0395899_0741097
706 Ga0395900_0000008
707 Ga0395900_0217165
708 Ga0395900_0735839
709 Ga0395898_0019949
710 Ga0395898_0047433
711 Ga0395905_0001727
712 Ga0395905_0004530
713 Ga0395905_0092692
714 Ga0395905_0252801
715 Ga0395905_0290091
716 Ga0395905_0365049
717 Ga0395905_0630923
718 Ga0395901_0000008
719 Ga0395901_0090359
720 Ga0395901_0225322
721 Ga0436365_1274617
722 Ga0451791_0657027
723 Ga0451804_0669531
724 Ga0439442_041919
725 Ga0439446_0166966
726 Ga0466965_0241479
727 Ga0466961_0307258
728 Ga0466963_0478261
729 Ga0466964_0687168
730 Ga0466968_0441251
731 Ga0466958_0518109
732 Ga0466958_0903423
733 Ga0466967_0700891
734 Ga0495629_0170013
735 Ga0495651_0380384
736 Ga0495651_0650041
737 Ga0495662_0216156
738 Ga0495594_0394145
739 Ga0495594_0455388
740 Ga0495583_0041391
741 Ga0495606_0437301
742 Ga0495610_0041861
743 Ga0495610_0052189
744 Ga0495628_0181894
745 Ga0495642_0014891
746 Ga0495642_0119731
747 Ga0495642_0225828
748 Ga0495665_0062997
749 Ga0495621_0325176
750 Ga0495597_0008222
751 Ga0495622_0091506
752 Ga0495668_0005630
753 Ga0495668_0034768
754 Ga0495668_0126940
755 Ga0495668_0210011
756 Ga0495668_0536904
757 Ga0495668_0551644
758 Ga0495611_0003099
759 Ga0495625_0145337
760 Ga0495625_0418006
761 Ga0495625_0576445
762 Ga0495659_0331015
763 Ga0495588_0404357
764 Ga0495669_0000002
765 Ga0495669_0011834
766 Ga0495669_0095151
767 Ga0495669_0148126
768 Ga0495670_0256864
769 Ga0495677_0008910
770 Ga0495677_0100274
771 Ga0495677_0242706
772 Ga0495593_0221780
773 Ga0496100_0428318
774 Ga0496100_1280959
775 Ga0496100_1388315
776 Ga0496101_0352240
777 Ga0496101_0411640
778 Ga0496101_1246165
779 Ga0496102_0044032
780 Ga0496103_0218890
781 Ga0496104_0277505
782 Ga0496106_0121057
783 Ga0496106_0180240
784 Ga0496106_0182934
785 Ga0496107_0083123
786 Ga0496107_0087820
787 Ga0496108_0405690
788 Ga0496109_0186633
789 Ga0496112_0055583
790 Ga0496112_0074703
791 Ga0496113_1131629
792 Ga0496115_0000126
793 Ga0496115_0008676
794 Ga0496115_0641482
795 Ga0496115_1404125
796 Ga0496117_0049553
797 Ga0496118_0023311
798 Ga0496121_0000035
799 Ga0495682_0038602
800 Ga0501038_0697050
801 Ga0501039_1358495
802 Ga0501047_0100491
803 Ga0501047_0118453
804 Ga0501047_0305929
805 Ga0501048_0096578
806 Ga0501207_067864
807 Ga0501263_047425
808 Ga0501044_0391742
809 nmdc:mga03n38_271155_c1
810 nmdc:mga00v17_491_c1
811 nmdc:mga0k408_6594_c3
812 nmdc:mga06z11_9752_c1
813 nmdc:mga07m45_3490_c1
814 nmdc:mga07m45_543804_c1
815 nmdc:mga0sz30_129612_c1
816 nmdc:mga0sz30_37409_c1
817 Ga0500635_0000270
818 Ga0500647_0458180
819 Ga0500583_0465505
820 Ga0500651_0070734
821 Ga0500641_0004329
822 Ga0500554_199107
823 Ga0500556_0020453
824 Ga0500562_001239
825 Ga0500569_012943
826 Ga0500572_002007
827 Ga0500594_0234966
828 Ga0500595_107930
829 Ga0500597_217574
830 Ga0500607_099894
831 Ga0500607_100392
832 Ga0500608_001063
833 Ga0500608_031451
834 Ga0500642_0077908
835 Ga0500642_0266939
836 Ga0500559_0392170
837 Ga0500590_058720
838 Ga0500639_068560
839 Ga0500636_0023444
840 Ga0500636_0054760
841 Ga0500637_0017203
842 Ga0500637_0569351
843 Ga0500656_003700
844 Ga0500596_001648
845 Ga0500601_010185
846 Ga0500661_017360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

75

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgn-assembly2.cif.gz_D crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.907 14 124
7bgn-assembly1.cif.gz_B crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.8981 14 124
7bgn-assembly2.cif.gz_C crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.8944 13 124
7bgn-assembly3.cif.gz_F crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.8943 13 124
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8909 29 125
ID Description Score Start End Superfamily
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9099 25 112 3.10.20.810
af_O59667_194_289_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9033 27 112 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8858 18 112 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8857 9 112 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8802 12 112 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A7W1NGE4-F1-model_v4 deleted 0.9745 24 107
AF-A0A382FE17-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9695 7 103 GO:0000105
GO:0004635
AF-A0A7X8IDC4-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) 0.9663 24 119 GO:0000105
GO:0004635
GO:0005737
AF-A0A537Z7J7-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] 0.9636 23 123 GO:0000105
GO:0004635
GO:0004636
GO:0005524
GO:0005737
AF-A0A2E1ESR9-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9635 24 107 GO:0000105
GO:0004635

Map