F440461

General Info

Members Datasets Scaffolds Average Seq Length
423 247 846 301

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100006761|Ga0070714_10000676110
Length 312
Sequence VREEKVTIASAGLKLAGVISVPPGLRAGERRAGFLVLHGFGSNKNSQNVLAPCKVLDELGYVTLRFDMRGCGESEGEHGRVICLDQVEDTRNALSYLSRHPAIAPNRIAVIGTSFGGAVAVYAAGIDPRIAAVISNGGWGDGERKFRGQHATPEAWARFTAMLAEGRAHRERTGRSLMVPRYDIVPIPARLRDDLAGRAVQMFPTGTIEXXXAETAQSMFDFRADDVVGRIAPRPLLLLHSANDSVTPTEQSVEMFKRAGQPTELHLFSGLDHFMFAEDNARVWRVIDDWLKNYFPSIITARADADAVESAG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 10.17
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100006761 3300005435 Bacteria 8889
2 Ga0065715_10002502 3300005293 Bacteria 5470
3 Ga0065707_10011838 3300005295 Bacteria 2307
4 Ga0070683_100055555 3300005329 Bacteria 3675
5 Ga0070690_100007990 3300005330 Bacteria 6072
6 Ga0070690_100018455 3300005330 Bacteria 4214
7 Ga0070670_100009168 3300005331 Bacteria 8459
8 Ga0070670_100036084 3300005331 Bacteria 4255
9 Ga0070680_100461743 3300005336 Bacteria 1085
10 Ga0070660_100009556 3300005339 Bacteria 6828
11 Ga0070689_100001147 3300005340 Bacteria 16737
12 Ga0070689_100255356 3300005340 Bacteria 1447
13 Ga0070689_100460927 3300005340 Bacteria 1083
14 Ga0070691_10084354 3300005341 Bacteria 1559
15 Ga0070661_100180723 3300005344 Bacteria 1605
16 Ga0070692_10118895 3300005345 Bacteria 1471
17 Ga0070674_100111123 3300005356 Bacteria 2012
18 Ga0070673_100379587 3300005364 Bacteria 1260
19 Ga0070667_100108273 3300005367 Bacteria 2407
20 Ga0070714_100099855 3300005435 Bacteria 2555
21 Ga0070714_100240904 3300005435 Bacteria 1669
22 Ga0070713_100050010 3300005436 Bacteria 3450
23 Ga0070713_100127349 3300005436 Bacteria 2241
24 Ga0070713_100134373 3300005436 Bacteria 2184
25 Ga0070713_100136592 3300005436 Bacteria 2167
26 Ga0070713_100158958 3300005436 Unclassified 2016
27 Ga0070701_10006538 3300005438 Bacteria 4912
28 Ga0070694_100216151 3300005444 Bacteria 1436
29 Ga0070708_100059978 3300005445 Bacteria 3394
30 Ga0070678_100125517 3300005456 Bacteria 2031
31 Ga0070662_100134342 3300005457 Bacteria 1911
32 Ga0070681_10107554 3300005458 Bacteria 2729
33 Ga0070699_100035482 3300005518 Bacteria 4310
34 Ga0070672_100102412 3300005543 Bacteria 2324
35 Ga0070686_100017006 3300005544 Bacteria 4241
36 Ga0068855_100483903 3300005563 Bacteria 1347
37 Ga0070664_100221343 3300005564 Bacteria 1693
38 Ga0068859_100256355 3300005617 Bacteria 1840
39 Ga0068864_100178780 3300005618 Bacteria 1939
40 Ga0068862_100050385 3300005844 Bacteria 3558
41 Ga0081455_10002226 3300005937 Bacteria 23089
42 Ga0081455_10191058 3300005937 Bacteria 1542
43 Ga0081538_10018495 3300005981 Bacteria 5230
44 Ga0081540_1030530 3300005983 Bacteria 2982
45 Ga0070717_10023587 3300006028 Bacteria 4877
46 Ga0070717_10059177 3300006028 Bacteria 3169
47 Ga0075365_10010391 3300006038 Bacteria 5419
48 Ga0075365_10036977 3300006038 Bacteria 3167
49 Ga0070715_10071014 3300006163 Bacteria 1556
50 Ga0070715_10106162 3300006163 Bacteria 1318
51 Ga0070716_100013400 3300006173 Bacteria 4177
52 Ga0070716_100035211 3300006173 Bacteria 2752
53 Ga0070712_100000645 3300006175 Bacteria 20511
54 Ga0075370_10054054 3300006353 Bacteria 2279
55 Ga0068871_100287918 3300006358 Bacteria 1439
56 Ga0075428_100092234 3300006844 Bacteria 3302
57 Ga0075428_100146691 3300006844 Bacteria 2564
58 Ga0075428_100350381 3300006844 Bacteria 1585
59 Ga0075428_100640333 3300006844 Bacteria 1134
60 Ga0075430_100000278 3300006846 Bacteria 35937
61 Ga0075430_100223391 3300006846 Bacteria 1562
62 Ga0075430_100440999 3300006846 Bacteria 1075
63 Ga0075431_100052433 3300006847 Bacteria 4207
64 Ga0075431_100127355 3300006847 Bacteria 2627
65 Ga0075431_100134167 3300006847 Bacteria 2552
66 Ga0075431_100446890 3300006847 Unclassified 1289
67 Ga0075434_100028327 3300006871 Bacteria 5502
68 Ga0075434_100102554 3300006871 Bacteria 2869
69 Ga0075434_100170439 3300006871 Bacteria 2197
70 Ga0075434_100286579 3300006871 Bacteria 1667
71 Ga0075429_100143559 3300006880 Bacteria 2089
72 Ga0075429_100163247 3300006880 Bacteria 1951
73 Ga0068865_100111850 3300006881 Bacteria 2016
74 Ga0068865_100123677 3300006881 Bacteria 1928
75 Ga0075436_100001974 3300006914 Bacteria 14145
76 Ga0075436_100048251 3300006914 Unclassified 2938
77 Ga0075436_100178601 3300006914 Bacteria 1500
78 Ga0097620_100256354 3300006931 Bacteria 1840
79 Ga0075435_100074576 3300007076 Bacteria 2776
80 Ga0075435_100258600 3300007076 Bacteria 1483
81 Ga0099795_10058317 3300007788 Bacteria 1425
82 Ga0111539_10029822 3300009094 Bacteria 6638
83 Ga0111539_10086165 3300009094 Bacteria 3691
84 Ga0105247_10008138 3300009101 Bacteria 6404
85 Ga0114129_10006409 3300009147 Bacteria 16683
86 Ga0114129_10009568 3300009147 Bacteria 13824
87 Ga0114129_10009585 3300009147 Bacteria 13812
88 Ga0114129_10031509 3300009147 Bacteria 7495
89 Ga0114129_10120892 3300009147 Bacteria 3605
90 Ga0114129_10283206 3300009147 Bacteria 2214
91 Ga0114129_10485531 3300009147 Bacteria 1616
92 Ga0114129_10648405 3300009147 Bacteria 1363
93 Ga0114129_10923554 3300009147 Bacteria 1104
94 Ga0105243_10183281 3300009148 Unclassified 1823
95 Ga0105243_10366526 3300009148 Bacteria 1328
96 Ga0105248_10008572 3300009177 Bacteria 11225
97 Ga0105239_10235138 3300010375 Bacteria 2056
98 Ga0105246_10019058 3300011119 Bacteria 4378
99 Ga0157374_10039740 3300013296 Bacteria 4330
100 Ga0157374_10319932 3300013296 Bacteria 1537
101 Ga0157378_10075116 3300013297 Bacteria 3042
102 Ga0163162_10209729 3300013306 Bacteria 2078
103 Ga0157375_10905392 3300013308 Bacteria 1026
104 Ga0163163_10084224 3300014325 Bacteria 3185
105 Ga0157380_10090155 3300014326 Bacteria 2528
106 Ga0157376_10208966 3300014969 Bacteria 1801
107 Ga0213876_10029238 3300021384 Bacteria 2905
108 Ga0213875_10000012 3300021388 Bacteria 312017
109 Ga0224572_1002452 3300024225 Bacteria 2997
110 Ga0207697_10049339 3300025315 Bacteria 1737
111 Ga0207692_10010022 3300025898 Bacteria 3976
112 Ga0207692_10125626 3300025898 Bacteria 1442
113 Ga0207680_10154491 3300025903 Bacteria 1533
114 Ga0207685_10014696 3300025905 Bacteria 2457
115 Ga0207685_10093978 3300025905 Bacteria 1269
116 Ga0207645_10022750 3300025907 Bacteria 4075
117 Ga0207643_10000233 3300025908 Bacteria 38972
118 Ga0207684_10015045 3300025910 Bacteria 6661
119 Ga0207707_10339084 3300025912 Bacteria 1296
120 Ga0207707_10341864 3300025912 Bacteria 1290
121 Ga0207671_10253318 3300025914 Bacteria 1384
122 Ga0207693_10002646 3300025915 Bacteria 15552
123 Ga0207663_10283116 3300025916 Bacteria 1232
124 Ga0207660_10068601 3300025917 Bacteria 2572
125 Ga0207657_10032562 3300025919 Bacteria 4708
126 Ga0207657_10032876 3300025919 Bacteria 4681
127 Ga0207646_10187299 3300025922 Bacteria 1869
128 Ga0207650_10005584 3300025925 Bacteria 8589
129 Ga0207700_10059075 3300025928 Bacteria 2899
130 Ga0207700_10068372 3300025928 Unclassified 2723
131 Ga0207700_10124260 3300025928 Bacteria 2096
132 Ga0207700_10145653 3300025928 Unclassified 1952
133 Ga0207700_10151878 3300025928 Bacteria 1915
134 Ga0207664_10002993 3300025929 Bacteria 11226
135 Ga0207664_10091905 3300025929 Bacteria 2490
136 Ga0207664_10249074 3300025929 Bacteria 1550
137 Ga0207664_10416306 3300025929 Bacteria 1197
138 Ga0207706_10003937 3300025933 Bacteria 14075
139 Ga0207686_10503547 3300025934 Bacteria 940
140 Ga0207709_10038446 3300025935 Bacteria 2850
141 Ga0207670_10001831 3300025936 Bacteria 11086
142 Ga0207670_10273081 3300025936 Bacteria 1315
143 Ga0207669_10014000 3300025937 Bacteria 4007
144 Ga0207704_10202383 3300025938 Bacteria 1454
145 Ga0207665_10002244 3300025939 Bacteria 13048
146 Ga0207665_10127818 3300025939 Bacteria 1801
147 Ga0207691_10002058 3300025940 Bacteria 19664
148 Ga0207691_10112404 3300025940 Bacteria 2421
149 Ga0207711_10012174 3300025941 Bacteria 7151
150 Ga0207661_10188028 3300025944 Bacteria 1809
151 Ga0207679_10074539 3300025945 Bacteria 2572
152 Ga0207651_10178001 3300025960 Bacteria 1684
153 Ga0207640_10041510 3300025981 Bacteria 2927
154 Ga0207708_10001432 3300026075 Bacteria 17899
155 Ga0207648_10004051 3300026089 Bacteria 15208
156 Ga0207648_10025809 3300026089 Bacteria 5228
157 Ga0207676_10023929 3300026095 Bacteria 4514
158 Ga0207676_10070310 3300026095 Bacteria 2806
159 Ga0207675_100005973 3300026118 Bacteria 11600
160 Ga0207683_10111032 3300026121 Bacteria 2455
161 Ga0207683_10179758 3300026121 Bacteria 1918
162 Ga0207698_10135329 3300026142 Bacteria 2113
163 Ga0268266_10197417 3300028379 Bacteria 1840
164 Ga0265760_10017389 3300031090 Bacteria 2065
165 Ga0265760_10036530 3300031090 Bacteria 1457
166 Ga0265325_10004989 3300031241 Bacteria 8271
167 Ga0265325_10010730 3300031241 Bacteria 5286
168 Ga0265339_10000133 3300031249 Bacteria 60726
169 Ga0265313_10000756 3300031595 Bacteria 33038
170 Ga0373926_0015421 3300035083 Unclassified 2605
171 Ga0373940_0067743 3300035088 Bacteria 1033
172 Ga0373944_0003603 3300035089 Bacteria 4004
173 Ga0373923_0073536 3300035111 Bacteria 1472
174 Ga0373932_0010731 3300035112 Bacteria 2224
175 Ga0373945_0001105 3300035116 Bacteria 8138
176 Ga0373945_0003901 3300035116 Bacteria 4712
177 Ga0373945_0016714 3300035116 Bacteria 2478
178 Ga0373945_0047225 3300035116 Bacteria 1574
179 Ga0373953_0018716 3300035117 Bacteria 2567
180 Ga0373956_0161771 3300035119 Bacteria 1055
181 Ga0373960_0015195 3300035121 Bacteria 1961
182 Ga0373943_0000243 3300035170 Bacteria 22511
183 Ga0373943_0003448 3300035170 Bacteria 7194
184 Ga0373943_0075093 3300035170 Bacteria 1721
185 Ga0373946_0002288 3300035171 Bacteria 6774
186 Ga0373946_0013644 3300035171 Unclassified 3056
187 Ga0373946_0050562 3300035171 Bacteria 1736
188 Ga0373924_0007406 3300035410 Bacteria 3963
189 Ga0373924_0028592 3300035410 Bacteria 2223
190 Ga0373931_0141982 3300035691 Bacteria 1392
191 Ga0373935_0000598 3300035692 Bacteria 18824
192 Ga0373935_0017709 3300035692 Bacteria 4327
193 Ga0373935_0032810 3300035692 Bacteria 3228
194 Ga0373927_0000839 3300035695 Bacteria 23542
195 Ga0373927_0006603 3300035695 Bacteria 7902
196 Ga0373927_0007788 3300035695 Bacteria 7245
197 Ga0373927_0030955 3300035695 Bacteria 3491
198 Ga0373927_0109839 3300035695 Bacteria 1796
199 Ga0373927_0329991 3300035695 Bacteria 1005
200 Ga0373933_0001806 3300035724 Bacteria 12406
201 Ga0373933_0041710 3300035724 Bacteria 2710
202 Ga0373947_0000796 3300035725 Bacteria 18989
203 Ga0373947_0008737 3300035725 Bacteria 5825
204 Ga0373937_0001350 3300036401 Bacteria 20525
205 Ga0373925_0002878 3300037068 Bacteria 13591
206 Ga0373925_0002955 3300037068 Bacteria 13418
207 Ga0436364_0553890 3300037853 Bacteria 33608
208 Ga0436365_1460405 3300039437 Bacteria 2566
209 Ga0436361_0953528 3300039447 Bacteria 2944
210 Ga0439453_0002368 3300041408 Bacteria 2591
211 Ga0466963_0148308 3300044694 Bacteria 1628
212 Ga0495592_0208637 3300046454 Bacteria 1313
213 Ga0495629_0003954 3300046459 Bacteria 11147
214 Ga0495629_0023942 3300046459 Bacteria 4349
215 Ga0495629_0032208 3300046459 Bacteria 3712
216 Ga0495638_0045478 3300046460 Bacteria 2761
217 Ga0495641_0018282 3300046461 Bacteria 3620
218 Ga0495651_0003136 3300046462 Bacteria 12751
219 Ga0495653_0002800 3300046463 Bacteria 13921
220 Ga0495653_0062075 3300046463 Unclassified 2825
221 Ga0495580_0011940 3300046472 Bacteria 6695
222 Ga0495580_0045894 3300046472 Bacteria 3102
223 Ga0495582_0004015 3300046473 Bacteria 8261
224 Ga0495582_0081337 3300046473 Bacteria 1799
225 Ga0495639_0012775 3300046475 Bacteria 3623
226 Ga0495662_0004502 3300046476 Bacteria 6992
227 Ga0495662_0007364 3300046476 Bacteria 5440
228 Ga0495664_0004943 3300046477 Bacteria 7299
229 Ga0495584_0078851 3300046491 Bacteria 1657
230 Ga0495584_0107183 3300046491 Bacteria 1413
231 Ga0495585_0036517 3300046492 Bacteria 2770
232 Ga0495594_0089840 3300046499 Bacteria 1721
233 Ga0495596_0076296 3300046500 Bacteria 1302
234 Ga0495608_0000379 3300046511 Bacteria 30996
235 Ga0495608_0170049 3300046511 Unclassified 1383
236 Ga0495616_0081651 3300046513 Bacteria 1546
237 Ga0495618_0005224 3300046514 Bacteria 7934
238 Ga0495628_0094391 3300046516 Bacteria 2312
239 Ga0495630_0007391 3300046517 Bacteria 7849
240 Ga0495630_0031890 3300046517 Unclassified 3924
241 Ga0495630_0094015 3300046517 Bacteria 2266
242 Ga0495630_0278742 3300046517 Bacteria 1277
243 Ga0495644_0065793 3300046523 Bacteria 1362
244 Ga0495666_0025940 3300046526 Bacteria 2893
245 Ga0495666_0167360 3300046526 Bacteria 1017
246 Ga0495652_0003814 3300046529 Bacteria 14718
247 Ga0495652_0010662 3300046529 Bacteria 8324
248 Ga0495665_0006123 3300046531 Bacteria 6495
249 Ga0495665_0034448 3300046531 Unclassified 2708
250 Ga0495665_0053750 3300046531 Bacteria 2129
251 Ga0495640_0003784 3300046533 Bacteria 12141
252 Ga0495640_0020708 3300046533 Bacteria 4836
253 Ga0495587_0002257 3300046536 Bacteria 12879
254 Ga0495621_0002975 3300046539 Bacteria 4624
255 Ga0495645_0028136 3300046543 Bacteria 4084
256 Ga0495622_0027691 3300046557 Bacteria 2645
257 Ga0495667_0001200 3300046559 Bacteria 16934
258 Ga0495656_0018248 3300046615 Bacteria 2690
259 Ga0495656_0065875 3300046615 Bacteria 1594
260 Ga0495634_0003473 3300046642 Bacteria 12621
261 Ga0495634_0004100 3300046642 Bacteria 11540
262 Ga0495634_0048833 3300046642 Bacteria 2847
263 Ga0495611_0153096 3300046648 Bacteria 1076
264 Ga0495635_0003010 3300046663 Bacteria 11578
265 Ga0495635_0007177 3300046663 Bacteria 7781
266 Ga0495599_0128934 3300046678 Bacteria 1571
267 Ga0495623_0001652 3300046679 Bacteria 14988
268 Ga0495658_0033103 3300046683 Bacteria 2828
269 Ga0495658_0196917 3300046683 Bacteria 1255
270 Ga0495613_0012977 3300046689 Bacteria 6190
271 Ga0495613_0177573 3300046689 Bacteria 1509
272 Ga0495613_0223419 3300046689 Bacteria 1321
273 Ga0495624_0002424 3300046690 Bacteria 14161
274 Ga0495624_0012238 3300046690 Bacteria 5873
275 Ga0495624_0017206 3300046690 Bacteria 4859
276 Ga0495670_0010680 3300046691 Bacteria 4514
277 Ga0495671_0057464 3300046692 Bacteria 1925
278 Ga0495589_0035095 3300046794 Bacteria 2516
279 Ga0495600_0000686 3300046809 Bacteria 17690
280 Ga0495581_0200104 3300047315 Bacteria 1169
281 Ga0495604_0000130 3300047317 Bacteria 63418
282 Ga0495674_0010265 3300047319 Bacteria 8868
283 Ga0495674_0403938 3300047319 Bacteria 1102
284 Ga0495676_0038892 3300047321 Bacteria 3946
285 Ga0495676_0081911 3300047321 Bacteria 2444
286 Ga0495680_0002073 3300047322 Bacteria 20877
287 Ga0495675_0004271 3300047444 Bacteria 8643
288 Ga0495684_0000987 3300047471 Bacteria 23140
289 Ga0495684_0006357 3300047471 Bacteria 9179
290 Ga0495684_0209312 3300047471 Bacteria 1435
291 Ga0495593_0017000 3300047673 Bacteria 4094
292 Ga0495602_0000910 3300048088 Bacteria 28607
293 Ga0496100_0004607 3300048903 Bacteria 7327
294 Ga0496100_0011284 3300048903 Bacteria 5083
295 Ga0496100_0117645 3300048903 Bacteria 1855
296 Ga0496100_0137458 3300048903 Bacteria 1728
297 Ga0496101_0003621 3300048904 Bacteria 9644
298 Ga0496101_0103074 3300048904 Bacteria 2138
299 Ga0496102_0040534 3300048905 Bacteria 4212
300 Ga0496102_0075136 3300048905 Bacteria 3106
301 Ga0496102_0103442 3300048905 Bacteria 2648
302 Ga0496102_0266278 3300048905 Bacteria 1616
303 Ga0496102_0510154 3300048905 Bacteria 1125
304 Ga0496103_0078980 3300048906 Bacteria 2067
305 Ga0496104_0002453 3300048907 Bacteria 15971
306 Ga0496104_0058852 3300048907 Bacteria 3637
307 Ga0496105_0006379 3300048908 Bacteria 9063
308 Ga0496105_0006610 3300048908 Bacteria 8926
309 Ga0496105_0012064 3300048908 Bacteria 6841
310 Ga0496105_0012233 3300048908 Bacteria 6794
311 Ga0496105_0165649 3300048908 Bacteria 1813
312 Ga0496106_0025829 3300048909 Bacteria 4370
313 Ga0496106_0043756 3300048909 Bacteria 3360
314 Ga0496107_0070227 3300048910 Bacteria 2542
315 Ga0496108_0001743 3300048911 Bacteria 17272
316 Ga0496108_0004886 3300048911 Bacteria 10821
317 Ga0496109_0037926 3300048912 Bacteria 4355
318 Ga0496109_0073017 3300048912 Bacteria 3152
319 Ga0496109_0232833 3300048912 Bacteria 1733
320 Ga0496110_0001386 3300048913 Bacteria 17473
321 Ga0496110_0352511 3300048913 Bacteria 1340
322 Ga0496111_0011122 3300048914 Bacteria 6058
323 Ga0496111_0182819 3300048914 Bacteria 1558
324 Ga0496112_0001217 3300048915 Bacteria 19356
325 Ga0496112_0026699 3300048915 Bacteria 5562
326 Ga0496112_0238688 3300048915 Bacteria 1771
327 Ga0496112_0305391 3300048915 Bacteria 1536
328 Ga0496113_0000800 3300048916 Bacteria 16318
329 Ga0496114_0008675 3300048917 Bacteria 8055
330 Ga0496114_0015733 3300048917 Bacteria 6087
331 Ga0496114_0090584 3300048917 Bacteria 2596
332 Ga0496115_0013868 3300048918 Bacteria 6103
333 Ga0496115_0022336 3300048918 Bacteria 4900
334 Ga0496115_0199809 3300048918 Bacteria 1651
335 Ga0496115_0307816 3300048918 Bacteria 1297
336 Ga0501031_0200850 3300049568 Bacteria 1301
337 Ga0501032_0031276 3300049569 Bacteria 3649
338 Ga0501033_0017432 3300049570 Bacteria 5425
339 Ga0501034_0031226 3300049571 Bacteria 5412
340 Ga0501034_0076338 3300049571 Bacteria 3357
341 Ga0501036_0005121 3300049572 Bacteria 10594
342 Ga0501037_0049261 3300049573 Bacteria 3085
343 Ga0501038_0001023 3300049574 Bacteria 25193
344 Ga0501039_0002839 3300049575 Bacteria 12948
345 Ga0501039_0146175 3300049575 Bacteria 1858
346 Ga0501039_0236260 3300049575 Bacteria 1437
347 Ga0501039_0444777 3300049575 Bacteria 1018
348 Ga0501041_0110326 3300049577 Bacteria 1707
349 Ga0501043_0013133 3300049579 Bacteria 6476
350 Ga0501046_0002410 3300049580 Bacteria 17528
351 Ga0501047_0017302 3300049581 Bacteria 6903
352 Ga0501048_0009776 3300049582 Bacteria 7191
353 Ga0501067_0018780 3300049583 Bacteria 3827
354 Ga0501068_0003620 3300049584 Bacteria 8357
355 Ga0501069_0002609 3300049585 Bacteria 9192
356 Ga0501069_0115144 3300049585 Bacteria 1533
357 Ga0501070_0024417 3300049586 Bacteria 5071
358 Ga0501071_0016040 3300049587 Bacteria 5147
359 Ga0501071_0291617 3300049587 Bacteria 1236
360 Ga0501072_0037228 3300049588 Bacteria 3816
361 Ga0501072_0051264 3300049588 Bacteria 3250
362 Ga0501072_0265926 3300049588 Bacteria 1365
363 Ga0501073_0020659 3300049589 Bacteria 4749
364 Ga0501074_0001473 3300049590 Bacteria 15819
365 Ga0501076_0111868 3300049592 Bacteria 2208
366 Ga0501076_0239382 3300049592 Bacteria 1485
367 Ga0501076_0452242 3300049592 Bacteria 1057
368 Ga0501077_0303090 3300049593 Bacteria 1018
369 Ga0501079_0065752 3300049741 Bacteria 2798
370 Ga0501080_0019466 3300049742 Bacteria 6286
371 Ga0501080_0117065 3300049742 Bacteria 2470
372 Ga0501080_0173237 3300049742 Bacteria 1989
373 Ga0501080_0528614 3300049742 Bacteria 1052
374 Ga0501083_0077456 3300049744 Bacteria 2206
375 Ga0501035_0098821 3300049822 Bacteria 2562
376 Ga0501044_0000260 3300049823 Bacteria 67087
377 Ga0501044_0041091 3300049823 Bacteria 4814
378 Ga0501044_0564335 3300049823 Bacteria 1034
379 Ga0501045_0011794 3300049824 Bacteria 6140
380 nmdc:mga03683_9717_c2 3300050489 Bacteria 3036
381 nmdc:mga00v17_41631_c1 3300050491 Bacteria 2760
382 nmdc:mga0yw44_10381_c1 3300050492 Bacteria 4755
383 nmdc:mga0yw44_51509_c1 3300050492 Bacteria 2493
384 nmdc:mga0yw44_6599_c1 3300050492 Bacteria 5622
385 nmdc:mga0k408_3532_c1 3300050493 Bacteria 8256
386 nmdc:mga07m45_24358_c1 3300050496 Bacteria 3314
387 nmdc:mga05p37_140746_c1 3300050507 Bacteria 2956
388 nmdc:mga05p37_339752_c1 3300050507 Bacteria 1771
389 nmdc:mga05p37_384417_c1 3300050507 Bacteria 1644
390 nmdc:mga05p37_529691_c1 3300050507 Bacteria 1346
391 nmdc:mga05p37_563819_c1 3300050507 Bacteria 1293
392 nmdc:mga05p37_637158_c1 3300050507 Bacteria 1196
393 nmdc:mga05p37_69649_c1 3300050507 Bacteria 4327
394 nmdc:mga06r32_135016_c1 3300050510 Bacteria 2442
395 nmdc:mga06r32_35413_c1 3300050510 Bacteria 4710
396 nmdc:mga06r32_472632_c1 3300050510 Bacteria 1232
397 nmdc:mga06r32_521618_c1 3300050510 Unclassified 1164
398 nmdc:mga06r32_90658_c1 3300050510 Bacteria 2987
399 nmdc:mga0n895_108682_c1 3300050512 Bacteria 2788
400 nmdc:mga0n895_136121_c1 3300050512 Unclassified 2483
401 nmdc:mga0n895_3705_c1 3300050512 Bacteria 12356
402 nmdc:mga0a205_141770_c1 3300050515 Bacteria 2303
403 Ga0495601_0000839 3300053077 Bacteria 16676
404 Ga0495601_0004604 3300053077 Bacteria 7979
405 Ga0495612_0000251 3300053078 Bacteria 22251
406 Ga0495612_0002301 3300053078 Bacteria 7865
407 Ga0495595_0000137 3300053084 Bacteria 30537
408 Ga0495595_0006784 3300053084 Bacteria 4673
409 Ga0495595_0109860 3300053084 Bacteria 1336
410 Ga0495619_0001061 3300053085 Bacteria 18026
411 Ga0495619_0002085 3300053085 Bacteria 13284
412 Ga0495619_0036745 3300053085 Unclassified 3191
413 Ga0495619_0041715 3300053085 Bacteria 3003
414 Ga0495619_0070010 3300053085 Bacteria 2346
415 Ga0495619_0094781 3300053085 Bacteria 2025
416 Ga0495619_0117098 3300053085 Bacteria 1824
417 Ga0500641_0049533 3300053096 Bacteria 1723
418 Ga0500642_0014988 3300053130 Bacteria 2900
419 Ga0501084_0004432 3300054114 Bacteria 11456
420 Ga0501084_0321984 3300054114 Bacteria 1306
421 Ga0501082_0027693 3300060353 Bacteria 4878
422 Ga0501082_0330498 3300060353 Bacteria 1328
423 Ga0530510_0094215 3300061734 Bacteria 2187
424 Ga0070714_100006761
425 Ga0065715_10002502
426 Ga0065707_10011838
427 Ga0070683_100055555
428 Ga0070690_100007990
429 Ga0070690_100018455
430 Ga0070670_100009168
431 Ga0070670_100036084
432 Ga0070680_100461743
433 Ga0070660_100009556
434 Ga0070689_100001147
435 Ga0070689_100255356
436 Ga0070689_100460927
437 Ga0070691_10084354
438 Ga0070661_100180723
439 Ga0070692_10118895
440 Ga0070674_100111123
441 Ga0070673_100379587
442 Ga0070667_100108273
443 Ga0070714_100099855
444 Ga0070714_100240904
445 Ga0070713_100050010
446 Ga0070713_100127349
447 Ga0070713_100134373
448 Ga0070713_100136592
449 Ga0070713_100158958
450 Ga0070701_10006538
451 Ga0070694_100216151
452 Ga0070708_100059978
453 Ga0070678_100125517
454 Ga0070662_100134342
455 Ga0070681_10107554
456 Ga0070699_100035482
457 Ga0070672_100102412
458 Ga0070686_100017006
459 Ga0068855_100483903
460 Ga0070664_100221343
461 Ga0068859_100256355
462 Ga0068864_100178780
463 Ga0068862_100050385
464 Ga0081455_10002226
465 Ga0081455_10191058
466 Ga0081538_10018495
467 Ga0081540_1030530
468 Ga0070717_10023587
469 Ga0070717_10059177
470 Ga0075365_10010391
471 Ga0075365_10036977
472 Ga0070715_10071014
473 Ga0070715_10106162
474 Ga0070716_100013400
475 Ga0070716_100035211
476 Ga0070712_100000645
477 Ga0075370_10054054
478 Ga0068871_100287918
479 Ga0075428_100092234
480 Ga0075428_100146691
481 Ga0075428_100350381
482 Ga0075428_100640333
483 Ga0075430_100000278
484 Ga0075430_100223391
485 Ga0075430_100440999
486 Ga0075431_100052433
487 Ga0075431_100127355
488 Ga0075431_100134167
489 Ga0075431_100446890
490 Ga0075434_100028327
491 Ga0075434_100102554
492 Ga0075434_100170439
493 Ga0075434_100286579
494 Ga0075429_100143559
495 Ga0075429_100163247
496 Ga0068865_100111850
497 Ga0068865_100123677
498 Ga0075436_100001974
499 Ga0075436_100048251
500 Ga0075436_100178601
501 Ga0097620_100256354
502 Ga0075435_100074576
503 Ga0075435_100258600
504 Ga0099795_10058317
505 Ga0111539_10029822
506 Ga0111539_10086165
507 Ga0105247_10008138
508 Ga0114129_10006409
509 Ga0114129_10009568
510 Ga0114129_10009585
511 Ga0114129_10031509
512 Ga0114129_10120892
513 Ga0114129_10283206
514 Ga0114129_10485531
515 Ga0114129_10648405
516 Ga0114129_10923554
517 Ga0105243_10183281
518 Ga0105243_10366526
519 Ga0105248_10008572
520 Ga0105239_10235138
521 Ga0105246_10019058
522 Ga0157374_10039740
523 Ga0157374_10319932
524 Ga0157378_10075116
525 Ga0163162_10209729
526 Ga0157375_10905392
527 Ga0163163_10084224
528 Ga0157380_10090155
529 Ga0157376_10208966
530 Ga0213876_10029238
531 Ga0213875_10000012
532 Ga0224572_1002452
533 Ga0207697_10049339
534 Ga0207692_10010022
535 Ga0207692_10125626
536 Ga0207680_10154491
537 Ga0207685_10014696
538 Ga0207685_10093978
539 Ga0207645_10022750
540 Ga0207643_10000233
541 Ga0207684_10015045
542 Ga0207707_10339084
543 Ga0207707_10341864
544 Ga0207671_10253318
545 Ga0207693_10002646
546 Ga0207663_10283116
547 Ga0207660_10068601
548 Ga0207657_10032562
549 Ga0207657_10032876
550 Ga0207646_10187299
551 Ga0207650_10005584
552 Ga0207700_10059075
553 Ga0207700_10068372
554 Ga0207700_10124260
555 Ga0207700_10145653
556 Ga0207700_10151878
557 Ga0207664_10002993
558 Ga0207664_10091905
559 Ga0207664_10249074
560 Ga0207664_10416306
561 Ga0207706_10003937
562 Ga0207686_10503547
563 Ga0207709_10038446
564 Ga0207670_10001831
565 Ga0207670_10273081
566 Ga0207669_10014000
567 Ga0207704_10202383
568 Ga0207665_10002244
569 Ga0207665_10127818
570 Ga0207691_10002058
571 Ga0207691_10112404
572 Ga0207711_10012174
573 Ga0207661_10188028
574 Ga0207679_10074539
575 Ga0207651_10178001
576 Ga0207640_10041510
577 Ga0207708_10001432
578 Ga0207648_10004051
579 Ga0207648_10025809
580 Ga0207676_10023929
581 Ga0207676_10070310
582 Ga0207675_100005973
583 Ga0207683_10111032
584 Ga0207683_10179758
585 Ga0207698_10135329
586 Ga0268266_10197417
587 Ga0265760_10017389
588 Ga0265760_10036530
589 Ga0265325_10004989
590 Ga0265325_10010730
591 Ga0265339_10000133
592 Ga0265313_10000756
593 Ga0373926_0015421
594 Ga0373940_0067743
595 Ga0373944_0003603
596 Ga0373923_0073536
597 Ga0373932_0010731
598 Ga0373945_0001105
599 Ga0373945_0003901
600 Ga0373945_0016714
601 Ga0373945_0047225
602 Ga0373953_0018716
603 Ga0373956_0161771
604 Ga0373960_0015195
605 Ga0373943_0000243
606 Ga0373943_0003448
607 Ga0373943_0075093
608 Ga0373946_0002288
609 Ga0373946_0013644
610 Ga0373946_0050562
611 Ga0373924_0007406
612 Ga0373924_0028592
613 Ga0373931_0141982
614 Ga0373935_0000598
615 Ga0373935_0017709
616 Ga0373935_0032810
617 Ga0373927_0000839
618 Ga0373927_0006603
619 Ga0373927_0007788
620 Ga0373927_0030955
621 Ga0373927_0109839
622 Ga0373927_0329991
623 Ga0373933_0001806
624 Ga0373933_0041710
625 Ga0373947_0000796
626 Ga0373947_0008737
627 Ga0373937_0001350
628 Ga0373925_0002878
629 Ga0373925_0002955
630 Ga0436364_0553890
631 Ga0436365_1460405
632 Ga0436361_0953528
633 Ga0439453_0002368
634 Ga0466963_0148308
635 Ga0495592_0208637
636 Ga0495629_0003954
637 Ga0495629_0023942
638 Ga0495629_0032208
639 Ga0495638_0045478
640 Ga0495641_0018282
641 Ga0495651_0003136
642 Ga0495653_0002800
643 Ga0495653_0062075
644 Ga0495580_0011940
645 Ga0495580_0045894
646 Ga0495582_0004015
647 Ga0495582_0081337
648 Ga0495639_0012775
649 Ga0495662_0004502
650 Ga0495662_0007364
651 Ga0495664_0004943
652 Ga0495584_0078851
653 Ga0495584_0107183
654 Ga0495585_0036517
655 Ga0495594_0089840
656 Ga0495596_0076296
657 Ga0495608_0000379
658 Ga0495608_0170049
659 Ga0495616_0081651
660 Ga0495618_0005224
661 Ga0495628_0094391
662 Ga0495630_0007391
663 Ga0495630_0031890
664 Ga0495630_0094015
665 Ga0495630_0278742
666 Ga0495644_0065793
667 Ga0495666_0025940
668 Ga0495666_0167360
669 Ga0495652_0003814
670 Ga0495652_0010662
671 Ga0495665_0006123
672 Ga0495665_0034448
673 Ga0495665_0053750
674 Ga0495640_0003784
675 Ga0495640_0020708
676 Ga0495587_0002257
677 Ga0495621_0002975
678 Ga0495645_0028136
679 Ga0495622_0027691
680 Ga0495667_0001200
681 Ga0495656_0018248
682 Ga0495656_0065875
683 Ga0495634_0003473
684 Ga0495634_0004100
685 Ga0495634_0048833
686 Ga0495611_0153096
687 Ga0495635_0003010
688 Ga0495635_0007177
689 Ga0495599_0128934
690 Ga0495623_0001652
691 Ga0495658_0033103
692 Ga0495658_0196917
693 Ga0495613_0012977
694 Ga0495613_0177573
695 Ga0495613_0223419
696 Ga0495624_0002424
697 Ga0495624_0012238
698 Ga0495624_0017206
699 Ga0495670_0010680
700 Ga0495671_0057464
701 Ga0495589_0035095
702 Ga0495600_0000686
703 Ga0495581_0200104
704 Ga0495604_0000130
705 Ga0495674_0010265
706 Ga0495674_0403938
707 Ga0495676_0038892
708 Ga0495676_0081911
709 Ga0495680_0002073
710 Ga0495675_0004271
711 Ga0495684_0000987
712 Ga0495684_0006357
713 Ga0495684_0209312
714 Ga0495593_0017000
715 Ga0495602_0000910
716 Ga0496100_0004607
717 Ga0496100_0011284
718 Ga0496100_0117645
719 Ga0496100_0137458
720 Ga0496101_0003621
721 Ga0496101_0103074
722 Ga0496102_0040534
723 Ga0496102_0075136
724 Ga0496102_0103442
725 Ga0496102_0266278
726 Ga0496102_0510154
727 Ga0496103_0078980
728 Ga0496104_0002453
729 Ga0496104_0058852
730 Ga0496105_0006379
731 Ga0496105_0006610
732 Ga0496105_0012064
733 Ga0496105_0012233
734 Ga0496105_0165649
735 Ga0496106_0025829
736 Ga0496106_0043756
737 Ga0496107_0070227
738 Ga0496108_0001743
739 Ga0496108_0004886
740 Ga0496109_0037926
741 Ga0496109_0073017
742 Ga0496109_0232833
743 Ga0496110_0001386
744 Ga0496110_0352511
745 Ga0496111_0011122
746 Ga0496111_0182819
747 Ga0496112_0001217
748 Ga0496112_0026699
749 Ga0496112_0238688
750 Ga0496112_0305391
751 Ga0496113_0000800
752 Ga0496114_0008675
753 Ga0496114_0015733
754 Ga0496114_0090584
755 Ga0496115_0013868
756 Ga0496115_0022336
757 Ga0496115_0199809
758 Ga0496115_0307816
759 Ga0501031_0200850
760 Ga0501032_0031276
761 Ga0501033_0017432
762 Ga0501034_0031226
763 Ga0501034_0076338
764 Ga0501036_0005121
765 Ga0501037_0049261
766 Ga0501038_0001023
767 Ga0501039_0002839
768 Ga0501039_0146175
769 Ga0501039_0236260
770 Ga0501039_0444777
771 Ga0501041_0110326
772 Ga0501043_0013133
773 Ga0501046_0002410
774 Ga0501047_0017302
775 Ga0501048_0009776
776 Ga0501067_0018780
777 Ga0501068_0003620
778 Ga0501069_0002609
779 Ga0501069_0115144
780 Ga0501070_0024417
781 Ga0501071_0016040
782 Ga0501071_0291617
783 Ga0501072_0037228
784 Ga0501072_0051264
785 Ga0501072_0265926
786 Ga0501073_0020659
787 Ga0501074_0001473
788 Ga0501076_0111868
789 Ga0501076_0239382
790 Ga0501076_0452242
791 Ga0501077_0303090
792 Ga0501079_0065752
793 Ga0501080_0019466
794 Ga0501080_0117065
795 Ga0501080_0173237
796 Ga0501080_0528614
797 Ga0501083_0077456
798 Ga0501035_0098821
799 Ga0501044_0000260
800 Ga0501044_0041091
801 Ga0501044_0564335
802 Ga0501045_0011794
803 nmdc:mga03683_9717_c2
804 nmdc:mga00v17_41631_c1
805 nmdc:mga0yw44_10381_c1
806 nmdc:mga0yw44_51509_c1
807 nmdc:mga0yw44_6599_c1
808 nmdc:mga0k408_3532_c1
809 nmdc:mga07m45_24358_c1
810 nmdc:mga05p37_140746_c1
811 nmdc:mga05p37_339752_c1
812 nmdc:mga05p37_384417_c1
813 nmdc:mga05p37_529691_c1
814 nmdc:mga05p37_563819_c1
815 nmdc:mga05p37_637158_c1
816 nmdc:mga05p37_69649_c1
817 nmdc:mga06r32_135016_c1
818 nmdc:mga06r32_35413_c1
819 nmdc:mga06r32_472632_c1
820 nmdc:mga06r32_521618_c1
821 nmdc:mga06r32_90658_c1
822 nmdc:mga0n895_108682_c1
823 nmdc:mga0n895_136121_c1
824 nmdc:mga0n895_3705_c1
825 nmdc:mga0a205_141770_c1
826 Ga0495601_0000839
827 Ga0495601_0004604
828 Ga0495612_0000251
829 Ga0495612_0002301
830 Ga0495595_0000137
831 Ga0495595_0006784
832 Ga0495595_0109860
833 Ga0495619_0001061
834 Ga0495619_0002085
835 Ga0495619_0036745
836 Ga0495619_0041715
837 Ga0495619_0070010
838 Ga0495619_0094781
839 Ga0495619_0117098
840 Ga0500641_0049533
841 Ga0500642_0014988
842 Ga0501084_0004432
843 Ga0501084_0321984
844 Ga0501082_0027693
845 Ga0501082_0330498
846 Ga0530510_0094215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08840

BAAT_C

BAAT / Acyl-CoA thioester hydrolase C terminal

87

153

0.91

PF00326

Peptidase_S9

Prolyl oligopeptidase family

48

173

0.83

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

34

280

0.8

PF12146

Hydrolase_4

Serine aminopeptidase, S33

28

280

0.78

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

39

273

0.67

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

34

286

0.53

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qjm-assembly2.cif.gz_B crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) 0.9343 2 288
7qjm-assembly2.cif.gz_B crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) 0.9187 2 288
5xb6-assembly1.cif.gz_B crystal structure of ycjy from e. coli 0.8582 1 286
2hdw-assembly1.cif.gz_A crystal structure of hypothetical protein pa2218 from pseudomonas aeruginosa 0.8546 1 286
8b4u-assembly1.cif.gz_A the crystal structure of pet46, a petase enzyme from candidatus bathyarchaeota 0.8502 1 289
ID Description Score Start End Superfamily
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9051 1 286 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8553 3 134 3.40.50.1820
af_Q54H73_43_283_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8535 2 286 3.40.50.1820
af_Q7L211_70_310_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8474 1 268 3.40.50.1820
af_P54069_41_276_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8451 1 264 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3D2BVG9-F1-model_v4 Alpha/beta hydrolase 0.9979 1 134 GO:0052689
AF-A0A3D2BRT6-F1-model_v4 Alpha/beta hydrolase 0.9893 74 288 GO:0052689
AF-A0A3D2BVG9-F1-model_v4 Alpha/beta hydrolase 0.9833 1 134 GO:0052689
AF-A0A3D2BRT6-F1-model_v4 Alpha/beta hydrolase 0.9802 74 288 GO:0052689
AF-A0A536TPK1-F1-model_v4 Alpha/beta fold hydrolase 0.9724 1 214 GO:0052689

Map